F468521

General Info

Members Datasets Scaffolds Average Seq Length
605 331 581 317

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000164|Ga0496125_0000164_6639_7616
Length 311
Sequence MLTKIRETAVALAVALTASLALAGSVHAQQKTIAIGTGGTGGVYYPLGGAIANVLSKSLPNVQATAEVTGGSVDNLKLIASGQSELGFSMADAALDALNGQDKFKSGKVPLQTLLVVYPNRMHVVTVEGTGIEKMADLKGKRVSTGSPGSATEVMAFRVLELGVAESVNAIKDRKIDAFLWVGGIPTAAVTDLAATPGLKMKLIDHSDTVEKMNAKYGKLYSASTIKAGAYPGTDKDNTIAEVWNIIVTGDKMSNDDAYNIVKTLVEKKADIVAVHKEAESFSLDNQIQERSPIPFHPGALKYFKEKGIGG

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2643221651 Afipia sp. Root123D2 Isolate Unclassified
6 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
7 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
12 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
13 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
14 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
15 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
16 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
17 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
316 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
317 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
328 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
329 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
330 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
331 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.11
Nodule 1.98
Rhizoplane 5.29
Rhizosphere 81.32
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003204 3300003203 Bacteria 7699
2 JGI25153J46596_10000848 3300003215 Bacteria 18741
3 Ga0070658_10118531 3300005327 Bacteria 2198
4 Ga0070683_100099443 3300005329 Bacteria 2738
5 Ga0070683_100295551 3300005329 Bacteria 1540
6 Ga0070690_100000791 3300005330 Bacteria 16062
7 Ga0070690_100055664 3300005330 Bacteria 2534
8 Ga0070670_100025554 3300005331 Bacteria 5080
9 Ga0070670_100185088 3300005331 Bacteria 1808
10 Ga0070670_100219266 3300005331 Bacteria 1655
11 Ga0070677_10075644 3300005333 Bacteria 1428
12 Ga0068869_100001018 3300005334 Bacteria 16298
13 Ga0070666_10117286 3300005335 Bacteria 1844
14 Ga0070666_10255695 3300005335 Bacteria 1241
15 Ga0070680_100070820 3300005336 Bacteria 2864
16 Ga0070680_100089741 3300005336 Bacteria 2543
17 Ga0070682_100047685 3300005337 Bacteria 2665
18 Ga0068868_100001147 3300005338 Bacteria 18142
19 Ga0068868_100033478 3300005338 Bacteria 3961
20 Ga0068868_100200790 3300005338 Bacteria 1662
21 Ga0070689_100005181 3300005340 Bacteria 8873
22 Ga0070691_10000180 3300005341 Bacteria 20810
23 Ga0070691_10162977 3300005341 Bacteria 1151
24 Ga0070687_100000304 3300005343 Bacteria 16643
25 Ga0070668_100017930 3300005347 Bacteria 5310
26 Ga0070668_100100845 3300005347 Bacteria 2287
27 Ga0070675_100189574 3300005354 Bacteria 1781
28 Ga0070671_100068520 3300005355 Bacteria 2959
29 Ga0070671_100093563 3300005355 Bacteria 2519
30 Ga0070671_100164986 3300005355 Bacteria 1873
31 Ga0070671_100328867 3300005355 Bacteria 1303
32 Ga0070673_100136831 3300005364 Bacteria 2063
33 Ga0070673_100193567 3300005364 Bacteria 1748
34 Ga0070673_100321477 3300005364 Bacteria 1367
35 Ga0070688_100040776 3300005365 Bacteria 2847
36 Ga0070659_100054404 3300005366 Bacteria 3152
37 Ga0070659_100104435 3300005366 Bacteria 2282
38 Ga0070667_100081864 3300005367 Bacteria 2763
39 Ga0070709_10010157 3300005434 Bacteria 5202
40 Ga0070714_100002637 3300005435 Bacteria 13209
41 Ga0070713_100006368 3300005436 Bacteria 8175
42 Ga0070713_100011188 3300005436 Bacteria 6525
43 Ga0070710_10004375 3300005437 Bacteria 6691
44 Ga0070701_10000171 3300005438 Bacteria 20076
45 Ga0070711_100010693 3300005439 Bacteria 5686
46 Ga0070711_100017819 3300005439 Bacteria 4526
47 Ga0070705_100001907 3300005440 Bacteria 10710
48 Ga0070700_100000396 3300005441 Bacteria 22554
49 Ga0070700_100154789 3300005441 Bacteria 1572
50 Ga0070694_100000367 3300005444 Bacteria 24183
51 Ga0070663_100041806 3300005455 Bacteria 3218
52 Ga0070663_100092183 3300005455 Bacteria 2246
53 Ga0070678_100019735 3300005456 Bacteria 4404
54 Ga0070678_100059797 3300005456 Bacteria 2802
55 Ga0070678_100073433 3300005456 Bacteria 2567
56 Ga0070678_100308295 3300005456 Bacteria 1348
57 Ga0070662_100315020 3300005457 Bacteria 1274
58 Ga0070681_10145128 3300005458 Bacteria 2302
59 Ga0068867_100002868 3300005459 Bacteria 12133
60 Ga0068867_100115140 3300005459 Bacteria 2070
61 Ga0070685_10186065 3300005466 Bacteria 1340
62 Ga0070698_100510536 3300005471 Bacteria 1140
63 Ga0070699_100074011 3300005518 Bacteria 2964
64 Ga0070699_100190953 3300005518 Bacteria 1819
65 Ga0070679_100035218 3300005530 Bacteria 4967
66 Ga0070697_100036963 3300005536 Bacteria 3944
67 Ga0070697_100068617 3300005536 Bacteria 2903
68 Ga0068853_100159030 3300005539 Bacteria 2037
69 Ga0068853_100208784 3300005539 Bacteria 1779
70 Ga0068853_100211361 3300005539 Bacteria 1768
71 Ga0068853_100487288 3300005539 Bacteria 1163
72 Ga0070672_100029603 3300005543 Bacteria 4107
73 Ga0070672_100360364 3300005543 Bacteria 1241
74 Ga0070686_100000664 3300005544 Bacteria 20136
75 Ga0070695_100000111 3300005545 Bacteria 36343
76 Ga0070695_100000897 3300005545 Bacteria 16062
77 Ga0070696_100000082 3300005546 Bacteria 47144
78 Ga0070696_100007382 3300005546 Bacteria 7344
79 Ga0070696_100082352 3300005546 Bacteria 2281
80 Ga0070693_100000114 3300005547 Bacteria 35958
81 Ga0070693_100052712 3300005547 Bacteria 2333
82 Ga0070693_100054909 3300005547 Bacteria 2292
83 Ga0070665_100021790 3300005548 Bacteria 6443
84 Ga0070665_100056105 3300005548 Bacteria 3950
85 Ga0070665_100103879 3300005548 Bacteria 2844
86 Ga0070665_100109032 3300005548 Bacteria 2771
87 Ga0070665_100110277 3300005548 Bacteria 2754
88 Ga0070704_100000018 3300005549 Bacteria 54668
89 Ga0070704_100019690 3300005549 Bacteria 4340
90 Ga0068855_100008462 3300005563 Bacteria 12442
91 Ga0068855_100030518 3300005563 Bacteria 6446
92 Ga0070664_100059073 3300005564 Bacteria 3262
93 Ga0068857_100065746 3300005577 Bacteria 3225
94 Ga0068857_100110296 3300005577 Bacteria 2473
95 Ga0068857_100289977 3300005577 Bacteria 1507
96 Ga0068854_100014836 3300005578 Bacteria 5144
97 Ga0068854_100068691 3300005578 Bacteria 2584
98 Ga0068854_100081524 3300005578 Bacteria 2390
99 Ga0068856_100015015 3300005614 Bacteria 7481
100 Ga0068856_100070791 3300005614 Bacteria 3451
101 Ga0070702_100000345 3300005615 Bacteria 16164
102 Ga0070702_100021506 3300005615 Bacteria 3395
103 Ga0070702_100107646 3300005615 Bacteria 1722
104 Ga0068852_100037238 3300005616 Bacteria 4077
105 Ga0068852_100164377 3300005616 Bacteria 2075
106 Ga0068852_100425866 3300005616 Bacteria 1310
107 Ga0068859_100001261 3300005617 Bacteria 25857
108 Ga0068859_100045230 3300005617 Bacteria 4423
109 Ga0068859_100091398 3300005617 Bacteria 3094
110 Ga0068859_100099818 3300005617 Bacteria 2958
111 Ga0068859_100390420 3300005617 Bacteria 1487
112 Ga0068859_100504564 3300005617 Unclassified 1305
113 Ga0068864_100022139 3300005618 Bacteria 5327
114 Ga0068864_100099012 3300005618 Bacteria 2583
115 Ga0068864_100125032 3300005618 Bacteria 2304
116 Ga0068864_100289542 3300005618 Bacteria 1531
117 Ga0068866_10022999 3300005718 Bacteria 2893
118 Ga0068861_100001057 3300005719 Bacteria 16951
119 Ga0068861_100132611 3300005719 Bacteria 2024
120 Ga0068861_100231144 3300005719 Bacteria 1568
121 Ga0068861_100344084 3300005719 Bacteria 1306
122 Ga0068851_10025656 3300005834 Bacteria 2892
123 Ga0068851_10055329 3300005834 Bacteria 2021
124 Ga0068870_10102035 3300005840 Bacteria 1623
125 Ga0068863_100285773 3300005841 Bacteria 1599
126 Ga0068858_100003300 3300005842 Bacteria 16062
127 Ga0068858_100071799 3300005842 Bacteria 3211
128 Ga0068858_100102517 3300005842 Bacteria 2669
129 Ga0068858_100105936 3300005842 Bacteria 2624
130 Ga0068860_100002554 3300005843 Bacteria 19028
131 Ga0068860_100091350 3300005843 Bacteria 2900
132 Ga0068860_100215423 3300005843 Bacteria 1863
133 Ga0068862_100002561 3300005844 Bacteria 16062
134 Ga0068862_100115607 3300005844 Bacteria 2359
135 Ga0081455_10002253 3300005937 Bacteria 22969
136 Ga0081455_10010660 3300005937 Bacteria 9299
137 Ga0081455_10055712 3300005937 Bacteria 3362
138 Ga0081538_10018942 3300005981 Bacteria 5143
139 Ga0081538_10064152 3300005981 Bacteria 2079
140 Ga0081540_1000007 3300005983 Bacteria 205328
141 Ga0081540_1001425 3300005983 Bacteria 20682
142 Ga0081540_1002471 3300005983 Bacteria 15050
143 Ga0081540_1003760 3300005983 Bacteria 11893
144 Ga0081540_1004726 3300005983 Bacteria 10301
145 Ga0081540_1010261 3300005983 Bacteria 6361
146 Ga0081540_1013903 3300005983 Bacteria 5198
147 Ga0081540_1023015 3300005983 Bacteria 3661
148 Ga0081539_10000040 3300005985 Bacteria 292753
149 Ga0081539_10011100 3300005985 Bacteria 7192
150 Ga0081539_10044462 3300005985 Bacteria 2564
151 Ga0070717_10009751 3300006028 Bacteria 7230
152 Ga0070717_10245887 3300006028 Bacteria 1579
153 Ga0075365_10003658 3300006038 Bacteria 7976
154 Ga0075365_10124679 3300006038 Bacteria 1779
155 Ga0075368_10038643 3300006042 Bacteria 1869
156 Ga0075363_100006644 3300006048 Bacteria 5271
157 Ga0075363_100017762 3300006048 Bacteria 3533
158 Ga0075363_100044802 3300006048 Bacteria 2345
159 Ga0075364_10010611 3300006051 Bacteria 5571
160 Ga0070716_100091342 3300006173 Bacteria 1843
161 Ga0075362_10042086 3300006177 Bacteria 2018
162 Ga0075367_10011619 3300006178 Bacteria 4669
163 Ga0075367_10028585 3300006178 Bacteria 3182
164 Ga0075367_10043882 3300006178 Bacteria 2619
165 Ga0075367_10057510 3300006178 Bacteria 2312
166 Ga0075367_10084720 3300006178 Bacteria 1922
167 Ga0075369_10003048 3300006186 Bacteria 6064
168 Ga0075366_10054790 3300006195 Bacteria 2369
169 Ga0097621_100001358 3300006237 Bacteria 16852
170 Ga0075370_10017942 3300006353 Bacteria 3831
171 Ga0068871_100024851 3300006358 Bacteria 4651
172 Ga0068871_100035845 3300006358 Bacteria 3945
173 Ga0075428_100029277 3300006844 Bacteria 6093
174 Ga0075428_100065717 3300006844 Bacteria 3972
175 Ga0075428_100143090 3300006844 Bacteria 2600
176 Ga0075430_100047470 3300006846 Bacteria 3626
177 Ga0075430_100082487 3300006846 Bacteria 2694
178 Ga0075431_100062005 3300006847 Bacteria 3858
179 Ga0075431_100259473 3300006847 Bacteria 1764
180 Ga0075433_10001083 3300006852 Bacteria 19628
181 Ga0075433_10053925 3300006852 Bacteria 3507
182 Ga0075434_100000358 3300006871 Bacteria 33110
183 Ga0075434_100002085 3300006871 Bacteria 17375
184 Ga0075434_100094427 3300006871 Bacteria 2996
185 Ga0075434_100104296 3300006871 Bacteria 2845
186 Ga0068865_100000555 3300006881 Bacteria 20766
187 Ga0068865_100184990 3300006881 Bacteria 1607
188 Ga0068865_100190814 3300006881 Bacteria 1584
189 Ga0075436_100001595 3300006914 Bacteria 15494
190 Ga0075436_100035412 3300006914 Bacteria 3445
191 Ga0097620_100001261 3300006931 Bacteria 25857
192 Ga0097620_100045232 3300006931 Bacteria 4423
193 Ga0097620_100091400 3300006931 Bacteria 3094
194 Ga0097620_100099818 3300006931 Bacteria 2958
195 Ga0097620_100390398 3300006931 Bacteria 1487
196 Ga0097620_100504571 3300006931 Unclassified 1305
197 Ga0075435_100000518 3300007076 Bacteria 23614
198 Ga0075435_100000614 3300007076 Bacteria 21898
199 Ga0099794_10001834 3300007265 Bacteria 7595
200 Ga0099794_10011943 3300007265 Bacteria 3734
201 Ga0099795_10000703 3300007788 Bacteria 6496
202 Ga0105250_10098508 3300009092 Bacteria 1192
203 Ga0105240_10115445 3300009093 Bacteria 3241
204 Ga0111539_10014436 3300009094 Bacteria 9858
205 Ga0111539_10023073 3300009094 Bacteria 7642
206 Ga0111539_10067195 3300009094 Bacteria 4233
207 Ga0111539_10292922 3300009094 Bacteria 1894
208 Ga0105245_10002939 3300009098 Bacteria 15302
209 Ga0105245_10006058 3300009098 Bacteria 10630
210 Ga0114129_10143177 3300009147 Bacteria 3276
211 Ga0105243_10002682 3300009148 Bacteria 14791
212 Ga0105241_10004461 3300009174 Bacteria 10354
213 Ga0105241_10098442 3300009174 Bacteria 2320
214 Ga0105242_10000987 3300009176 Bacteria 22250
215 Ga0105237_10044251 3300009545 Bacteria 4482
216 Ga0105238_10212114 3300009551 Bacteria 1912
217 Ga0105246_10062671 3300011119 Bacteria 2591
218 Ga0105246_10147410 3300011119 Bacteria 1777
219 Ga0157378_10001843 3300013297 Bacteria 19029
220 Ga0157372_10166417 3300013307 Bacteria 2550
221 Ga0157375_10147768 3300013308 Bacteria 2482
222 Ga0157375_10181580 3300013308 Bacteria 2256
223 Ga0163163_10114371 3300014325 Bacteria 2729
224 Ga0157380_10031003 3300014326 Bacteria 4101
225 Ga0157380_10446498 3300014326 Bacteria 1241
226 Ga0157376_10006926 3300014969 Bacteria 8035
227 Ga0157376_10078350 3300014969 Bacteria 2829
228 Ga0163161_10043069 3300017792 Bacteria 3250
229 Ga0209758_1015586 3300025297 Bacteria 3922
230 Ga0207656_10006815 3300025321 Bacteria 4130
231 Ga0207656_10039581 3300025321 Bacteria 1995
232 Ga0207656_10069167 3300025321 Bacteria 1566
233 Ga0207682_10000069 3300025893 Bacteria 45399
234 Ga0207682_10046202 3300025893 Bacteria 1789
235 Ga0207692_10004880 3300025898 Bacteria 5340
236 Ga0207642_10202354 3300025899 Bacteria 1098
237 Ga0207688_10050963 3300025901 Bacteria 2318
238 Ga0207680_10126738 3300025903 Bacteria 1677
239 Ga0207699_10007439 3300025906 Bacteria 5359
240 Ga0207699_10040723 3300025906 Bacteria 2679
241 Ga0207643_10086869 3300025908 Bacteria 1818
242 Ga0207705_10011317 3300025909 Bacteria 6461
243 Ga0207705_10079109 3300025909 Bacteria 2394
244 Ga0207684_10044656 3300025910 Bacteria 3758
245 Ga0207654_10062373 3300025911 Bacteria 2184
246 Ga0207695_10149237 3300025913 Bacteria 2278
247 Ga0207671_10076432 3300025914 Bacteria 2506
248 Ga0207693_10013978 3300025915 Bacteria 6465
249 Ga0207663_10001469 3300025916 Bacteria 10987
250 Ga0207663_10004543 3300025916 Bacteria 6912
251 Ga0207660_10042880 3300025917 Bacteria 3178
252 Ga0207660_10111596 3300025917 Bacteria 2058
253 Ga0207662_10000269 3300025918 Bacteria 23948
254 Ga0207662_10101726 3300025918 Bacteria 1781
255 Ga0207662_10106992 3300025918 Bacteria 1740
256 Ga0207649_10014762 3300025920 Bacteria 4381
257 Ga0207652_10024979 3300025921 Bacteria 4962
258 Ga0207694_10049322 3300025924 Bacteria 3259
259 Ga0207694_10052701 3300025924 Bacteria 3154
260 Ga0207694_10285236 3300025924 Bacteria 1357
261 Ga0207650_10251659 3300025925 Bacteria 1430
262 Ga0207650_10320957 3300025925 Bacteria 1268
263 Ga0207659_10147265 3300025926 Bacteria 1835
264 Ga0207687_10003693 3300025927 Bacteria 10301
265 Ga0207687_10038544 3300025927 Bacteria 3266
266 Ga0207664_10020236 3300025929 Bacteria 4929
267 Ga0207644_10158453 3300025931 Bacteria 1757
268 Ga0207644_10456387 3300025931 Bacteria 1050
269 Ga0207690_10092970 3300025932 Bacteria 2136
270 Ga0207690_10330082 3300025932 Bacteria 1201
271 Ga0207686_10003451 3300025934 Bacteria 8490
272 Ga0207686_10046307 3300025934 Bacteria 2682
273 Ga0207709_10000759 3300025935 Bacteria 25445
274 Ga0207670_10010027 3300025936 Bacteria 5437
275 Ga0207670_10119122 3300025936 Bacteria 1916
276 Ga0207704_10000698 3300025938 Bacteria 14805
277 Ga0207704_10060081 3300025938 Bacteria 2350
278 Ga0207704_10114618 3300025938 Bacteria 1830
279 Ga0207665_10000825 3300025939 Bacteria 20977
280 Ga0207691_10013055 3300025940 Bacteria 7953
281 Ga0207691_10079903 3300025940 Bacteria 2942
282 Ga0207691_10339921 3300025940 Bacteria 1285
283 Ga0207689_10001752 3300025942 Bacteria 20489
284 Ga0207689_10042878 3300025942 Bacteria 3741
285 Ga0207679_10025720 3300025945 Bacteria 4052
286 Ga0207667_10011686 3300025949 Bacteria 10187
287 Ga0207667_10052440 3300025949 Bacteria 4296
288 Ga0207651_10074265 3300025960 Bacteria 2421
289 Ga0207651_10154220 3300025960 Bacteria 1792
290 Ga0207651_10168366 3300025960 Bacteria 1725
291 Ga0207712_10014753 3300025961 Bacteria 5031
292 Ga0207712_10196885 3300025961 Bacteria 1595
293 Ga0207668_10027356 3300025972 Bacteria 3713
294 Ga0207668_10076918 3300025972 Bacteria 2404
295 Ga0207668_10241948 3300025972 Bacteria 1460
296 Ga0207640_10003047 3300025981 Bacteria 9024
297 Ga0207640_10060375 3300025981 Bacteria 2506
298 Ga0207640_10141739 3300025981 Bacteria 1753
299 Ga0207658_10167593 3300025986 Bacteria 1806
300 Ga0207677_10000943 3300026023 Bacteria 16236
301 Ga0207677_10019890 3300026023 Bacteria 4064
302 Ga0207677_10165186 3300026023 Bacteria 1724
303 Ga0207677_10235094 3300026023 Bacteria 1479
304 Ga0207703_10001924 3300026035 Bacteria 18395
305 Ga0207703_10110871 3300026035 Bacteria 2341
306 Ga0207703_10198149 3300026035 Bacteria 1783
307 Ga0207639_10056458 3300026041 Bacteria 3010
308 Ga0207678_10000808 3300026067 Bacteria 28722
309 Ga0207678_10018631 3300026067 Bacteria 6094
310 Ga0207678_10030236 3300026067 Bacteria 4728
311 Ga0207678_10044806 3300026067 Bacteria 3825
312 Ga0207678_10106613 3300026067 Bacteria 2390
313 Ga0207708_10000736 3300026075 Bacteria 24605
314 Ga0207702_10173941 3300026078 Bacteria 1977
315 Ga0207641_10415328 3300026088 Bacteria 1294
316 Ga0207648_10001763 3300026089 Bacteria 23706
317 Ga0207648_10020554 3300026089 Bacteria 5944
318 Ga0207648_10041839 3300026089 Bacteria 4024
319 Ga0207648_10117466 3300026089 Bacteria 2337
320 Ga0207676_10073096 3300026095 Bacteria 2758
321 Ga0207676_10265452 3300026095 Bacteria 1552
322 Ga0207674_10273990 3300026116 Bacteria 1635
323 Ga0207674_10539896 3300026116 Bacteria 1126
324 Ga0207675_100001316 3300026118 Bacteria 24900
325 Ga0207675_100248544 3300026118 Bacteria 1721
326 Ga0207675_100308595 3300026118 Bacteria 1542
327 Ga0207683_10007197 3300026121 Bacteria 9538
328 Ga0207683_10016805 3300026121 Bacteria 6228
329 Ga0207683_10270104 3300026121 Bacteria 1553
330 Ga0207683_10328691 3300026121 Bacteria 1401
331 Ga0207683_10387552 3300026121 Bacteria 1285
332 Ga0207683_10548046 3300026121 Bacteria 1069
333 Ga0207698_10139101 3300026142 Bacteria 2088
334 Ga0207698_10233836 3300026142 Bacteria 1670
335 Ga0209588_1009368 3300027671 Bacteria 2926
336 Ga0209813_10014130 3300027866 Bacteria 2145
337 Ga0209813_10022098 3300027866 Bacteria 1795
338 Ga0209813_10067764 3300027866 Bacteria 1154
339 Ga0207428_10062371 3300027907 Bacteria 2948
340 Ga0268266_10003236 3300028379 Bacteria 16447
341 Ga0268266_10039251 3300028379 Bacteria 4032
342 Ga0268266_10057871 3300028379 Bacteria 3336
343 Ga0268266_10237173 3300028379 Bacteria 1682
344 Ga0268266_10443498 3300028379 Bacteria 1233
345 Ga0268265_10003454 3300028380 Bacteria 11361
346 Ga0268265_10009313 3300028380 Bacteria 6637
347 Ga0268265_10339341 3300028380 Bacteria 1367
348 Ga0268264_10001853 3300028381 Bacteria 19220
349 Ga0268264_10080039 3300028381 Bacteria 2789
350 Ga0268264_10382397 3300028381 Bacteria 1348
351 Ga0307517_10001037 3300028786 Bacteria 47162
352 Ga0307517_10094318 3300028786 Bacteria 2418
353 Ga0307515_10079255 3300028794 Bacteria 4305
354 Ga0265325_10000052 3300031241 Bacteria 78471
355 Ga0307513_10163215 3300031456 Bacteria 2116
356 Ga0307509_10086077 3300031507 Bacteria 3232
357 Ga0307410_10129714 3300031852 Bacteria 1851
358 Ga0307406_10259710 3300031901 Bacteria 1313
359 Ga0307411_10375976 3300032005 Bacteria 1167
360 Ga0307415_100011650 3300032126 Bacteria 5044
361 Ga0307415_100124964 3300032126 Bacteria 1937
362 Ga0307510_10039344 3300033180 Bacteria 5211
363 Ga0373948_0024857 3300034817 Bacteria 1171
364 Ga0373928_0016679 3300035084 Bacteria 1505
365 Ga0373944_0033990 3300035089 Bacteria 1547
366 Ga0373932_0041234 3300035112 Bacteria 1333
367 Ga0373936_0004291 3300035113 Bacteria 5386
368 Ga0373936_0079272 3300035113 Bacteria 1365
369 Ga0373936_0090163 3300035113 Bacteria 1285
370 Ga0373939_0006102 3300035114 Bacteria 2896
371 Ga0373939_0059196 3300035114 Bacteria 1214
372 Ga0373960_0002213 3300035121 Bacteria 4374
373 Ga0373943_0174011 3300035170 Bacteria 1179
374 Ga0373955_0008249 3300035172 Bacteria 4830
375 Ga0373935_0302106 3300035692 Bacteria 1131
376 Ga0373927_0128384 3300035695 Bacteria 1656
377 Ga0373933_0088192 3300035724 Bacteria 1911
378 Ga0373947_0188659 3300035725 Bacteria 1344
379 Ga0373937_0020492 3300036401 Bacteria 5927
380 Ga0373925_0009358 3300037068 Bacteria 7133
381 Ga0373925_0019330 3300037068 Bacteria 4954
382 Ga0395899_0006994 3300037312 Bacteria 8736
383 Ga0451576_0028297 3300045051 Bacteria 6006
384 Ga0451576_0253740 3300045051 Bacteria 1838
385 Ga0495592_0001683 3300046454 Bacteria 15504
386 Ga0495592_0255999 3300046454 Bacteria 1155
387 Ga0495603_0004721 3300046455 Bacteria 8138
388 Ga0495638_0031422 3300046460 Bacteria 3413
389 Ga0495580_0024507 3300046472 Bacteria 4415
390 Ga0495582_0005635 3300046473 Bacteria 6970
391 Ga0495582_0042184 3300046473 Bacteria 2514
392 Ga0495606_0014980 3300046507 Bacteria 6012
393 Ga0495628_0001265 3300046516 Bacteria 23148
394 Ga0495628_0167681 3300046516 Bacteria 1666
395 Ga0495632_0104076 3300046519 Bacteria 1336
396 Ga0495644_0045670 3300046523 Bacteria 1647
397 Ga0495652_0017682 3300046529 Bacteria 6362
398 Ga0495640_0065469 3300046533 Bacteria 2454
399 Ga0495586_0020218 3300046535 Bacteria 3546
400 Ga0495598_0016338 3300046537 Bacteria 1892
401 Ga0495598_0027515 3300046537 Bacteria 1569
402 Ga0495597_0020002 3300046542 Bacteria 3124
403 Ga0495645_0000689 3300046543 Bacteria 23257
404 Ga0495622_0076558 3300046557 Bacteria 1541
405 Ga0495633_0040139 3300046558 Bacteria 2231
406 Ga0495667_0001076 3300046559 Bacteria 17673
407 Ga0495656_0015638 3300046615 Bacteria 2868
408 Ga0495656_0081090 3300046615 Bacteria 1464
409 Ga0495668_0253398 3300046616 Bacteria 963
410 Ga0495659_0049239 3300046664 Bacteria 1529
411 Ga0495588_0035971 3300046674 Bacteria 2511
412 Ga0495658_0002492 3300046683 Bacteria 9260
413 Ga0495658_0020102 3300046683 Bacteria 3498
414 Ga0495669_0003001 3300046684 Bacteria 6931
415 Ga0495669_0039152 3300046684 Bacteria 2099
416 Ga0495600_0039981 3300046809 Bacteria 3054
417 Ga0495581_0086811 3300047315 Bacteria 1814
418 Ga0495604_0045426 3300047317 Bacteria 3428
419 Ga0495636_0022746 3300047318 Bacteria 2536
420 Ga0495674_0116333 3300047319 Bacteria 2262
421 Ga0495672_0076801 3300047320 Bacteria 1874
422 Ga0495680_0009229 3300047322 Bacteria 8888
423 Ga0495680_0126216 3300047322 Bacteria 1884
424 Ga0495675_0013450 3300047444 Bacteria 5166
425 Ga0495673_0083002 3300047469 Bacteria 1324
426 Ga0495602_0044179 3300048088 Bacteria 4045
427 Ga0496100_0065250 3300048903 Bacteria 2411
428 Ga0496101_0210005 3300048904 Bacteria 1508
429 Ga0496102_0002605 3300048905 Bacteria 15365
430 Ga0496102_0028253 3300048905 Bacteria 5009
431 Ga0496102_0089978 3300048905 Bacteria 2840
432 Ga0496102_0605192 3300048905 Bacteria 1019
433 Ga0496103_0036389 3300048906 Bacteria 3015
434 Ga0496104_0000425 3300048907 Bacteria 36760
435 Ga0496104_0039091 3300048907 Bacteria 4441
436 Ga0496105_0000531 3300048908 Bacteria 25197
437 Ga0496105_0017634 3300048908 Bacteria 5727
438 Ga0496105_0040471 3300048908 Bacteria 3843
439 Ga0496106_0005613 3300048909 Bacteria 9285
440 Ga0496106_0177192 3300048909 Bacteria 1691
441 Ga0496107_0212686 3300048910 Bacteria 1438
442 Ga0496108_0072516 3300048911 Bacteria 2907
443 Ga0496108_0103812 3300048911 Bacteria 2425
444 Ga0496109_0023243 3300048912 Bacteria 5499
445 Ga0496110_0006549 3300048913 Bacteria 9244
446 Ga0496110_0130480 3300048913 Bacteria 2269
447 Ga0496110_0164330 3300048913 Bacteria 2012
448 Ga0496111_0069801 3300048914 Bacteria 2555
449 Ga0496112_0000244 3300048915 Bacteria 34762
450 Ga0496112_0113777 3300048915 Bacteria 2676
451 Ga0496112_0140208 3300048915 Bacteria 2387
452 Ga0496112_0174049 3300048915 Bacteria 2118
453 Ga0496113_0009303 3300048916 Bacteria 6444
454 Ga0496113_0251642 3300048916 Bacteria 1411
455 Ga0496114_0043199 3300048917 Bacteria 3738
456 Ga0496114_0464561 3300048917 Bacteria 1120
457 Ga0496115_0012773 3300048918 Bacteria 6330
458 Ga0496121_0000214 3300048924 Bacteria 127349
459 Ga0496121_0114512 3300048924 Bacteria 2049
460 Ga0496121_0124208 3300048924 Bacteria 1943
461 Ga0496125_0000164 3300048928 Bacteria 147789
462 Ga0496125_0003429 3300048928 Bacteria 19221
463 Ga0496126_0004022 3300048929 Bacteria 17912
464 Ga0496126_0019846 3300048929 Bacteria 6609
465 Ga0496126_0061537 3300048929 Bacteria 3372
466 Ga0496126_0119351 3300048929 Bacteria 2288
467 Ga0496126_0153496 3300048929 Bacteria 1972
468 Ga0495678_067049 3300049459 Bacteria 1327
469 Ga0501036_0001769 3300049572 Bacteria 16770
470 Ga0501036_0071937 3300049572 Bacteria 2924
471 Ga0501036_0263092 3300049572 Bacteria 1445
472 Ga0501038_0001150 3300049574 Bacteria 23992
473 Ga0501038_0164773 3300049574 Bacteria 1799
474 Ga0501039_0002050 3300049575 Bacteria 14927
475 Ga0501039_0067008 3300049575 Bacteria 2788
476 Ga0501040_0000302 3300049576 Bacteria 28825
477 Ga0501041_0000813 3300049577 Bacteria 16725
478 Ga0501041_0052884 3300049577 Bacteria 2476
479 Ga0501041_0151722 3300049577 Bacteria 1447
480 Ga0501041_0172794 3300049577 Bacteria 1352
481 Ga0501042_0008176 3300049578 Bacteria 6891
482 Ga0501043_0040321 3300049579 Bacteria 3670
483 Ga0501043_0059467 3300049579 Bacteria 2999
484 Ga0501046_0004835 3300049580 Bacteria 12137
485 Ga0501046_0014710 3300049580 Bacteria 6588
486 Ga0501047_0012016 3300049581 Bacteria 8194
487 Ga0501048_0002096 3300049582 Bacteria 15203
488 Ga0501068_0292002 3300049584 Bacteria 1043
489 Ga0501070_0039003 3300049586 Bacteria 3964
490 Ga0501071_0020545 3300049587 Bacteria 4590
491 Ga0501071_0093838 3300049587 Bacteria 2207
492 Ga0501071_0298745 3300049587 Bacteria 1221
493 Ga0501072_0001721 3300049588 Bacteria 16303
494 Ga0501072_0164526 3300049588 Bacteria 1770
495 Ga0501074_0004817 3300049590 Bacteria 9678
496 Ga0501074_0029088 3300049590 Bacteria 4002
497 Ga0501075_0000045 3300049591 Bacteria 50874
498 Ga0501075_0012647 3300049591 Bacteria 6002
499 Ga0501075_0083898 3300049591 Bacteria 2413
500 Ga0501076_0000394 3300049592 Bacteria 27363
501 Ga0501076_0001408 3300049592 Bacteria 16105
502 Ga0501076_0129014 3300049592 Bacteria 2050
503 Ga0501076_0140669 3300049592 Bacteria 1961
504 Ga0501076_0152314 3300049592 Bacteria 1881
505 Ga0501077_0000629 3300049593 Bacteria 21374
506 Ga0501079_0001910 3300049741 Bacteria 14935
507 Ga0501079_0133715 3300049741 Bacteria 1930
508 Ga0501080_0037353 3300049742 Bacteria 4536
509 Ga0501080_0085967 3300049742 Bacteria 2922
510 Ga0501081_0002316 3300049743 Bacteria 11989
511 Ga0501081_0006209 3300049743 Bacteria 7742
512 Ga0501081_0275064 3300049743 Bacteria 1232
513 Ga0501083_0140230 3300049744 Bacteria 1583
514 Ga0501035_0015747 3300049822 Bacteria 6979
515 Ga0501035_0101824 3300049822 Bacteria 2520
516 Ga0501044_0211729 3300049823 Bacteria 1892
517 Ga0501045_0001370 3300049824 Bacteria 16220
518 nmdc:mga03n38_2974_c1 3300050490 Bacteria 5358
519 nmdc:mga03n38_55936_c1 3300050490 Bacteria 1779
520 nmdc:mga00v17_210397_c1 3300050491 Bacteria 1258
521 nmdc:mga0yw44_128928_c1 3300050492 Bacteria 1636
522 nmdc:mga0yw44_52052_c1 3300050492 Bacteria 2481
523 nmdc:mga0yw44_64140_c1 3300050492 Bacteria 2260
524 nmdc:mga0k408_50713_c1 3300050493 Bacteria 1606
525 nmdc:mga06z11_24041_c1 3300050494 Bacteria 1901
526 nmdc:mga06z11_24310_c1 3300050494 Bacteria 2856
527 nmdc:mga06z11_35675_c1 3300050494 Bacteria 2450
528 nmdc:mga06z11_42145_c1 3300050494 Bacteria 2288
529 nmdc:mga06z11_63801_c1 3300050494 Bacteria 1928
530 nmdc:mga07m45_1913_c3 3300050496 Bacteria 7218
531 nmdc:mga05p37_39963_c1 3300050507 Bacteria 5760
532 nmdc:mga09592_163159_c1 3300050508 Bacteria 1925
533 nmdc:mga09592_23644_c1 3300050508 Bacteria 5076
534 nmdc:mga09592_67976_c1 3300050508 Bacteria 3022
535 nmdc:mga0qj67_132904_c1 3300050509 Bacteria 2016
536 nmdc:mga0qj67_8051_c1 3300050509 Bacteria 7800
537 nmdc:mga06r32_10778_c1 3300050510 Bacteria 8235
538 nmdc:mga08y16_10503_c1 3300050511 Bacteria 9713
539 nmdc:mga08y16_24194_c1 3300050511 Bacteria 6410
540 nmdc:mga08y16_421956_c1 3300050511 Bacteria 1363
541 nmdc:mga08y16_56934_c1 3300050511 Bacteria 4086
542 nmdc:mga0n895_113655_c1 3300050512 Bacteria 2725
543 nmdc:mga0n895_129071_c1 3300050512 Bacteria 2552
544 nmdc:mga0n895_5209_c1 3300050512 Bacteria 10825
545 nmdc:mga0rr50_1387_c1 3300050513 Bacteria 13256
546 nmdc:mga0rr50_3323_c1 3300050513 Bacteria 9234
547 nmdc:mga0rr50_7963_c1 3300050513 Bacteria 6578
548 nmdc:mga08x19_102629_c1 3300050514 Bacteria 1899
549 nmdc:mga08x19_10442_c1 3300050514 Bacteria 5575
550 nmdc:mga08x19_14933_c1 3300050514 Bacteria 4717
551 nmdc:mga08x19_70221_c1 3300050514 Bacteria 2282
552 nmdc:mga0a205_105394_c1 3300050515 Bacteria 2718
553 nmdc:mga0a205_253298_c1 3300050515 Bacteria 1639
554 nmdc:mga0a205_8535_c1 3300050515 Bacteria 9315
555 nmdc:mga0sz30_37113_c1 3300050516 Bacteria 2039
556 Ga0495601_0000408 3300053077 Bacteria 22524
557 Ga0495601_0023161 3300053077 Bacteria 3815
558 Ga0495601_0189290 3300053077 Bacteria 1345
559 Ga0495595_0001343 3300053084 Bacteria 9555
560 Ga0495595_0002116 3300053084 Bacteria 7710
561 Ga0495619_0000086 3300053085 Bacteria 69774
562 Ga0495619_0001999 3300053085 Bacteria 13573
563 Ga0495619_0028424 3300053085 Bacteria 3607
564 Ga0500641_0052497 3300053096 Bacteria 1680
565 Ga0500594_0008945 3300053118 Bacteria 2295
566 Ga0500655_013979 3300053133 Bacteria 1468
567 Ga0500568_0024204 3300053139 Bacteria 2574
568 Ga0500616_0009811 3300053153 Bacteria 5777
569 Ga0500645_012185 3300053730 Bacteria 2783
570 Ga0500645_018795 3300053730 Bacteria 2154
571 Ga0500609_010288 3300053731 Bacteria 1260
572 Ga0501084_0016558 3300054114 Bacteria 6121
573 Ga0501084_0092786 3300054114 Bacteria 2535
574 Ga0501084_0525682 3300054114 Bacteria 1000
575 Ga0590071_016265 3300059421 Bacteria 1745
576 Ga0590077_013729 3300059426 Bacteria 1685
577 Ga0501082_0004607 3300060353 Bacteria 12038
578 Ga0501082_0135795 3300060353 Bacteria 2134
579 Ga0530510_0000797 3300061734 Bacteria 20554
580 Ga0530510_0003533 3300061734 Bacteria 10763
581 Ga0530510_0173758 3300061734 Bacteria 1596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025899 Ga0207642_10202354 Ga0207642_102023542 269
2 3300005983 Ga0081540_1023015 Ga0081540_10230155 274
3 3300035112 Ga0373932_0041234 Ga0373932_0041234_469_1323 283
4 3300035695 Ga0373927_0128384 Ga0373927_0128384_306_1250 293
5 3300046616 Ga0495668_0253398 Ga0495668_0253398_46_927 293
6 3300047315 Ga0495581_0086811 Ga0495581_0086811_16_897 293
7 3300005937 Ga0081455_10002253 Ga0081455_100022539 296
8 3300005985 Ga0081539_10044462 Ga0081539_100444622 301
9 3300005841 Ga0068863_100285773 Ga0068863_1002857732 302
10 3300006178 Ga0075367_10043882 Ga0075367_100438823 302
11 3300049741 Ga0501079_0133715 Ga0501079_0133715_354_1325 302
12 3300050494 nmdc:mga06z11_24310_c1 nmdc:mga06z11_24310_c1_1189_2151 302
13 3300026023 Ga0207677_10235094 Ga0207677_102350941 303
14 3300035114 Ga0373939_0059196 Ga0373939_0059196_113_1072 303
15 3300005331 Ga0070670_100219266 Ga0070670_1002192662 304
16 3300005355 Ga0070671_100068520 Ga0070671_1000685202 304
17 3300005366 Ga0070659_100054404 Ga0070659_1000544042 304
18 3300005441 Ga0070700_100154789 Ga0070700_1001547892 304
19 3300005455 Ga0070663_100092183 Ga0070663_1000921832 304
20 3300005456 Ga0070678_100059797 Ga0070678_1000597973 304
21 3300005456 Ga0070678_100073433 Ga0070678_1000734332 304
22 3300005547 Ga0070693_100054909 Ga0070693_1000549092 304
23 3300005548 Ga0070665_100110277 Ga0070665_1001102772 304
24 3300005563 Ga0068855_100030518 Ga0068855_1000305184 304
25 3300005577 Ga0068857_100110296 Ga0068857_1001102962 304
26 3300005614 Ga0068856_100070791 Ga0068856_1000707912 304
27 3300005615 Ga0070702_100107646 Ga0070702_1001076462 304
28 3300005617 Ga0068859_100091398 Ga0068859_1000913982 304
29 3300005618 Ga0068864_100125032 Ga0068864_1001250322 304
30 3300005718 Ga0068866_10022999 Ga0068866_100229993 304
31 3300005719 Ga0068861_100132611 Ga0068861_1001326112 304
32 3300005842 Ga0068858_100102517 Ga0068858_1001025172 304
33 3300005843 Ga0068860_100091350 Ga0068860_1000913502 304
34 3300005844 Ga0068862_100115607 Ga0068862_1001156072 304
35 3300006051 Ga0075364_10010611 Ga0075364_100106115 304
36 3300006178 Ga0075367_10028585 Ga0075367_100285852 304
37 3300006358 Ga0068871_100035845 Ga0068871_1000358452 304
38 3300006931 Ga0097620_100091400 Ga0097620_1000914002 304
39 3300025321 Ga0207656_10069167 Ga0207656_100691672 304
40 3300025893 Ga0207682_10046202 Ga0207682_100462022 304
41 3300025914 Ga0207671_10076432 Ga0207671_100764322 304
42 3300025925 Ga0207650_10320957 Ga0207650_103209572 304
43 3300025931 Ga0207644_10158453 Ga0207644_101584532 304
44 3300025932 Ga0207690_10092970 Ga0207690_100929701 304
45 3300025949 Ga0207667_10052440 Ga0207667_100524402 304
46 3300025972 Ga0207668_10027356 Ga0207668_100273562 304
47 3300025981 Ga0207640_10141739 Ga0207640_101417391 304
48 3300025986 Ga0207658_10167593 Ga0207658_101675932 304
49 3300026035 Ga0207703_10110871 Ga0207703_101108712 304
50 3300026041 Ga0207639_10056458 Ga0207639_100564582 304
51 3300026067 Ga0207678_10106613 Ga0207678_101066132 304
52 3300026089 Ga0207648_10117466 Ga0207648_101174662 304
53 3300026118 Ga0207675_100248544 Ga0207675_1002485442 304
54 3300026121 Ga0207683_10328691 Ga0207683_103286911 304
55 3300027866 Ga0209813_10022098 Ga0209813_100220982 304
56 3300028379 Ga0268266_10057871 Ga0268266_100578712 304
57 3300034817 Ga0373948_0024857 Ga0373948_0024857_131_1078 304
58 3300035084 Ga0373928_0016679 Ga0373928_0016679_385_1332 304
59 3300035114 Ga0373939_0006102 Ga0373939_0006102_1303_2250 304
60 3300035121 Ga0373960_0002213 Ga0373960_0002213_1987_2934 304
61 3300005329 Ga0070683_100295551 Ga0070683_1002955511 305
62 3300005466 Ga0070685_10186065 Ga0070685_101860652 305
63 3300053077 Ga0495601_0189290 Ga0495601_0189290_162_1133 305
64 3300006881 Ga0068865_100184990 Ga0068865_1001849901 306
65 3300048911 Ga0496108_0072516 Ga0496108_0072516_1250_2170 306
66 3300048915 Ga0496112_0174049 Ga0496112_0174049_610_1530 306
67 3300049577 Ga0501041_0151722 Ga0501041_0151722_10_975 306
68 3300049591 Ga0501075_0083898 Ga0501075_0083898_408_1373 306
69 3300049592 Ga0501076_0152314 Ga0501076_0152314_494_1459 306
70 3300060353 Ga0501082_0135795 Ga0501082_0135795_773_1738 306
71 3300005617 Ga0068859_100504564 Ga0068859_1005045642 307
72 3300006931 Ga0097620_100504571 Ga0097620_1005045712 307
73 3300035170 Ga0373943_0174011 Ga0373943_0174011_168_1094 307
74 3300035692 Ga0373935_0302106 Ga0373935_0302106_120_1046 307
75 3300035725 Ga0373947_0188659 Ga0373947_0188659_333_1259 307
76 3300005355 Ga0070671_100093563 Ga0070671_1000935632 308
77 3300025931 Ga0207644_10456387 Ga0207644_104563871 308
78 3300053153 Ga0500616_0009811 Ga0500616_0009811_895_1833 308
79 3300061734 Ga0530510_0173758 Ga0530510_0173758_203_1168 309
80 3300005347 Ga0070668_100017930 Ga0070668_1000179307 310
81 3300014326 Ga0157380_10446498 Ga0157380_104464982 310
82 3300025940 Ga0207691_10013055 Ga0207691_100130558 310
83 3300046542 Ga0495597_0020002 Ga0495597_0020002_1880_2812 310
84 3300046557 Ga0495622_0076558 Ga0495622_0076558_595_1527 310
85 3300046684 Ga0495669_0003001 Ga0495669_0003001_3430_4362 310
86 3300005336 Ga0070680_100089741 Ga0070680_1000897412 311
87 3300005546 Ga0070696_100082352 Ga0070696_1000823522 311
88 3300005549 Ga0070704_100019690 Ga0070704_1000196902 311
89 3300005615 Ga0070702_100021506 Ga0070702_1000215064 311
90 3300006844 Ga0075428_100065717 Ga0075428_1000657176 311
91 3300006846 Ga0075430_100047470 Ga0075430_1000474702 311
92 3300006852 Ga0075433_10053925 Ga0075433_100539252 311
93 3300006871 Ga0075434_100000358 Ga0075434_10000035815 311
94 3300007076 Ga0075435_100000614 Ga0075435_1000006149 311
95 3300025917 Ga0207660_10111596 Ga0207660_101115962 311
96 3300027907 Ga0207428_10062371 Ga0207428_100623712 311
97 3300048928 Ga0496125_0000164 Ga0496125_0000164_6639_7616 311
98 3300048928 Ga0496125_0003429 Ga0496125_0003429_2802_3779 311
99 3300048929 Ga0496126_0119351 Ga0496126_0119351_863_1840 311
100 3300049575 Ga0501039_0067008 Ga0501039_0067008_215_1162 311
101 3300049577 Ga0501041_0052884 Ga0501041_0052884_55_1002 311
102 3300049587 Ga0501071_0298745 Ga0501071_0298745_11_958 311
103 3300049591 Ga0501075_0012647 Ga0501075_0012647_576_1523 311
104 3300049592 Ga0501076_0001408 Ga0501076_0001408_12578_13525 311
105 3300049742 Ga0501080_0085967 Ga0501080_0085967_349_1299 311
106 3300049743 Ga0501081_0002316 Ga0501081_0002316_5806_6753 311
107 3300050508 nmdc:mga09592_23644_c1 nmdc:mga09592_23644_c1_1335_2285 311
108 3300050509 nmdc:mga0qj67_132904_c1 nmdc:mga0qj67_132904_c1_382_1335 311
109 3300050509 nmdc:mga0qj67_8051_c1 nmdc:mga0qj67_8051_c1_5084_6031 311
110 3300050511 nmdc:mga08y16_56934_c1 nmdc:mga08y16_56934_c1_407_1357 311
111 3300050512 nmdc:mga0n895_5209_c1 nmdc:mga0n895_5209_c1_8785_9732 311
112 3300050513 nmdc:mga0rr50_1387_c1 nmdc:mga0rr50_1387_c1_10972_11919 311
113 3300050513 nmdc:mga0rr50_3323_c1 nmdc:mga0rr50_3323_c1_1611_2558 311
114 3300050514 nmdc:mga08x19_14933_c1 nmdc:mga08x19_14933_c1_680_1627 311
115 3300050515 nmdc:mga0a205_105394_c1 nmdc:mga0a205_105394_c1_769_1716 311
116 3300061734 Ga0530510_0003533 Ga0530510_0003533_4779_5726 311
117 3300005333 Ga0070677_10075644 Ga0070677_100756442 312
118 3300005335 Ga0070666_10255695 Ga0070666_102556952 312
119 3300005434 Ga0070709_10010157 Ga0070709_100101572 312
120 3300005435 Ga0070714_100002637 Ga0070714_1000026378 312
121 3300005436 Ga0070713_100006368 Ga0070713_1000063682 312
122 3300005439 Ga0070711_100010693 Ga0070711_1000106931 312
123 3300005548 Ga0070665_100109032 Ga0070665_1001090323 312
124 3300006028 Ga0070717_10009751 Ga0070717_100097514 312
125 3300009545 Ga0105237_10044251 Ga0105237_100442513 312
126 3300025898 Ga0207692_10004880 Ga0207692_100048801 312
127 3300025906 Ga0207699_10040723 Ga0207699_100407232 312
128 3300025915 Ga0207693_10013978 Ga0207693_100139785 312
129 3300025916 Ga0207663_10001469 Ga0207663_100014694 312
130 3300025929 Ga0207664_10020236 Ga0207664_100202362 312
131 3300048909 Ga0496106_0177192 Ga0496106_0177192_663_1601 312
132 3300048910 Ga0496107_0212686 Ga0496107_0212686_333_1310 312
133 3300048913 Ga0496110_0164330 Ga0496110_0164330_690_1628 312
134 3300048915 Ga0496112_0140208 Ga0496112_0140208_741_1679 312
135 3300048924 Ga0496121_0114512 Ga0496121_0114512_37_975 312
136 3300048924 Ga0496121_0124208 Ga0496121_0124208_21_959 312
137 3300050493 nmdc:mga0k408_50713_c1 nmdc:mga0k408_50713_c1_197_1135 312
138 3300050494 nmdc:mga06z11_24041_c1 nmdc:mga06z11_24041_c1_416_1354 312
139 3300050512 nmdc:mga0n895_113655_c1 nmdc:mga0n895_113655_c1_959_1897 312
140 3300005330 Ga0070690_100000791 Ga0070690_1000007918 313
141 3300005334 Ga0068869_100001018 Ga0068869_10000101814 313
142 3300005336 Ga0070680_100070820 Ga0070680_1000708202 313
143 3300005337 Ga0070682_100047685 Ga0070682_1000476853 313
144 3300005338 Ga0068868_100001147 Ga0068868_10000114712 313
145 3300005340 Ga0070689_100005181 Ga0070689_1000051813 313
146 3300005341 Ga0070691_10000180 Ga0070691_1000018010 313
147 3300005343 Ga0070687_100000304 Ga0070687_10000030413 313
148 3300005354 Ga0070675_100189574 Ga0070675_1001895741 313
149 3300005355 Ga0070671_100328867 Ga0070671_1003288672 313
150 3300005364 Ga0070673_100193567 Ga0070673_1001935672 313
151 3300005365 Ga0070688_100040776 Ga0070688_1000407762 313
152 3300005438 Ga0070701_10000171 Ga0070701_100001717 313
153 3300005440 Ga0070705_100001907 Ga0070705_1000019078 313
154 3300005441 Ga0070700_100000396 Ga0070700_10000039611 313
155 3300005444 Ga0070694_100000367 Ga0070694_10000036714 313
156 3300005459 Ga0068867_100002868 Ga0068867_10000286814 313
157 3300005530 Ga0070679_100035218 Ga0070679_1000352182 313
158 3300005539 Ga0068853_100487288 Ga0068853_1004872881 313
159 3300005543 Ga0070672_100360364 Ga0070672_1003603642 313
160 3300005544 Ga0070686_100000664 Ga0070686_10000066414 313
161 3300005545 Ga0070695_100000111 Ga0070695_10000011117 313
162 3300005546 Ga0070696_100000082 Ga0070696_10000008240 313
163 3300005547 Ga0070693_100000114 Ga0070693_10000011429 313
164 3300005549 Ga0070704_100000018 Ga0070704_10000001844 313
165 3300005563 Ga0068855_100008462 Ga0068855_10000846211 313
166 3300005578 Ga0068854_100014836 Ga0068854_1000148363 313
167 3300005614 Ga0068856_100015015 Ga0068856_1000150152 313
168 3300005615 Ga0070702_100000345 Ga0070702_10000034512 313
169 3300005617 Ga0068859_100001261 Ga0068859_10000126114 313
170 3300005719 Ga0068861_100001057 Ga0068861_1000010578 313
171 3300005840 Ga0068870_10102035 Ga0068870_101020352 313
172 3300005842 Ga0068858_100003300 Ga0068858_1000033008 313
173 3300005843 Ga0068860_100002554 Ga0068860_10000255412 313
174 3300005844 Ga0068862_100002561 Ga0068862_10000256112 313
175 3300005983 Ga0081540_1001425 Ga0081540_10014257 313
176 3300006237 Ga0097621_100001358 Ga0097621_10000135810 313
177 3300006847 Ga0075431_100259473 Ga0075431_1002594732 313
178 3300006852 Ga0075433_10001083 Ga0075433_100010838 313
179 3300006871 Ga0075434_100002085 Ga0075434_10000208517 313
180 3300006871 Ga0075434_100094427 Ga0075434_1000944274 313
181 3300006881 Ga0068865_100000555 Ga0068865_10000055514 313
182 3300006914 Ga0075436_100001595 Ga0075436_1000015956 313
183 3300006931 Ga0097620_100001261 Ga0097620_10000126114 313
184 3300007076 Ga0075435_100000518 Ga0075435_10000051811 313
185 3300009094 Ga0111539_10014436 Ga0111539_100144365 313
186 3300009094 Ga0111539_10292922 Ga0111539_102929222 313
187 3300009098 Ga0105245_10006058 Ga0105245_1000605812 313
188 3300009148 Ga0105243_10002682 Ga0105243_100026825 313
189 3300009174 Ga0105241_10004461 Ga0105241_100044616 313
190 3300009176 Ga0105242_10000987 Ga0105242_1000098712 313
191 3300011119 Ga0105246_10147410 Ga0105246_101474102 313
192 3300013297 Ga0157378_10001843 Ga0157378_1000184312 313
193 3300014969 Ga0157376_10006926 Ga0157376_100069263 313
194 3300025903 Ga0207680_10126738 Ga0207680_101267382 313
195 3300025908 Ga0207643_10086869 Ga0207643_100868692 313
196 3300025917 Ga0207660_10042880 Ga0207660_100428803 313
197 3300025918 Ga0207662_10000269 Ga0207662_1000026912 313
198 3300025921 Ga0207652_10024979 Ga0207652_100249796 313
199 3300025926 Ga0207659_10147265 Ga0207659_101472652 313
200 3300025927 Ga0207687_10003693 Ga0207687_1000369312 313
201 3300025934 Ga0207686_10003451 Ga0207686_1000345112 313
202 3300025935 Ga0207709_10000759 Ga0207709_100007597 313
203 3300025936 Ga0207670_10010027 Ga0207670_100100272 313
204 3300025938 Ga0207704_10000698 Ga0207704_1000069812 313
205 3300025940 Ga0207691_10339921 Ga0207691_103399212 313
206 3300025942 Ga0207689_10001752 Ga0207689_1000175214 313
207 3300025949 Ga0207667_10011686 Ga0207667_1001168611 313
208 3300025960 Ga0207651_10154220 Ga0207651_101542202 313
209 3300025981 Ga0207640_10003047 Ga0207640_100030474 313
210 3300026023 Ga0207677_10000943 Ga0207677_100009437 313
211 3300026035 Ga0207703_10001924 Ga0207703_1000192412 313
212 3300026075 Ga0207708_10000736 Ga0207708_1000073614 313
213 3300026078 Ga0207702_10173941 Ga0207702_101739412 313
214 3300026088 Ga0207641_10415328 Ga0207641_104153281 313
215 3300026089 Ga0207648_10001763 Ga0207648_1000176317 313
216 3300026118 Ga0207675_100001316 Ga0207675_10000131617 313
217 3300028380 Ga0268265_10003454 Ga0268265_100034542 313
218 3300028381 Ga0268264_10001853 Ga0268264_1000185312 313
219 3300031852 Ga0307410_10129714 Ga0307410_101297141 313
220 3300035089 Ga0373944_0033990 Ga0373944_0033990_454_1407 313
221 3300035113 Ga0373936_0004291 Ga0373936_0004291_1767_2720 313
222 3300037068 Ga0373925_0009358 Ga0373925_0009358_4157_5110 313
223 3300045051 Ga0451576_0028297 Ga0451576_0028297_3060_4013 313
224 3300046455 Ga0495603_0004721 Ga0495603_0004721_2413_3366 313
225 3300046472 Ga0495580_0024507 Ga0495580_0024507_1754_2707 313
226 3300046473 Ga0495582_0005635 Ga0495582_0005635_2388_3341 313
227 3300046535 Ga0495586_0020218 Ga0495586_0020218_2262_3215 313
228 3300046537 Ga0495598_0016338 Ga0495598_0016338_18_977 313
229 3300046615 Ga0495656_0081090 Ga0495656_0081090_91_1050 313
230 3300046674 Ga0495588_0035971 Ga0495588_0035971_520_1473 313
231 3300046683 Ga0495658_0002492 Ga0495658_0002492_4346_5299 313
232 3300048905 Ga0496102_0089978 Ga0496102_0089978_437_1378 313
233 3300048913 Ga0496110_0130480 Ga0496110_0130480_190_1131 313
234 3300048917 Ga0496114_0043199 Ga0496114_0043199_585_1526 313
235 3300048917 Ga0496114_0464561 Ga0496114_0464561_32_991 313
236 3300049572 Ga0501036_0001769 Ga0501036_0001769_2072_3025 313
237 3300049574 Ga0501038_0001150 Ga0501038_0001150_14860_15813 313
238 3300049575 Ga0501039_0002050 Ga0501039_0002050_2961_3914 313
239 3300049576 Ga0501040_0000302 Ga0501040_0000302_14044_14997 313
240 3300049577 Ga0501041_0000813 Ga0501041_0000813_3265_4218 313
241 3300049577 Ga0501041_0172794 Ga0501041_0172794_338_1291 313
242 3300049578 Ga0501042_0008176 Ga0501042_0008176_5251_6204 313
243 3300049579 Ga0501043_0040321 Ga0501043_0040321_1531_2484 313
244 3300049580 Ga0501046_0004835 Ga0501046_0004835_8180_9133 313
245 3300049582 Ga0501048_0002096 Ga0501048_0002096_1024_1977 313
246 3300049587 Ga0501071_0020545 Ga0501071_0020545_1917_2870 313
247 3300049588 Ga0501072_0001721 Ga0501072_0001721_2740_3693 313
248 3300049588 Ga0501072_0164526 Ga0501072_0164526_253_1206 313
249 3300049590 Ga0501074_0004817 Ga0501074_0004817_2862_3815 313
250 3300049591 Ga0501075_0000045 Ga0501075_0000045_41402_42355 313
251 3300049592 Ga0501076_0000394 Ga0501076_0000394_11774_12727 313
252 3300049593 Ga0501077_0000629 Ga0501077_0000629_19056_20009 313
253 3300049741 Ga0501079_0001910 Ga0501079_0001910_3038_3991 313
254 3300049742 Ga0501080_0037353 Ga0501080_0037353_1857_2810 313
255 3300049743 Ga0501081_0006209 Ga0501081_0006209_3751_4704 313
256 3300049744 Ga0501083_0140230 Ga0501083_0140230_305_1258 313
257 3300049822 Ga0501035_0015747 Ga0501035_0015747_1538_2491 313
258 3300049824 Ga0501045_0001370 Ga0501045_0001370_8062_9015 313
259 3300050511 nmdc:mga08y16_24194_c1 nmdc:mga08y16_24194_c1_5128_6081 313
260 3300050511 nmdc:mga08y16_421956_c1 nmdc:mga08y16_421956_c1_251_1204 313
261 3300050512 nmdc:mga0n895_129071_c1 nmdc:mga0n895_129071_c1_568_1509 313
262 3300050513 nmdc:mga0rr50_7963_c1 nmdc:mga0rr50_7963_c1_1394_2347 313
263 3300050514 nmdc:mga08x19_10442_c1 nmdc:mga08x19_10442_c1_1863_2816 313
264 3300050515 nmdc:mga0a205_8535_c1 nmdc:mga0a205_8535_c1_4474_5427 313
265 3300054114 Ga0501084_0016558 Ga0501084_0016558_941_1894 313
266 3300054114 Ga0501084_0092786 Ga0501084_0092786_927_1880 313
267 3300054114 Ga0501084_0525682 Ga0501084_0525682_32_985 313
268 3300059421 Ga0590071_016265 Ga0590071_016265_666_1619 313
269 3300059426 Ga0590077_013729 Ga0590077_013729_331_1284 313
270 3300060353 Ga0501082_0004607 Ga0501082_0004607_5281_6234 313
271 3300061734 Ga0530510_0000797 Ga0530510_0000797_4689_5642 313
272 3300005331 Ga0070670_100025554 Ga0070670_1000255542 314
273 3300005341 Ga0070691_10162977 Ga0070691_101629771 314
274 3300005366 Ga0070659_100104435 Ga0070659_1001044352 314
275 3300005458 Ga0070681_10145128 Ga0070681_101451282 314
276 3300005539 Ga0068853_100208784 Ga0068853_1002087841 314
277 3300005539 Ga0068853_100211361 Ga0068853_1002113612 314
278 3300005543 Ga0070672_100029603 Ga0070672_1000296032 314
279 3300005577 Ga0068857_100065746 Ga0068857_1000657462 314
280 3300005578 Ga0068854_100068691 Ga0068854_1000686912 314
281 3300005616 Ga0068852_100164377 Ga0068852_1001643772 314
282 3300005617 Ga0068859_100045230 Ga0068859_1000452303 314
283 3300005617 Ga0068859_100390420 Ga0068859_1003904202 314
284 3300005618 Ga0068864_100099012 Ga0068864_1000990122 314
285 3300005834 Ga0068851_10025656 Ga0068851_100256563 314
286 3300005842 Ga0068858_100105936 Ga0068858_1001059362 314
287 3300006931 Ga0097620_100045232 Ga0097620_1000452323 314
288 3300006931 Ga0097620_100390398 Ga0097620_1003903982 314
289 3300009094 Ga0111539_10023073 Ga0111539_1002307310 314
290 3300009094 Ga0111539_10067195 Ga0111539_100671956 314
291 3300013307 Ga0157372_10166417 Ga0157372_101664172 314
292 3300014326 Ga0157380_10031003 Ga0157380_100310033 314
293 3300025321 Ga0207656_10039581 Ga0207656_100395812 314
294 3300025918 Ga0207662_10106992 Ga0207662_101069922 314
295 3300025920 Ga0207649_10014762 Ga0207649_100147623 314
296 3300025925 Ga0207650_10251659 Ga0207650_102516592 314
297 3300025932 Ga0207690_10330082 Ga0207690_103300821 314
298 3300025940 Ga0207691_10079903 Ga0207691_100799033 314
299 3300025981 Ga0207640_10060375 Ga0207640_100603752 314
300 3300026116 Ga0207674_10273990 Ga0207674_102739902 314
301 3300026121 Ga0207683_10387552 Ga0207683_103875521 314
302 3300026142 Ga0207698_10233836 Ga0207698_102338361 314
303 3300028379 Ga0268266_10237173 Ga0268266_102371731 314
304 3300028380 Ga0268265_10339341 Ga0268265_103393411 314
305 3300037312 Ga0395899_0006994 Ga0395899_0006994_2760_3716 314
306 3300045051 Ga0451576_0253740 Ga0451576_0253740_376_1335 314
307 3300047318 Ga0495636_0022746 Ga0495636_0022746_61_1017 314
308 3300050511 nmdc:mga08y16_10503_c1 nmdc:mga08y16_10503_c1_3665_4621 314
309 3300005518 Ga0070699_100074011 Ga0070699_1000740111 315
310 3300005536 Ga0070697_100036963 Ga0070697_1000369632 315
311 3300005545 Ga0070695_100000897 Ga0070695_10000089717 315
312 3300005546 Ga0070696_100007382 Ga0070696_1000073826 315
313 3300006914 Ga0075436_100035412 Ga0075436_1000354122 315
314 3300025893 Ga0207682_10000069 Ga0207682_1000006937 315
315 3300050514 nmdc:mga08x19_70221_c1 nmdc:mga08x19_70221_c1_183_1145 315
316 iso_pu_bacteria 2513237101 2513694511 315
317 iso_pu_bacteria 2721755755 2723848960 315
318 iso_pu_bacteria 2791355199 2793079057 315
319 iso_pu_bacteria 2874604998 2874607092 315
320 iso_pu_bacteria 2889033259 2889034763 315
321 iso_pu_bacteria 2922361189 2922364766 315
322 iso_pu_bacteria 2922386360 2922391777 315
323 iso_pu_bacteria 8006964411 8006965099 315
324 iso_pu_bacteria 8006984368 8006993200 315
325 iso_pu_bacteria 8006994254 8006995347 315
326 iso_pu_bacteria 8056673599 8056679145 315
327 3300005578 Ga0068854_100081524 Ga0068854_1000815242 316
328 3300005843 Ga0068860_100215423 Ga0068860_1002154232 316
329 3300006844 Ga0075428_100143090 Ga0075428_1001430902 316
330 3300013308 Ga0157375_10181580 Ga0157375_101815803 316
331 3300025938 Ga0207704_10060081 Ga0207704_100600812 316
332 3300026089 Ga0207648_10041839 Ga0207648_100418394 316
333 3300026121 Ga0207683_10007197 Ga0207683_1000719712 316
334 3300027671 Ga0209588_1009368 Ga0209588_10093683 316
335 3300005985 Ga0081539_10011100 Ga0081539_100111004 317
336 iso_pu_bacteria 2876808645 2876815747 317
337 iso_pu_bacteria 2879110137 2879117063 317
338 3300005330 Ga0070690_100055664 Ga0070690_1000556642 318
339 3300005338 Ga0068868_100033478 Ga0068868_1000334781 318
340 3300005364 Ga0070673_100321477 Ga0070673_1003214772 318
341 3300005367 Ga0070667_100081864 Ga0070667_1000818642 318
342 3300005471 Ga0070698_100510536 Ga0070698_1005105361 318
343 3300005616 Ga0068852_100037238 Ga0068852_1000372384 318
344 3300005618 Ga0068864_100289542 Ga0068864_1002895422 318
345 3300005719 Ga0068861_100344084 Ga0068861_1003440841 318
346 3300005834 Ga0068851_10055329 Ga0068851_100553291 318
347 3300005842 Ga0068858_100071799 Ga0068858_1000717993 318
348 3300005983 Ga0081540_1002471 Ga0081540_10024712 318
349 3300006048 Ga0075363_100006644 Ga0075363_1000066441 318
350 3300006178 Ga0075367_10011619 Ga0075367_100116192 318
351 3300006178 Ga0075367_10084720 Ga0075367_100847202 318
352 3300006186 Ga0075369_10003048 Ga0075369_100030484 318
353 3300006846 Ga0075430_100082487 Ga0075430_1000824872 318
354 3300006847 Ga0075431_100062005 Ga0075431_1000620053 318
355 3300006871 Ga0075434_100104296 Ga0075434_1001042962 318
356 3300009098 Ga0105245_10002939 Ga0105245_1000293916 318
357 3300011119 Ga0105246_10062671 Ga0105246_100626713 318
358 3300013308 Ga0157375_10147768 Ga0157375_101477682 318
359 3300025321 Ga0207656_10006815 Ga0207656_100068152 318
360 3300025924 Ga0207694_10049322 Ga0207694_100493223 318
361 3300025927 Ga0207687_10038544 Ga0207687_100385441 318
362 3300025960 Ga0207651_10074265 Ga0207651_100742653 318
363 3300025960 Ga0207651_10168366 Ga0207651_101683662 318
364 3300026023 Ga0207677_10019890 Ga0207677_100198903 318
365 3300026067 Ga0207678_10030236 Ga0207678_100302362 318
366 3300026095 Ga0207676_10265452 Ga0207676_102654522 318
367 3300026142 Ga0207698_10139101 Ga0207698_101391012 318
368 3300027866 Ga0209813_10067764 Ga0209813_100677642 318
369 3300032126 Ga0307415_100011650 Ga0307415_1000116502 318
370 3300050490 nmdc:mga03n38_55936_c1 nmdc:mga03n38_55936_c1_239_1204 318
371 3300050491 nmdc:mga00v17_210397_c1 nmdc:mga00v17_210397_c1_173_1138 318
372 3300050492 nmdc:mga0yw44_128928_c1 nmdc:mga0yw44_128928_c1_191_1156 318
373 3300050494 nmdc:mga06z11_35675_c1 nmdc:mga06z11_35675_c1_1182_2147 318
374 3300050494 nmdc:mga06z11_63801_c1 nmdc:mga06z11_63801_c1_109_1074 318
375 3300050508 nmdc:mga09592_67976_c1 nmdc:mga09592_67976_c1_1729_2694 318
376 3300050510 nmdc:mga06r32_10778_c1 nmdc:mga06r32_10778_c1_4512_5477 318
377 3300005335 Ga0070666_10117286 Ga0070666_101172861 319
378 3300005347 Ga0070668_100100845 Ga0070668_1001008452 319
379 3300005436 Ga0070713_100011188 Ga0070713_1000111883 319
380 3300005437 Ga0070710_10004375 Ga0070710_100043752 319
381 3300005439 Ga0070711_100017819 Ga0070711_1000178193 319
382 3300005455 Ga0070663_100041806 Ga0070663_1000418062 319
383 3300005459 Ga0068867_100115140 Ga0068867_1001151403 319
384 3300005539 Ga0068853_100159030 Ga0068853_1001590301 319
385 3300005548 Ga0070665_100056105 Ga0070665_1000561054 319
386 3300005617 Ga0068859_100099818 Ga0068859_1000998182 319
387 3300005719 Ga0068861_100231144 Ga0068861_1002311442 319
388 3300005937 Ga0081455_10055712 Ga0081455_100557123 319
389 3300005981 Ga0081538_10018942 Ga0081538_100189422 319
390 3300005983 Ga0081540_1003760 Ga0081540_10037607 319
391 3300006048 Ga0075363_100044802 Ga0075363_1000448022 319
392 3300006177 Ga0075362_10042086 Ga0075362_100420862 319
393 3300006881 Ga0068865_100190814 Ga0068865_1001908143 319
394 3300006931 Ga0097620_100099818 Ga0097620_1000998182 319
395 3300009092 Ga0105250_10098508 Ga0105250_100985082 319
396 3300014325 Ga0163163_10114371 Ga0163163_101143712 319
397 3300017792 Ga0163161_10043069 Ga0163161_100430693 319
398 3300025901 Ga0207688_10050963 Ga0207688_100509632 319
399 3300025906 Ga0207699_10007439 Ga0207699_100074394 319
400 3300025916 Ga0207663_10004543 Ga0207663_100045432 319
401 3300025918 Ga0207662_10101726 Ga0207662_101017261 319
402 3300025924 Ga0207694_10285236 Ga0207694_102852362 319
403 3300025938 Ga0207704_10114618 Ga0207704_101146182 319
404 3300025961 Ga0207712_10014753 Ga0207712_100147533 319
405 3300025972 Ga0207668_10076918 Ga0207668_100769182 319
406 3300025972 Ga0207668_10241948 Ga0207668_102419481 319
407 3300026035 Ga0207703_10198149 Ga0207703_101981491 319
408 3300026067 Ga0207678_10044806 Ga0207678_100448064 319
409 3300026089 Ga0207648_10020554 Ga0207648_100205546 319
410 3300026116 Ga0207674_10539896 Ga0207674_105398961 319
411 3300026118 Ga0207675_100308595 Ga0207675_1003085952 319
412 3300026121 Ga0207683_10270104 Ga0207683_102701042 319
413 3300028379 Ga0268266_10003236 Ga0268266_1000323619 319
414 3300028379 Ga0268266_10443498 Ga0268266_104434981 319
415 3300028786 Ga0307517_10094318 Ga0307517_100943182 319
416 3300031241 Ga0265325_10000052 Ga0265325_1000005211 319
417 3300031507 Ga0307509_10086077 Ga0307509_100860773 319
418 3300031901 Ga0307406_10259710 Ga0307406_102597101 319
419 3300032126 Ga0307415_100124964 Ga0307415_1001249641 319
420 3300033180 Ga0307510_10039344 Ga0307510_100393442 319
421 3300035113 Ga0373936_0079272 Ga0373936_0079272_117_1082 319
422 3300035113 Ga0373936_0090163 Ga0373936_0090163_81_1046 319
423 3300035172 Ga0373955_0008249 Ga0373955_0008249_1669_2634 319
424 3300035724 Ga0373933_0088192 Ga0373933_0088192_691_1656 319
425 3300036401 Ga0373937_0020492 Ga0373937_0020492_3812_4777 319
426 3300037068 Ga0373925_0019330 Ga0373925_0019330_3681_4646 319
427 3300046454 Ga0495592_0001683 Ga0495592_0001683_4839_5804 319
428 3300046454 Ga0495592_0255999 Ga0495592_0255999_17_982 319
429 3300046460 Ga0495638_0031422 Ga0495638_0031422_206_1165 319
430 3300046516 Ga0495628_0001265 Ga0495628_0001265_14511_15476 319
431 3300046516 Ga0495628_0167681 Ga0495628_0167681_343_1308 319
432 3300046519 Ga0495632_0104076 Ga0495632_0104076_299_1258 319
433 3300046529 Ga0495652_0017682 Ga0495652_0017682_827_1792 319
434 3300046533 Ga0495640_0065469 Ga0495640_0065469_1073_2038 319
435 3300046543 Ga0495645_0000689 Ga0495645_0000689_2405_3370 319
436 3300046559 Ga0495667_0001076 Ga0495667_0001076_2428_3393 319
437 3300046615 Ga0495656_0015638 Ga0495656_0015638_588_1547 319
438 3300046683 Ga0495658_0020102 Ga0495658_0020102_458_1423 319
439 3300046809 Ga0495600_0039981 Ga0495600_0039981_699_1664 319
440 3300047317 Ga0495604_0045426 Ga0495604_0045426_1666_2631 319
441 3300047319 Ga0495674_0116333 Ga0495674_0116333_472_1437 319
442 3300047322 Ga0495680_0009229 Ga0495680_0009229_4894_5859 319
443 3300047322 Ga0495680_0126216 Ga0495680_0126216_487_1452 319
444 3300047444 Ga0495675_0013450 Ga0495675_0013450_3745_4710 319
445 3300048088 Ga0495602_0044179 Ga0495602_0044179_1014_1979 319
446 3300048905 Ga0496102_0605192 Ga0496102_0605192_32_991 319
447 3300048906 Ga0496103_0036389 Ga0496103_0036389_179_1138 319
448 3300048907 Ga0496104_0000425 Ga0496104_0000425_5650_6615 319
449 3300048908 Ga0496105_0000531 Ga0496105_0000531_14572_15537 319
450 3300048908 Ga0496105_0040471 Ga0496105_0040471_475_1440 319
451 3300048929 Ga0496126_0004022 Ga0496126_0004022_15334_16293 319
452 3300049459 Ga0495678_067049 Ga0495678_067049_301_1260 319
453 3300049572 Ga0501036_0263092 Ga0501036_0263092_394_1353 319
454 3300049587 Ga0501071_0093838 Ga0501071_0093838_313_1272 319
455 3300049592 Ga0501076_0129014 Ga0501076_0129014_953_1912 319
456 3300049743 Ga0501081_0275064 Ga0501081_0275064_87_1046 319
457 3300053077 Ga0495601_0000408 Ga0495601_0000408_9261_10226 319
458 3300053077 Ga0495601_0023161 Ga0495601_0023161_1916_2881 319
459 3300053084 Ga0495595_0001343 Ga0495595_0001343_8313_9278 319
460 3300053084 Ga0495595_0002116 Ga0495595_0002116_1005_1970 319
461 3300053085 Ga0495619_0000086 Ga0495619_0000086_34501_35466 319
462 3300053085 Ga0495619_0001999 Ga0495619_0001999_2881_3846 319
463 3300053096 Ga0500641_0052497 Ga0500641_0052497_506_1465 319
464 3300053133 Ga0500655_013979 Ga0500655_013979_211_1170 319
465 3300053730 Ga0500645_012185 Ga0500645_012185_119_1078 319
466 3300053730 Ga0500645_018795 Ga0500645_018795_604_1563 319
467 3300053731 Ga0500609_010288 Ga0500609_010288_24_983 319
468 iso_pu_bacteria 2602042107 2603862322 319
469 iso_pu_bacteria 2857524615 2857525789 319
470 iso_pu_bacteria 2893066018 2893067918 319
471 iso_pu_bacteria 2919073203 2919074347 319
472 3300005331 Ga0070670_100185088 Ga0070670_1001850882 320
473 3300005547 Ga0070693_100052712 Ga0070693_1000527121 320
474 3300005983 Ga0081540_1000007 Ga0081540_100000757 320
475 3300006038 Ga0075365_10124679 Ga0075365_101246792 320
476 3300006173 Ga0070716_100091342 Ga0070716_1000913422 320
477 3300006195 Ga0075366_10054790 Ga0075366_100547903 320
478 3300007788 Ga0099795_10000703 Ga0099795_100007033 320
479 3300009093 Ga0105240_10115445 Ga0105240_101154452 320
480 3300009174 Ga0105241_10098442 Ga0105241_100984422 320
481 3300009551 Ga0105238_10212114 Ga0105238_102121142 320
482 3300025909 Ga0207705_10011317 Ga0207705_100113172 320
483 3300025910 Ga0207684_10044656 Ga0207684_100446562 320
484 3300025911 Ga0207654_10062373 Ga0207654_100623732 320
485 3300025913 Ga0207695_10149237 Ga0207695_101492372 320
486 3300025924 Ga0207694_10052701 Ga0207694_100527012 320
487 3300025936 Ga0207670_10119122 Ga0207670_101191223 320
488 3300025939 Ga0207665_10000825 Ga0207665_100008255 320
489 3300046473 Ga0495582_0042184 Ga0495582_0042184_1075_2046 320
490 3300048904 Ga0496101_0210005 Ga0496101_0210005_325_1302 320
491 3300049579 Ga0501043_0059467 Ga0501043_0059467_1110_2078 320
492 3300049580 Ga0501046_0014710 Ga0501046_0014710_3698_4666 320
493 3300049590 Ga0501074_0029088 Ga0501074_0029088_38_1006 320
494 3300049592 Ga0501076_0140669 Ga0501076_0140669_389_1354 320
495 3300050492 nmdc:mga0yw44_52052_c1 nmdc:mga0yw44_52052_c1_1287_2258 320
496 3300050514 nmdc:mga08x19_102629_c1 nmdc:mga08x19_102629_c1_44_1021 320
497 3300053085 Ga0495619_0028424 Ga0495619_0028424_1618_2589 320
498 iso_pu_bacteria 2513237098 2513678718 320
499 iso_pu_bacteria 2524023210 2524465454 320
500 iso_pu_bacteria 2885383462 2885391524 320
501 iso_pu_bacteria 2903768456 2903776347 320
502 iso_pu_bacteria 8056681323 8056681519 320
503 3300003215 JGI25153J46596_10000848 JGI25153J46596_1000084819 321
504 3300005327 Ga0070658_10118531 Ga0070658_101185312 321
505 3300005329 Ga0070683_100099443 Ga0070683_1000994432 321
506 3300005338 Ga0068868_100200790 Ga0068868_1002007902 321
507 3300005355 Ga0070671_100164986 Ga0070671_1001649862 321
508 3300005364 Ga0070673_100136831 Ga0070673_1001368312 321
509 3300005456 Ga0070678_100019735 Ga0070678_1000197353 321
510 3300005457 Ga0070662_100315020 Ga0070662_1003150201 321
511 3300005518 Ga0070699_100190953 Ga0070699_1001909532 321
512 3300005548 Ga0070665_100103879 Ga0070665_1001038792 321
513 3300005564 Ga0070664_100059073 Ga0070664_1000590732 321
514 3300005577 Ga0068857_100289977 Ga0068857_1002899772 321
515 3300005616 Ga0068852_100425866 Ga0068852_1004258662 321
516 3300005618 Ga0068864_100022139 Ga0068864_1000221396 321
517 3300005983 Ga0081540_1010261 Ga0081540_10102612 321
518 3300006358 Ga0068871_100024851 Ga0068871_1000248512 321
519 3300006844 Ga0075428_100029277 Ga0075428_1000292773 321
520 3300014969 Ga0157376_10078350 Ga0157376_100783504 321
521 3300025297 Ga0209758_1015586 Ga0209758_10155862 321
522 3300025909 Ga0207705_10079109 Ga0207705_100791092 321
523 3300025934 Ga0207686_10046307 Ga0207686_100463071 321
524 3300025942 Ga0207689_10042878 Ga0207689_100428782 321
525 3300025945 Ga0207679_10025720 Ga0207679_100257202 321
526 3300025961 Ga0207712_10196885 Ga0207712_101968852 321
527 3300026023 Ga0207677_10165186 Ga0207677_101651862 321
528 3300026067 Ga0207678_10018631 Ga0207678_100186314 321
529 3300026095 Ga0207676_10073096 Ga0207676_100730961 321
530 3300028380 Ga0268265_10009313 Ga0268265_100093132 321
531 3300028381 Ga0268264_10080039 Ga0268264_100800392 321
532 3300028381 Ga0268264_10382397 Ga0268264_103823971 321
533 3300032005 Ga0307411_10375976 Ga0307411_103759762 321
534 3300046684 Ga0495669_0039152 Ga0495669_0039152_554_1519 321
535 3300048903 Ga0496100_0065250 Ga0496100_0065250_1379_2344 321
536 3300048907 Ga0496104_0039091 Ga0496104_0039091_733_1698 321
537 3300048924 Ga0496121_0000214 Ga0496121_0000214_46713_47678 321
538 3300048929 Ga0496126_0061537 Ga0496126_0061537_2198_3178 321
539 3300050490 nmdc:mga03n38_2974_c1 nmdc:mga03n38_2974_c1_4148_5113 321
540 3300050492 nmdc:mga0yw44_64140_c1 nmdc:mga0yw44_64140_c1_470_1435 321
541 3300050494 nmdc:mga06z11_42145_c1 nmdc:mga06z11_42145_c1_1088_2053 321
542 3300050496 nmdc:mga07m45_1913_c3 nmdc:mga07m45_1913_c3_4351_5316 321
543 3300005937 Ga0081455_10010660 Ga0081455_100106604 322
544 3300005983 Ga0081540_1013903 Ga0081540_10139032 322
545 3300047320 Ga0495672_0076801 Ga0495672_0076801_268_1236 322
546 3300048916 Ga0496113_0251642 Ga0496113_0251642_43_1011 322
547 3300006028 Ga0070717_10245887 Ga0070717_102458872 323
548 3300031456 Ga0307513_10163215 Ga0307513_101632152 323
549 3300048905 Ga0496102_0028253 Ga0496102_0028253_479_1507 323
550 3300049574 Ga0501038_0164773 Ga0501038_0164773_783_1760 323
551 3300049581 Ga0501047_0012016 Ga0501047_0012016_4953_5930 323
552 3300049586 Ga0501070_0039003 Ga0501070_0039003_2710_3687 323
553 3300049822 Ga0501035_0101824 Ga0501035_0101824_278_1255 323
554 3300049823 Ga0501044_0211729 Ga0501044_0211729_858_1835 323
555 iso_pu_bacteria 2643221651 2644289962 323
556 3300005456 Ga0070678_100308295 Ga0070678_1003082952 324
557 3300005536 Ga0070697_100068617 Ga0070697_1000686172 324
558 3300005548 Ga0070665_100021790 Ga0070665_1000217902 324
559 3300005981 Ga0081538_10064152 Ga0081538_100641522 324
560 3300006038 Ga0075365_10003658 Ga0075365_100036582 324
561 3300006042 Ga0075368_10038643 Ga0075368_100386432 324
562 3300006048 Ga0075363_100017762 Ga0075363_1000177622 324
563 3300006178 Ga0075367_10057510 Ga0075367_100575102 324
564 3300006353 Ga0075370_10017942 Ga0075370_100179423 324
565 3300007265 Ga0099794_10011943 Ga0099794_100119433 324
566 3300009147 Ga0114129_10143177 Ga0114129_101431773 324
567 3300026067 Ga0207678_10000808 Ga0207678_100008088 324
568 3300026121 Ga0207683_10016805 Ga0207683_100168056 324
569 3300026121 Ga0207683_10548046 Ga0207683_105480461 324
570 3300027866 Ga0209813_10014130 Ga0209813_100141302 324
571 3300028379 Ga0268266_10039251 Ga0268266_100392512 324
572 3300028786 Ga0307517_10001037 Ga0307517_100010379 324
573 3300028794 Ga0307515_10079255 Ga0307515_100792552 324
574 3300046523 Ga0495644_0045670 Ga0495644_0045670_310_1284 324
575 3300046537 Ga0495598_0027515 Ga0495598_0027515_573_1547 324
576 3300046558 Ga0495633_0040139 Ga0495633_0040139_382_1356 324
577 3300046664 Ga0495659_0049239 Ga0495659_0049239_400_1374 324
578 3300048905 Ga0496102_0002605 Ga0496102_0002605_10490_11464 324
579 3300048908 Ga0496105_0017634 Ga0496105_0017634_974_1948 324
580 3300048909 Ga0496106_0005613 Ga0496106_0005613_8212_9186 324
581 3300048911 Ga0496108_0103812 Ga0496108_0103812_708_1682 324
582 3300048912 Ga0496109_0023243 Ga0496109_0023243_669_1643 324
583 3300048913 Ga0496110_0006549 Ga0496110_0006549_5153_6127 324
584 3300048914 Ga0496111_0069801 Ga0496111_0069801_594_1568 324
585 3300048915 Ga0496112_0113777 Ga0496112_0113777_519_1493 324
586 3300048916 Ga0496113_0009303 Ga0496113_0009303_4861_5835 324
587 3300048918 Ga0496115_0012773 Ga0496115_0012773_4416_5390 324
588 3300048929 Ga0496126_0019846 Ga0496126_0019846_2403_3377 324
589 3300048929 Ga0496126_0153496 Ga0496126_0153496_882_1856 324
590 3300049572 Ga0501036_0071937 Ga0501036_0071937_1044_2024 324
591 3300049584 Ga0501068_0292002 Ga0501068_0292002_42_1016 324
592 3300050507 nmdc:mga05p37_39963_c1 nmdc:mga05p37_39963_c1_2288_3262 324
593 3300050508 nmdc:mga09592_163159_c1 nmdc:mga09592_163159_c1_686_1660 324
594 3300050515 nmdc:mga0a205_253298_c1 nmdc:mga0a205_253298_c1_507_1481 324
595 3300050516 nmdc:mga0sz30_37113_c1 nmdc:mga0sz30_37113_c1_125_1099 324
596 3300053118 Ga0500594_0008945 Ga0500594_0008945_446_1420 324
597 3300053139 Ga0500568_0024204 Ga0500568_0024204_1321_2298 324
598 3300003203 JGI25406J46586_10003204 JGI25406J46586_100032045 325
599 3300005937 Ga0081455_10010660 Ga0081455_100106603 325
600 3300005983 Ga0081540_1004726 Ga0081540_10047268 325
601 3300005985 Ga0081539_10000040 Ga0081539_10000040125 325
602 3300007265 Ga0099794_10001834 Ga0099794_100018346 325
603 3300046507 Ga0495606_0014980 Ga0495606_0014980_2573_3550 325
604 3300047469 Ga0495673_0083002 Ga0495673_0083002_277_1260 325
605 3300048915 Ga0496112_0000244 Ga0496112_0000244_24631_25608 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16868

NMT1_3

NMT1-like family

35

308

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.9095 30 323
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.898 30 323
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.8838 28 322
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.8673 28 322
4esw-assembly1.cif.gz_B crystal structure of c. albicans thi5 h66g mutant 0.7352 31 293
ID Description Score Start End Superfamily
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9468 118 257 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9336 118 257 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9095 118 257 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8972 118 257 3.40.190.10
4dddA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8465 28 322 3.40.190.10
ID Description Score Start End GO Terms
AF-C0GKC4-F1-model_v4 TRAP transporter solute receptor, TAXI family 0.9697 29 321 GO:0016020
AF-A0A2N5K6P8-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9695 67 325
AF-A0A7V8X6N9-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9656 35 325
AF-A0A2N5K6P8-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9622 67 325
AF-A0A139CWP3-F1-model_v4 TRAP transporter solute receptor, TAXI family 0.9544 48 321

Feature Viewer

pLDDT pTM Quality
90.11 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map