F468521
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 331 | 581 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0000164|Ga0496125_0000164_6639_7616 |
| Length | 311 |
| Sequence | MLTKIRETAVALAVALTASLALAGSVHAQQKTIAIGTGGTGGVYYPLGGAIANVLSKSLPNVQATAEVTGGSVDNLKLIASGQSELGFSMADAALDALNGQDKFKSGKVPLQTLLVVYPNRMHVVTVEGTGIEKMADLKGKRVSTGSPGSATEVMAFRVLELGVAESVNAIKDRKIDAFLWVGGIPTAAVTDLAATPGLKMKLIDHSDTVEKMNAKYGKLYSASTIKAGAYPGTDKDNTIAEVWNIIVTGDKMSNDDAYNIVKTLVEKKADIVAVHKEAESFSLDNQIQERSPIPFHPGALKYFKEKGIGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 4 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 5 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 6 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 7 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 8 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 9 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 10 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 11 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 12 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 13 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 14 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 15 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 16 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 17 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 300 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 316 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 327 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 328 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 329 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 330 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 331 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.36 |
| Metatranscriptomes | 0 |
| Isolates | 3.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.11 |
| Nodule | 1.98 |
| Rhizoplane | 5.29 |
| Rhizosphere | 81.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10003204 | 3300003203 | Bacteria | 7699 |
| 2 | JGI25153J46596_10000848 | 3300003215 | Bacteria | 18741 |
| 3 | Ga0070658_10118531 | 3300005327 | Bacteria | 2198 |
| 4 | Ga0070683_100099443 | 3300005329 | Bacteria | 2738 |
| 5 | Ga0070683_100295551 | 3300005329 | Bacteria | 1540 |
| 6 | Ga0070690_100000791 | 3300005330 | Bacteria | 16062 |
| 7 | Ga0070690_100055664 | 3300005330 | Bacteria | 2534 |
| 8 | Ga0070670_100025554 | 3300005331 | Bacteria | 5080 |
| 9 | Ga0070670_100185088 | 3300005331 | Bacteria | 1808 |
| 10 | Ga0070670_100219266 | 3300005331 | Bacteria | 1655 |
| 11 | Ga0070677_10075644 | 3300005333 | Bacteria | 1428 |
| 12 | Ga0068869_100001018 | 3300005334 | Bacteria | 16298 |
| 13 | Ga0070666_10117286 | 3300005335 | Bacteria | 1844 |
| 14 | Ga0070666_10255695 | 3300005335 | Bacteria | 1241 |
| 15 | Ga0070680_100070820 | 3300005336 | Bacteria | 2864 |
| 16 | Ga0070680_100089741 | 3300005336 | Bacteria | 2543 |
| 17 | Ga0070682_100047685 | 3300005337 | Bacteria | 2665 |
| 18 | Ga0068868_100001147 | 3300005338 | Bacteria | 18142 |
| 19 | Ga0068868_100033478 | 3300005338 | Bacteria | 3961 |
| 20 | Ga0068868_100200790 | 3300005338 | Bacteria | 1662 |
| 21 | Ga0070689_100005181 | 3300005340 | Bacteria | 8873 |
| 22 | Ga0070691_10000180 | 3300005341 | Bacteria | 20810 |
| 23 | Ga0070691_10162977 | 3300005341 | Bacteria | 1151 |
| 24 | Ga0070687_100000304 | 3300005343 | Bacteria | 16643 |
| 25 | Ga0070668_100017930 | 3300005347 | Bacteria | 5310 |
| 26 | Ga0070668_100100845 | 3300005347 | Bacteria | 2287 |
| 27 | Ga0070675_100189574 | 3300005354 | Bacteria | 1781 |
| 28 | Ga0070671_100068520 | 3300005355 | Bacteria | 2959 |
| 29 | Ga0070671_100093563 | 3300005355 | Bacteria | 2519 |
| 30 | Ga0070671_100164986 | 3300005355 | Bacteria | 1873 |
| 31 | Ga0070671_100328867 | 3300005355 | Bacteria | 1303 |
| 32 | Ga0070673_100136831 | 3300005364 | Bacteria | 2063 |
| 33 | Ga0070673_100193567 | 3300005364 | Bacteria | 1748 |
| 34 | Ga0070673_100321477 | 3300005364 | Bacteria | 1367 |
| 35 | Ga0070688_100040776 | 3300005365 | Bacteria | 2847 |
| 36 | Ga0070659_100054404 | 3300005366 | Bacteria | 3152 |
| 37 | Ga0070659_100104435 | 3300005366 | Bacteria | 2282 |
| 38 | Ga0070667_100081864 | 3300005367 | Bacteria | 2763 |
| 39 | Ga0070709_10010157 | 3300005434 | Bacteria | 5202 |
| 40 | Ga0070714_100002637 | 3300005435 | Bacteria | 13209 |
| 41 | Ga0070713_100006368 | 3300005436 | Bacteria | 8175 |
| 42 | Ga0070713_100011188 | 3300005436 | Bacteria | 6525 |
| 43 | Ga0070710_10004375 | 3300005437 | Bacteria | 6691 |
| 44 | Ga0070701_10000171 | 3300005438 | Bacteria | 20076 |
| 45 | Ga0070711_100010693 | 3300005439 | Bacteria | 5686 |
| 46 | Ga0070711_100017819 | 3300005439 | Bacteria | 4526 |
| 47 | Ga0070705_100001907 | 3300005440 | Bacteria | 10710 |
| 48 | Ga0070700_100000396 | 3300005441 | Bacteria | 22554 |
| 49 | Ga0070700_100154789 | 3300005441 | Bacteria | 1572 |
| 50 | Ga0070694_100000367 | 3300005444 | Bacteria | 24183 |
| 51 | Ga0070663_100041806 | 3300005455 | Bacteria | 3218 |
| 52 | Ga0070663_100092183 | 3300005455 | Bacteria | 2246 |
| 53 | Ga0070678_100019735 | 3300005456 | Bacteria | 4404 |
| 54 | Ga0070678_100059797 | 3300005456 | Bacteria | 2802 |
| 55 | Ga0070678_100073433 | 3300005456 | Bacteria | 2567 |
| 56 | Ga0070678_100308295 | 3300005456 | Bacteria | 1348 |
| 57 | Ga0070662_100315020 | 3300005457 | Bacteria | 1274 |
| 58 | Ga0070681_10145128 | 3300005458 | Bacteria | 2302 |
| 59 | Ga0068867_100002868 | 3300005459 | Bacteria | 12133 |
| 60 | Ga0068867_100115140 | 3300005459 | Bacteria | 2070 |
| 61 | Ga0070685_10186065 | 3300005466 | Bacteria | 1340 |
| 62 | Ga0070698_100510536 | 3300005471 | Bacteria | 1140 |
| 63 | Ga0070699_100074011 | 3300005518 | Bacteria | 2964 |
| 64 | Ga0070699_100190953 | 3300005518 | Bacteria | 1819 |
| 65 | Ga0070679_100035218 | 3300005530 | Bacteria | 4967 |
| 66 | Ga0070697_100036963 | 3300005536 | Bacteria | 3944 |
| 67 | Ga0070697_100068617 | 3300005536 | Bacteria | 2903 |
| 68 | Ga0068853_100159030 | 3300005539 | Bacteria | 2037 |
| 69 | Ga0068853_100208784 | 3300005539 | Bacteria | 1779 |
| 70 | Ga0068853_100211361 | 3300005539 | Bacteria | 1768 |
| 71 | Ga0068853_100487288 | 3300005539 | Bacteria | 1163 |
| 72 | Ga0070672_100029603 | 3300005543 | Bacteria | 4107 |
| 73 | Ga0070672_100360364 | 3300005543 | Bacteria | 1241 |
| 74 | Ga0070686_100000664 | 3300005544 | Bacteria | 20136 |
| 75 | Ga0070695_100000111 | 3300005545 | Bacteria | 36343 |
| 76 | Ga0070695_100000897 | 3300005545 | Bacteria | 16062 |
| 77 | Ga0070696_100000082 | 3300005546 | Bacteria | 47144 |
| 78 | Ga0070696_100007382 | 3300005546 | Bacteria | 7344 |
| 79 | Ga0070696_100082352 | 3300005546 | Bacteria | 2281 |
| 80 | Ga0070693_100000114 | 3300005547 | Bacteria | 35958 |
| 81 | Ga0070693_100052712 | 3300005547 | Bacteria | 2333 |
| 82 | Ga0070693_100054909 | 3300005547 | Bacteria | 2292 |
| 83 | Ga0070665_100021790 | 3300005548 | Bacteria | 6443 |
| 84 | Ga0070665_100056105 | 3300005548 | Bacteria | 3950 |
| 85 | Ga0070665_100103879 | 3300005548 | Bacteria | 2844 |
| 86 | Ga0070665_100109032 | 3300005548 | Bacteria | 2771 |
| 87 | Ga0070665_100110277 | 3300005548 | Bacteria | 2754 |
| 88 | Ga0070704_100000018 | 3300005549 | Bacteria | 54668 |
| 89 | Ga0070704_100019690 | 3300005549 | Bacteria | 4340 |
| 90 | Ga0068855_100008462 | 3300005563 | Bacteria | 12442 |
| 91 | Ga0068855_100030518 | 3300005563 | Bacteria | 6446 |
| 92 | Ga0070664_100059073 | 3300005564 | Bacteria | 3262 |
| 93 | Ga0068857_100065746 | 3300005577 | Bacteria | 3225 |
| 94 | Ga0068857_100110296 | 3300005577 | Bacteria | 2473 |
| 95 | Ga0068857_100289977 | 3300005577 | Bacteria | 1507 |
| 96 | Ga0068854_100014836 | 3300005578 | Bacteria | 5144 |
| 97 | Ga0068854_100068691 | 3300005578 | Bacteria | 2584 |
| 98 | Ga0068854_100081524 | 3300005578 | Bacteria | 2390 |
| 99 | Ga0068856_100015015 | 3300005614 | Bacteria | 7481 |
| 100 | Ga0068856_100070791 | 3300005614 | Bacteria | 3451 |
| 101 | Ga0070702_100000345 | 3300005615 | Bacteria | 16164 |
| 102 | Ga0070702_100021506 | 3300005615 | Bacteria | 3395 |
| 103 | Ga0070702_100107646 | 3300005615 | Bacteria | 1722 |
| 104 | Ga0068852_100037238 | 3300005616 | Bacteria | 4077 |
| 105 | Ga0068852_100164377 | 3300005616 | Bacteria | 2075 |
| 106 | Ga0068852_100425866 | 3300005616 | Bacteria | 1310 |
| 107 | Ga0068859_100001261 | 3300005617 | Bacteria | 25857 |
| 108 | Ga0068859_100045230 | 3300005617 | Bacteria | 4423 |
| 109 | Ga0068859_100091398 | 3300005617 | Bacteria | 3094 |
| 110 | Ga0068859_100099818 | 3300005617 | Bacteria | 2958 |
| 111 | Ga0068859_100390420 | 3300005617 | Bacteria | 1487 |
| 112 | Ga0068859_100504564 | 3300005617 | Unclassified | 1305 |
| 113 | Ga0068864_100022139 | 3300005618 | Bacteria | 5327 |
| 114 | Ga0068864_100099012 | 3300005618 | Bacteria | 2583 |
| 115 | Ga0068864_100125032 | 3300005618 | Bacteria | 2304 |
| 116 | Ga0068864_100289542 | 3300005618 | Bacteria | 1531 |
| 117 | Ga0068866_10022999 | 3300005718 | Bacteria | 2893 |
| 118 | Ga0068861_100001057 | 3300005719 | Bacteria | 16951 |
| 119 | Ga0068861_100132611 | 3300005719 | Bacteria | 2024 |
| 120 | Ga0068861_100231144 | 3300005719 | Bacteria | 1568 |
| 121 | Ga0068861_100344084 | 3300005719 | Bacteria | 1306 |
| 122 | Ga0068851_10025656 | 3300005834 | Bacteria | 2892 |
| 123 | Ga0068851_10055329 | 3300005834 | Bacteria | 2021 |
| 124 | Ga0068870_10102035 | 3300005840 | Bacteria | 1623 |
| 125 | Ga0068863_100285773 | 3300005841 | Bacteria | 1599 |
| 126 | Ga0068858_100003300 | 3300005842 | Bacteria | 16062 |
| 127 | Ga0068858_100071799 | 3300005842 | Bacteria | 3211 |
| 128 | Ga0068858_100102517 | 3300005842 | Bacteria | 2669 |
| 129 | Ga0068858_100105936 | 3300005842 | Bacteria | 2624 |
| 130 | Ga0068860_100002554 | 3300005843 | Bacteria | 19028 |
| 131 | Ga0068860_100091350 | 3300005843 | Bacteria | 2900 |
| 132 | Ga0068860_100215423 | 3300005843 | Bacteria | 1863 |
| 133 | Ga0068862_100002561 | 3300005844 | Bacteria | 16062 |
| 134 | Ga0068862_100115607 | 3300005844 | Bacteria | 2359 |
| 135 | Ga0081455_10002253 | 3300005937 | Bacteria | 22969 |
| 136 | Ga0081455_10010660 | 3300005937 | Bacteria | 9299 |
| 137 | Ga0081455_10055712 | 3300005937 | Bacteria | 3362 |
| 138 | Ga0081538_10018942 | 3300005981 | Bacteria | 5143 |
| 139 | Ga0081538_10064152 | 3300005981 | Bacteria | 2079 |
| 140 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 141 | Ga0081540_1001425 | 3300005983 | Bacteria | 20682 |
| 142 | Ga0081540_1002471 | 3300005983 | Bacteria | 15050 |
| 143 | Ga0081540_1003760 | 3300005983 | Bacteria | 11893 |
| 144 | Ga0081540_1004726 | 3300005983 | Bacteria | 10301 |
| 145 | Ga0081540_1010261 | 3300005983 | Bacteria | 6361 |
| 146 | Ga0081540_1013903 | 3300005983 | Bacteria | 5198 |
| 147 | Ga0081540_1023015 | 3300005983 | Bacteria | 3661 |
| 148 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 149 | Ga0081539_10011100 | 3300005985 | Bacteria | 7192 |
| 150 | Ga0081539_10044462 | 3300005985 | Bacteria | 2564 |
| 151 | Ga0070717_10009751 | 3300006028 | Bacteria | 7230 |
| 152 | Ga0070717_10245887 | 3300006028 | Bacteria | 1579 |
| 153 | Ga0075365_10003658 | 3300006038 | Bacteria | 7976 |
| 154 | Ga0075365_10124679 | 3300006038 | Bacteria | 1779 |
| 155 | Ga0075368_10038643 | 3300006042 | Bacteria | 1869 |
| 156 | Ga0075363_100006644 | 3300006048 | Bacteria | 5271 |
| 157 | Ga0075363_100017762 | 3300006048 | Bacteria | 3533 |
| 158 | Ga0075363_100044802 | 3300006048 | Bacteria | 2345 |
| 159 | Ga0075364_10010611 | 3300006051 | Bacteria | 5571 |
| 160 | Ga0070716_100091342 | 3300006173 | Bacteria | 1843 |
| 161 | Ga0075362_10042086 | 3300006177 | Bacteria | 2018 |
| 162 | Ga0075367_10011619 | 3300006178 | Bacteria | 4669 |
| 163 | Ga0075367_10028585 | 3300006178 | Bacteria | 3182 |
| 164 | Ga0075367_10043882 | 3300006178 | Bacteria | 2619 |
| 165 | Ga0075367_10057510 | 3300006178 | Bacteria | 2312 |
| 166 | Ga0075367_10084720 | 3300006178 | Bacteria | 1922 |
| 167 | Ga0075369_10003048 | 3300006186 | Bacteria | 6064 |
| 168 | Ga0075366_10054790 | 3300006195 | Bacteria | 2369 |
| 169 | Ga0097621_100001358 | 3300006237 | Bacteria | 16852 |
| 170 | Ga0075370_10017942 | 3300006353 | Bacteria | 3831 |
| 171 | Ga0068871_100024851 | 3300006358 | Bacteria | 4651 |
| 172 | Ga0068871_100035845 | 3300006358 | Bacteria | 3945 |
| 173 | Ga0075428_100029277 | 3300006844 | Bacteria | 6093 |
| 174 | Ga0075428_100065717 | 3300006844 | Bacteria | 3972 |
| 175 | Ga0075428_100143090 | 3300006844 | Bacteria | 2600 |
| 176 | Ga0075430_100047470 | 3300006846 | Bacteria | 3626 |
| 177 | Ga0075430_100082487 | 3300006846 | Bacteria | 2694 |
| 178 | Ga0075431_100062005 | 3300006847 | Bacteria | 3858 |
| 179 | Ga0075431_100259473 | 3300006847 | Bacteria | 1764 |
| 180 | Ga0075433_10001083 | 3300006852 | Bacteria | 19628 |
| 181 | Ga0075433_10053925 | 3300006852 | Bacteria | 3507 |
| 182 | Ga0075434_100000358 | 3300006871 | Bacteria | 33110 |
| 183 | Ga0075434_100002085 | 3300006871 | Bacteria | 17375 |
| 184 | Ga0075434_100094427 | 3300006871 | Bacteria | 2996 |
| 185 | Ga0075434_100104296 | 3300006871 | Bacteria | 2845 |
| 186 | Ga0068865_100000555 | 3300006881 | Bacteria | 20766 |
| 187 | Ga0068865_100184990 | 3300006881 | Bacteria | 1607 |
| 188 | Ga0068865_100190814 | 3300006881 | Bacteria | 1584 |
| 189 | Ga0075436_100001595 | 3300006914 | Bacteria | 15494 |
| 190 | Ga0075436_100035412 | 3300006914 | Bacteria | 3445 |
| 191 | Ga0097620_100001261 | 3300006931 | Bacteria | 25857 |
| 192 | Ga0097620_100045232 | 3300006931 | Bacteria | 4423 |
| 193 | Ga0097620_100091400 | 3300006931 | Bacteria | 3094 |
| 194 | Ga0097620_100099818 | 3300006931 | Bacteria | 2958 |
| 195 | Ga0097620_100390398 | 3300006931 | Bacteria | 1487 |
| 196 | Ga0097620_100504571 | 3300006931 | Unclassified | 1305 |
| 197 | Ga0075435_100000518 | 3300007076 | Bacteria | 23614 |
| 198 | Ga0075435_100000614 | 3300007076 | Bacteria | 21898 |
| 199 | Ga0099794_10001834 | 3300007265 | Bacteria | 7595 |
| 200 | Ga0099794_10011943 | 3300007265 | Bacteria | 3734 |
| 201 | Ga0099795_10000703 | 3300007788 | Bacteria | 6496 |
| 202 | Ga0105250_10098508 | 3300009092 | Bacteria | 1192 |
| 203 | Ga0105240_10115445 | 3300009093 | Bacteria | 3241 |
| 204 | Ga0111539_10014436 | 3300009094 | Bacteria | 9858 |
| 205 | Ga0111539_10023073 | 3300009094 | Bacteria | 7642 |
| 206 | Ga0111539_10067195 | 3300009094 | Bacteria | 4233 |
| 207 | Ga0111539_10292922 | 3300009094 | Bacteria | 1894 |
| 208 | Ga0105245_10002939 | 3300009098 | Bacteria | 15302 |
| 209 | Ga0105245_10006058 | 3300009098 | Bacteria | 10630 |
| 210 | Ga0114129_10143177 | 3300009147 | Bacteria | 3276 |
| 211 | Ga0105243_10002682 | 3300009148 | Bacteria | 14791 |
| 212 | Ga0105241_10004461 | 3300009174 | Bacteria | 10354 |
| 213 | Ga0105241_10098442 | 3300009174 | Bacteria | 2320 |
| 214 | Ga0105242_10000987 | 3300009176 | Bacteria | 22250 |
| 215 | Ga0105237_10044251 | 3300009545 | Bacteria | 4482 |
| 216 | Ga0105238_10212114 | 3300009551 | Bacteria | 1912 |
| 217 | Ga0105246_10062671 | 3300011119 | Bacteria | 2591 |
| 218 | Ga0105246_10147410 | 3300011119 | Bacteria | 1777 |
| 219 | Ga0157378_10001843 | 3300013297 | Bacteria | 19029 |
| 220 | Ga0157372_10166417 | 3300013307 | Bacteria | 2550 |
| 221 | Ga0157375_10147768 | 3300013308 | Bacteria | 2482 |
| 222 | Ga0157375_10181580 | 3300013308 | Bacteria | 2256 |
| 223 | Ga0163163_10114371 | 3300014325 | Bacteria | 2729 |
| 224 | Ga0157380_10031003 | 3300014326 | Bacteria | 4101 |
| 225 | Ga0157380_10446498 | 3300014326 | Bacteria | 1241 |
| 226 | Ga0157376_10006926 | 3300014969 | Bacteria | 8035 |
| 227 | Ga0157376_10078350 | 3300014969 | Bacteria | 2829 |
| 228 | Ga0163161_10043069 | 3300017792 | Bacteria | 3250 |
| 229 | Ga0209758_1015586 | 3300025297 | Bacteria | 3922 |
| 230 | Ga0207656_10006815 | 3300025321 | Bacteria | 4130 |
| 231 | Ga0207656_10039581 | 3300025321 | Bacteria | 1995 |
| 232 | Ga0207656_10069167 | 3300025321 | Bacteria | 1566 |
| 233 | Ga0207682_10000069 | 3300025893 | Bacteria | 45399 |
| 234 | Ga0207682_10046202 | 3300025893 | Bacteria | 1789 |
| 235 | Ga0207692_10004880 | 3300025898 | Bacteria | 5340 |
| 236 | Ga0207642_10202354 | 3300025899 | Bacteria | 1098 |
| 237 | Ga0207688_10050963 | 3300025901 | Bacteria | 2318 |
| 238 | Ga0207680_10126738 | 3300025903 | Bacteria | 1677 |
| 239 | Ga0207699_10007439 | 3300025906 | Bacteria | 5359 |
| 240 | Ga0207699_10040723 | 3300025906 | Bacteria | 2679 |
| 241 | Ga0207643_10086869 | 3300025908 | Bacteria | 1818 |
| 242 | Ga0207705_10011317 | 3300025909 | Bacteria | 6461 |
| 243 | Ga0207705_10079109 | 3300025909 | Bacteria | 2394 |
| 244 | Ga0207684_10044656 | 3300025910 | Bacteria | 3758 |
| 245 | Ga0207654_10062373 | 3300025911 | Bacteria | 2184 |
| 246 | Ga0207695_10149237 | 3300025913 | Bacteria | 2278 |
| 247 | Ga0207671_10076432 | 3300025914 | Bacteria | 2506 |
| 248 | Ga0207693_10013978 | 3300025915 | Bacteria | 6465 |
| 249 | Ga0207663_10001469 | 3300025916 | Bacteria | 10987 |
| 250 | Ga0207663_10004543 | 3300025916 | Bacteria | 6912 |
| 251 | Ga0207660_10042880 | 3300025917 | Bacteria | 3178 |
| 252 | Ga0207660_10111596 | 3300025917 | Bacteria | 2058 |
| 253 | Ga0207662_10000269 | 3300025918 | Bacteria | 23948 |
| 254 | Ga0207662_10101726 | 3300025918 | Bacteria | 1781 |
| 255 | Ga0207662_10106992 | 3300025918 | Bacteria | 1740 |
| 256 | Ga0207649_10014762 | 3300025920 | Bacteria | 4381 |
| 257 | Ga0207652_10024979 | 3300025921 | Bacteria | 4962 |
| 258 | Ga0207694_10049322 | 3300025924 | Bacteria | 3259 |
| 259 | Ga0207694_10052701 | 3300025924 | Bacteria | 3154 |
| 260 | Ga0207694_10285236 | 3300025924 | Bacteria | 1357 |
| 261 | Ga0207650_10251659 | 3300025925 | Bacteria | 1430 |
| 262 | Ga0207650_10320957 | 3300025925 | Bacteria | 1268 |
| 263 | Ga0207659_10147265 | 3300025926 | Bacteria | 1835 |
| 264 | Ga0207687_10003693 | 3300025927 | Bacteria | 10301 |
| 265 | Ga0207687_10038544 | 3300025927 | Bacteria | 3266 |
| 266 | Ga0207664_10020236 | 3300025929 | Bacteria | 4929 |
| 267 | Ga0207644_10158453 | 3300025931 | Bacteria | 1757 |
| 268 | Ga0207644_10456387 | 3300025931 | Bacteria | 1050 |
| 269 | Ga0207690_10092970 | 3300025932 | Bacteria | 2136 |
| 270 | Ga0207690_10330082 | 3300025932 | Bacteria | 1201 |
| 271 | Ga0207686_10003451 | 3300025934 | Bacteria | 8490 |
| 272 | Ga0207686_10046307 | 3300025934 | Bacteria | 2682 |
| 273 | Ga0207709_10000759 | 3300025935 | Bacteria | 25445 |
| 274 | Ga0207670_10010027 | 3300025936 | Bacteria | 5437 |
| 275 | Ga0207670_10119122 | 3300025936 | Bacteria | 1916 |
| 276 | Ga0207704_10000698 | 3300025938 | Bacteria | 14805 |
| 277 | Ga0207704_10060081 | 3300025938 | Bacteria | 2350 |
| 278 | Ga0207704_10114618 | 3300025938 | Bacteria | 1830 |
| 279 | Ga0207665_10000825 | 3300025939 | Bacteria | 20977 |
| 280 | Ga0207691_10013055 | 3300025940 | Bacteria | 7953 |
| 281 | Ga0207691_10079903 | 3300025940 | Bacteria | 2942 |
| 282 | Ga0207691_10339921 | 3300025940 | Bacteria | 1285 |
| 283 | Ga0207689_10001752 | 3300025942 | Bacteria | 20489 |
| 284 | Ga0207689_10042878 | 3300025942 | Bacteria | 3741 |
| 285 | Ga0207679_10025720 | 3300025945 | Bacteria | 4052 |
| 286 | Ga0207667_10011686 | 3300025949 | Bacteria | 10187 |
| 287 | Ga0207667_10052440 | 3300025949 | Bacteria | 4296 |
| 288 | Ga0207651_10074265 | 3300025960 | Bacteria | 2421 |
| 289 | Ga0207651_10154220 | 3300025960 | Bacteria | 1792 |
| 290 | Ga0207651_10168366 | 3300025960 | Bacteria | 1725 |
| 291 | Ga0207712_10014753 | 3300025961 | Bacteria | 5031 |
| 292 | Ga0207712_10196885 | 3300025961 | Bacteria | 1595 |
| 293 | Ga0207668_10027356 | 3300025972 | Bacteria | 3713 |
| 294 | Ga0207668_10076918 | 3300025972 | Bacteria | 2404 |
| 295 | Ga0207668_10241948 | 3300025972 | Bacteria | 1460 |
| 296 | Ga0207640_10003047 | 3300025981 | Bacteria | 9024 |
| 297 | Ga0207640_10060375 | 3300025981 | Bacteria | 2506 |
| 298 | Ga0207640_10141739 | 3300025981 | Bacteria | 1753 |
| 299 | Ga0207658_10167593 | 3300025986 | Bacteria | 1806 |
| 300 | Ga0207677_10000943 | 3300026023 | Bacteria | 16236 |
| 301 | Ga0207677_10019890 | 3300026023 | Bacteria | 4064 |
| 302 | Ga0207677_10165186 | 3300026023 | Bacteria | 1724 |
| 303 | Ga0207677_10235094 | 3300026023 | Bacteria | 1479 |
| 304 | Ga0207703_10001924 | 3300026035 | Bacteria | 18395 |
| 305 | Ga0207703_10110871 | 3300026035 | Bacteria | 2341 |
| 306 | Ga0207703_10198149 | 3300026035 | Bacteria | 1783 |
| 307 | Ga0207639_10056458 | 3300026041 | Bacteria | 3010 |
| 308 | Ga0207678_10000808 | 3300026067 | Bacteria | 28722 |
| 309 | Ga0207678_10018631 | 3300026067 | Bacteria | 6094 |
| 310 | Ga0207678_10030236 | 3300026067 | Bacteria | 4728 |
| 311 | Ga0207678_10044806 | 3300026067 | Bacteria | 3825 |
| 312 | Ga0207678_10106613 | 3300026067 | Bacteria | 2390 |
| 313 | Ga0207708_10000736 | 3300026075 | Bacteria | 24605 |
| 314 | Ga0207702_10173941 | 3300026078 | Bacteria | 1977 |
| 315 | Ga0207641_10415328 | 3300026088 | Bacteria | 1294 |
| 316 | Ga0207648_10001763 | 3300026089 | Bacteria | 23706 |
| 317 | Ga0207648_10020554 | 3300026089 | Bacteria | 5944 |
| 318 | Ga0207648_10041839 | 3300026089 | Bacteria | 4024 |
| 319 | Ga0207648_10117466 | 3300026089 | Bacteria | 2337 |
| 320 | Ga0207676_10073096 | 3300026095 | Bacteria | 2758 |
| 321 | Ga0207676_10265452 | 3300026095 | Bacteria | 1552 |
| 322 | Ga0207674_10273990 | 3300026116 | Bacteria | 1635 |
| 323 | Ga0207674_10539896 | 3300026116 | Bacteria | 1126 |
| 324 | Ga0207675_100001316 | 3300026118 | Bacteria | 24900 |
| 325 | Ga0207675_100248544 | 3300026118 | Bacteria | 1721 |
| 326 | Ga0207675_100308595 | 3300026118 | Bacteria | 1542 |
| 327 | Ga0207683_10007197 | 3300026121 | Bacteria | 9538 |
| 328 | Ga0207683_10016805 | 3300026121 | Bacteria | 6228 |
| 329 | Ga0207683_10270104 | 3300026121 | Bacteria | 1553 |
| 330 | Ga0207683_10328691 | 3300026121 | Bacteria | 1401 |
| 331 | Ga0207683_10387552 | 3300026121 | Bacteria | 1285 |
| 332 | Ga0207683_10548046 | 3300026121 | Bacteria | 1069 |
| 333 | Ga0207698_10139101 | 3300026142 | Bacteria | 2088 |
| 334 | Ga0207698_10233836 | 3300026142 | Bacteria | 1670 |
| 335 | Ga0209588_1009368 | 3300027671 | Bacteria | 2926 |
| 336 | Ga0209813_10014130 | 3300027866 | Bacteria | 2145 |
| 337 | Ga0209813_10022098 | 3300027866 | Bacteria | 1795 |
| 338 | Ga0209813_10067764 | 3300027866 | Bacteria | 1154 |
| 339 | Ga0207428_10062371 | 3300027907 | Bacteria | 2948 |
| 340 | Ga0268266_10003236 | 3300028379 | Bacteria | 16447 |
| 341 | Ga0268266_10039251 | 3300028379 | Bacteria | 4032 |
| 342 | Ga0268266_10057871 | 3300028379 | Bacteria | 3336 |
| 343 | Ga0268266_10237173 | 3300028379 | Bacteria | 1682 |
| 344 | Ga0268266_10443498 | 3300028379 | Bacteria | 1233 |
| 345 | Ga0268265_10003454 | 3300028380 | Bacteria | 11361 |
| 346 | Ga0268265_10009313 | 3300028380 | Bacteria | 6637 |
| 347 | Ga0268265_10339341 | 3300028380 | Bacteria | 1367 |
| 348 | Ga0268264_10001853 | 3300028381 | Bacteria | 19220 |
| 349 | Ga0268264_10080039 | 3300028381 | Bacteria | 2789 |
| 350 | Ga0268264_10382397 | 3300028381 | Bacteria | 1348 |
| 351 | Ga0307517_10001037 | 3300028786 | Bacteria | 47162 |
| 352 | Ga0307517_10094318 | 3300028786 | Bacteria | 2418 |
| 353 | Ga0307515_10079255 | 3300028794 | Bacteria | 4305 |
| 354 | Ga0265325_10000052 | 3300031241 | Bacteria | 78471 |
| 355 | Ga0307513_10163215 | 3300031456 | Bacteria | 2116 |
| 356 | Ga0307509_10086077 | 3300031507 | Bacteria | 3232 |
| 357 | Ga0307410_10129714 | 3300031852 | Bacteria | 1851 |
| 358 | Ga0307406_10259710 | 3300031901 | Bacteria | 1313 |
| 359 | Ga0307411_10375976 | 3300032005 | Bacteria | 1167 |
| 360 | Ga0307415_100011650 | 3300032126 | Bacteria | 5044 |
| 361 | Ga0307415_100124964 | 3300032126 | Bacteria | 1937 |
| 362 | Ga0307510_10039344 | 3300033180 | Bacteria | 5211 |
| 363 | Ga0373948_0024857 | 3300034817 | Bacteria | 1171 |
| 364 | Ga0373928_0016679 | 3300035084 | Bacteria | 1505 |
| 365 | Ga0373944_0033990 | 3300035089 | Bacteria | 1547 |
| 366 | Ga0373932_0041234 | 3300035112 | Bacteria | 1333 |
| 367 | Ga0373936_0004291 | 3300035113 | Bacteria | 5386 |
| 368 | Ga0373936_0079272 | 3300035113 | Bacteria | 1365 |
| 369 | Ga0373936_0090163 | 3300035113 | Bacteria | 1285 |
| 370 | Ga0373939_0006102 | 3300035114 | Bacteria | 2896 |
| 371 | Ga0373939_0059196 | 3300035114 | Bacteria | 1214 |
| 372 | Ga0373960_0002213 | 3300035121 | Bacteria | 4374 |
| 373 | Ga0373943_0174011 | 3300035170 | Bacteria | 1179 |
| 374 | Ga0373955_0008249 | 3300035172 | Bacteria | 4830 |
| 375 | Ga0373935_0302106 | 3300035692 | Bacteria | 1131 |
| 376 | Ga0373927_0128384 | 3300035695 | Bacteria | 1656 |
| 377 | Ga0373933_0088192 | 3300035724 | Bacteria | 1911 |
| 378 | Ga0373947_0188659 | 3300035725 | Bacteria | 1344 |
| 379 | Ga0373937_0020492 | 3300036401 | Bacteria | 5927 |
| 380 | Ga0373925_0009358 | 3300037068 | Bacteria | 7133 |
| 381 | Ga0373925_0019330 | 3300037068 | Bacteria | 4954 |
| 382 | Ga0395899_0006994 | 3300037312 | Bacteria | 8736 |
| 383 | Ga0451576_0028297 | 3300045051 | Bacteria | 6006 |
| 384 | Ga0451576_0253740 | 3300045051 | Bacteria | 1838 |
| 385 | Ga0495592_0001683 | 3300046454 | Bacteria | 15504 |
| 386 | Ga0495592_0255999 | 3300046454 | Bacteria | 1155 |
| 387 | Ga0495603_0004721 | 3300046455 | Bacteria | 8138 |
| 388 | Ga0495638_0031422 | 3300046460 | Bacteria | 3413 |
| 389 | Ga0495580_0024507 | 3300046472 | Bacteria | 4415 |
| 390 | Ga0495582_0005635 | 3300046473 | Bacteria | 6970 |
| 391 | Ga0495582_0042184 | 3300046473 | Bacteria | 2514 |
| 392 | Ga0495606_0014980 | 3300046507 | Bacteria | 6012 |
| 393 | Ga0495628_0001265 | 3300046516 | Bacteria | 23148 |
| 394 | Ga0495628_0167681 | 3300046516 | Bacteria | 1666 |
| 395 | Ga0495632_0104076 | 3300046519 | Bacteria | 1336 |
| 396 | Ga0495644_0045670 | 3300046523 | Bacteria | 1647 |
| 397 | Ga0495652_0017682 | 3300046529 | Bacteria | 6362 |
| 398 | Ga0495640_0065469 | 3300046533 | Bacteria | 2454 |
| 399 | Ga0495586_0020218 | 3300046535 | Bacteria | 3546 |
| 400 | Ga0495598_0016338 | 3300046537 | Bacteria | 1892 |
| 401 | Ga0495598_0027515 | 3300046537 | Bacteria | 1569 |
| 402 | Ga0495597_0020002 | 3300046542 | Bacteria | 3124 |
| 403 | Ga0495645_0000689 | 3300046543 | Bacteria | 23257 |
| 404 | Ga0495622_0076558 | 3300046557 | Bacteria | 1541 |
| 405 | Ga0495633_0040139 | 3300046558 | Bacteria | 2231 |
| 406 | Ga0495667_0001076 | 3300046559 | Bacteria | 17673 |
| 407 | Ga0495656_0015638 | 3300046615 | Bacteria | 2868 |
| 408 | Ga0495656_0081090 | 3300046615 | Bacteria | 1464 |
| 409 | Ga0495668_0253398 | 3300046616 | Bacteria | 963 |
| 410 | Ga0495659_0049239 | 3300046664 | Bacteria | 1529 |
| 411 | Ga0495588_0035971 | 3300046674 | Bacteria | 2511 |
| 412 | Ga0495658_0002492 | 3300046683 | Bacteria | 9260 |
| 413 | Ga0495658_0020102 | 3300046683 | Bacteria | 3498 |
| 414 | Ga0495669_0003001 | 3300046684 | Bacteria | 6931 |
| 415 | Ga0495669_0039152 | 3300046684 | Bacteria | 2099 |
| 416 | Ga0495600_0039981 | 3300046809 | Bacteria | 3054 |
| 417 | Ga0495581_0086811 | 3300047315 | Bacteria | 1814 |
| 418 | Ga0495604_0045426 | 3300047317 | Bacteria | 3428 |
| 419 | Ga0495636_0022746 | 3300047318 | Bacteria | 2536 |
| 420 | Ga0495674_0116333 | 3300047319 | Bacteria | 2262 |
| 421 | Ga0495672_0076801 | 3300047320 | Bacteria | 1874 |
| 422 | Ga0495680_0009229 | 3300047322 | Bacteria | 8888 |
| 423 | Ga0495680_0126216 | 3300047322 | Bacteria | 1884 |
| 424 | Ga0495675_0013450 | 3300047444 | Bacteria | 5166 |
| 425 | Ga0495673_0083002 | 3300047469 | Bacteria | 1324 |
| 426 | Ga0495602_0044179 | 3300048088 | Bacteria | 4045 |
| 427 | Ga0496100_0065250 | 3300048903 | Bacteria | 2411 |
| 428 | Ga0496101_0210005 | 3300048904 | Bacteria | 1508 |
| 429 | Ga0496102_0002605 | 3300048905 | Bacteria | 15365 |
| 430 | Ga0496102_0028253 | 3300048905 | Bacteria | 5009 |
| 431 | Ga0496102_0089978 | 3300048905 | Bacteria | 2840 |
| 432 | Ga0496102_0605192 | 3300048905 | Bacteria | 1019 |
| 433 | Ga0496103_0036389 | 3300048906 | Bacteria | 3015 |
| 434 | Ga0496104_0000425 | 3300048907 | Bacteria | 36760 |
| 435 | Ga0496104_0039091 | 3300048907 | Bacteria | 4441 |
| 436 | Ga0496105_0000531 | 3300048908 | Bacteria | 25197 |
| 437 | Ga0496105_0017634 | 3300048908 | Bacteria | 5727 |
| 438 | Ga0496105_0040471 | 3300048908 | Bacteria | 3843 |
| 439 | Ga0496106_0005613 | 3300048909 | Bacteria | 9285 |
| 440 | Ga0496106_0177192 | 3300048909 | Bacteria | 1691 |
| 441 | Ga0496107_0212686 | 3300048910 | Bacteria | 1438 |
| 442 | Ga0496108_0072516 | 3300048911 | Bacteria | 2907 |
| 443 | Ga0496108_0103812 | 3300048911 | Bacteria | 2425 |
| 444 | Ga0496109_0023243 | 3300048912 | Bacteria | 5499 |
| 445 | Ga0496110_0006549 | 3300048913 | Bacteria | 9244 |
| 446 | Ga0496110_0130480 | 3300048913 | Bacteria | 2269 |
| 447 | Ga0496110_0164330 | 3300048913 | Bacteria | 2012 |
| 448 | Ga0496111_0069801 | 3300048914 | Bacteria | 2555 |
| 449 | Ga0496112_0000244 | 3300048915 | Bacteria | 34762 |
| 450 | Ga0496112_0113777 | 3300048915 | Bacteria | 2676 |
| 451 | Ga0496112_0140208 | 3300048915 | Bacteria | 2387 |
| 452 | Ga0496112_0174049 | 3300048915 | Bacteria | 2118 |
| 453 | Ga0496113_0009303 | 3300048916 | Bacteria | 6444 |
| 454 | Ga0496113_0251642 | 3300048916 | Bacteria | 1411 |
| 455 | Ga0496114_0043199 | 3300048917 | Bacteria | 3738 |
| 456 | Ga0496114_0464561 | 3300048917 | Bacteria | 1120 |
| 457 | Ga0496115_0012773 | 3300048918 | Bacteria | 6330 |
| 458 | Ga0496121_0000214 | 3300048924 | Bacteria | 127349 |
| 459 | Ga0496121_0114512 | 3300048924 | Bacteria | 2049 |
| 460 | Ga0496121_0124208 | 3300048924 | Bacteria | 1943 |
| 461 | Ga0496125_0000164 | 3300048928 | Bacteria | 147789 |
| 462 | Ga0496125_0003429 | 3300048928 | Bacteria | 19221 |
| 463 | Ga0496126_0004022 | 3300048929 | Bacteria | 17912 |
| 464 | Ga0496126_0019846 | 3300048929 | Bacteria | 6609 |
| 465 | Ga0496126_0061537 | 3300048929 | Bacteria | 3372 |
| 466 | Ga0496126_0119351 | 3300048929 | Bacteria | 2288 |
| 467 | Ga0496126_0153496 | 3300048929 | Bacteria | 1972 |
| 468 | Ga0495678_067049 | 3300049459 | Bacteria | 1327 |
| 469 | Ga0501036_0001769 | 3300049572 | Bacteria | 16770 |
| 470 | Ga0501036_0071937 | 3300049572 | Bacteria | 2924 |
| 471 | Ga0501036_0263092 | 3300049572 | Bacteria | 1445 |
| 472 | Ga0501038_0001150 | 3300049574 | Bacteria | 23992 |
| 473 | Ga0501038_0164773 | 3300049574 | Bacteria | 1799 |
| 474 | Ga0501039_0002050 | 3300049575 | Bacteria | 14927 |
| 475 | Ga0501039_0067008 | 3300049575 | Bacteria | 2788 |
| 476 | Ga0501040_0000302 | 3300049576 | Bacteria | 28825 |
| 477 | Ga0501041_0000813 | 3300049577 | Bacteria | 16725 |
| 478 | Ga0501041_0052884 | 3300049577 | Bacteria | 2476 |
| 479 | Ga0501041_0151722 | 3300049577 | Bacteria | 1447 |
| 480 | Ga0501041_0172794 | 3300049577 | Bacteria | 1352 |
| 481 | Ga0501042_0008176 | 3300049578 | Bacteria | 6891 |
| 482 | Ga0501043_0040321 | 3300049579 | Bacteria | 3670 |
| 483 | Ga0501043_0059467 | 3300049579 | Bacteria | 2999 |
| 484 | Ga0501046_0004835 | 3300049580 | Bacteria | 12137 |
| 485 | Ga0501046_0014710 | 3300049580 | Bacteria | 6588 |
| 486 | Ga0501047_0012016 | 3300049581 | Bacteria | 8194 |
| 487 | Ga0501048_0002096 | 3300049582 | Bacteria | 15203 |
| 488 | Ga0501068_0292002 | 3300049584 | Bacteria | 1043 |
| 489 | Ga0501070_0039003 | 3300049586 | Bacteria | 3964 |
| 490 | Ga0501071_0020545 | 3300049587 | Bacteria | 4590 |
| 491 | Ga0501071_0093838 | 3300049587 | Bacteria | 2207 |
| 492 | Ga0501071_0298745 | 3300049587 | Bacteria | 1221 |
| 493 | Ga0501072_0001721 | 3300049588 | Bacteria | 16303 |
| 494 | Ga0501072_0164526 | 3300049588 | Bacteria | 1770 |
| 495 | Ga0501074_0004817 | 3300049590 | Bacteria | 9678 |
| 496 | Ga0501074_0029088 | 3300049590 | Bacteria | 4002 |
| 497 | Ga0501075_0000045 | 3300049591 | Bacteria | 50874 |
| 498 | Ga0501075_0012647 | 3300049591 | Bacteria | 6002 |
| 499 | Ga0501075_0083898 | 3300049591 | Bacteria | 2413 |
| 500 | Ga0501076_0000394 | 3300049592 | Bacteria | 27363 |
| 501 | Ga0501076_0001408 | 3300049592 | Bacteria | 16105 |
| 502 | Ga0501076_0129014 | 3300049592 | Bacteria | 2050 |
| 503 | Ga0501076_0140669 | 3300049592 | Bacteria | 1961 |
| 504 | Ga0501076_0152314 | 3300049592 | Bacteria | 1881 |
| 505 | Ga0501077_0000629 | 3300049593 | Bacteria | 21374 |
| 506 | Ga0501079_0001910 | 3300049741 | Bacteria | 14935 |
| 507 | Ga0501079_0133715 | 3300049741 | Bacteria | 1930 |
| 508 | Ga0501080_0037353 | 3300049742 | Bacteria | 4536 |
| 509 | Ga0501080_0085967 | 3300049742 | Bacteria | 2922 |
| 510 | Ga0501081_0002316 | 3300049743 | Bacteria | 11989 |
| 511 | Ga0501081_0006209 | 3300049743 | Bacteria | 7742 |
| 512 | Ga0501081_0275064 | 3300049743 | Bacteria | 1232 |
| 513 | Ga0501083_0140230 | 3300049744 | Bacteria | 1583 |
| 514 | Ga0501035_0015747 | 3300049822 | Bacteria | 6979 |
| 515 | Ga0501035_0101824 | 3300049822 | Bacteria | 2520 |
| 516 | Ga0501044_0211729 | 3300049823 | Bacteria | 1892 |
| 517 | Ga0501045_0001370 | 3300049824 | Bacteria | 16220 |
| 518 | nmdc:mga03n38_2974_c1 | 3300050490 | Bacteria | 5358 |
| 519 | nmdc:mga03n38_55936_c1 | 3300050490 | Bacteria | 1779 |
| 520 | nmdc:mga00v17_210397_c1 | 3300050491 | Bacteria | 1258 |
| 521 | nmdc:mga0yw44_128928_c1 | 3300050492 | Bacteria | 1636 |
| 522 | nmdc:mga0yw44_52052_c1 | 3300050492 | Bacteria | 2481 |
| 523 | nmdc:mga0yw44_64140_c1 | 3300050492 | Bacteria | 2260 |
| 524 | nmdc:mga0k408_50713_c1 | 3300050493 | Bacteria | 1606 |
| 525 | nmdc:mga06z11_24041_c1 | 3300050494 | Bacteria | 1901 |
| 526 | nmdc:mga06z11_24310_c1 | 3300050494 | Bacteria | 2856 |
| 527 | nmdc:mga06z11_35675_c1 | 3300050494 | Bacteria | 2450 |
| 528 | nmdc:mga06z11_42145_c1 | 3300050494 | Bacteria | 2288 |
| 529 | nmdc:mga06z11_63801_c1 | 3300050494 | Bacteria | 1928 |
| 530 | nmdc:mga07m45_1913_c3 | 3300050496 | Bacteria | 7218 |
| 531 | nmdc:mga05p37_39963_c1 | 3300050507 | Bacteria | 5760 |
| 532 | nmdc:mga09592_163159_c1 | 3300050508 | Bacteria | 1925 |
| 533 | nmdc:mga09592_23644_c1 | 3300050508 | Bacteria | 5076 |
| 534 | nmdc:mga09592_67976_c1 | 3300050508 | Bacteria | 3022 |
| 535 | nmdc:mga0qj67_132904_c1 | 3300050509 | Bacteria | 2016 |
| 536 | nmdc:mga0qj67_8051_c1 | 3300050509 | Bacteria | 7800 |
| 537 | nmdc:mga06r32_10778_c1 | 3300050510 | Bacteria | 8235 |
| 538 | nmdc:mga08y16_10503_c1 | 3300050511 | Bacteria | 9713 |
| 539 | nmdc:mga08y16_24194_c1 | 3300050511 | Bacteria | 6410 |
| 540 | nmdc:mga08y16_421956_c1 | 3300050511 | Bacteria | 1363 |
| 541 | nmdc:mga08y16_56934_c1 | 3300050511 | Bacteria | 4086 |
| 542 | nmdc:mga0n895_113655_c1 | 3300050512 | Bacteria | 2725 |
| 543 | nmdc:mga0n895_129071_c1 | 3300050512 | Bacteria | 2552 |
| 544 | nmdc:mga0n895_5209_c1 | 3300050512 | Bacteria | 10825 |
| 545 | nmdc:mga0rr50_1387_c1 | 3300050513 | Bacteria | 13256 |
| 546 | nmdc:mga0rr50_3323_c1 | 3300050513 | Bacteria | 9234 |
| 547 | nmdc:mga0rr50_7963_c1 | 3300050513 | Bacteria | 6578 |
| 548 | nmdc:mga08x19_102629_c1 | 3300050514 | Bacteria | 1899 |
| 549 | nmdc:mga08x19_10442_c1 | 3300050514 | Bacteria | 5575 |
| 550 | nmdc:mga08x19_14933_c1 | 3300050514 | Bacteria | 4717 |
| 551 | nmdc:mga08x19_70221_c1 | 3300050514 | Bacteria | 2282 |
| 552 | nmdc:mga0a205_105394_c1 | 3300050515 | Bacteria | 2718 |
| 553 | nmdc:mga0a205_253298_c1 | 3300050515 | Bacteria | 1639 |
| 554 | nmdc:mga0a205_8535_c1 | 3300050515 | Bacteria | 9315 |
| 555 | nmdc:mga0sz30_37113_c1 | 3300050516 | Bacteria | 2039 |
| 556 | Ga0495601_0000408 | 3300053077 | Bacteria | 22524 |
| 557 | Ga0495601_0023161 | 3300053077 | Bacteria | 3815 |
| 558 | Ga0495601_0189290 | 3300053077 | Bacteria | 1345 |
| 559 | Ga0495595_0001343 | 3300053084 | Bacteria | 9555 |
| 560 | Ga0495595_0002116 | 3300053084 | Bacteria | 7710 |
| 561 | Ga0495619_0000086 | 3300053085 | Bacteria | 69774 |
| 562 | Ga0495619_0001999 | 3300053085 | Bacteria | 13573 |
| 563 | Ga0495619_0028424 | 3300053085 | Bacteria | 3607 |
| 564 | Ga0500641_0052497 | 3300053096 | Bacteria | 1680 |
| 565 | Ga0500594_0008945 | 3300053118 | Bacteria | 2295 |
| 566 | Ga0500655_013979 | 3300053133 | Bacteria | 1468 |
| 567 | Ga0500568_0024204 | 3300053139 | Bacteria | 2574 |
| 568 | Ga0500616_0009811 | 3300053153 | Bacteria | 5777 |
| 569 | Ga0500645_012185 | 3300053730 | Bacteria | 2783 |
| 570 | Ga0500645_018795 | 3300053730 | Bacteria | 2154 |
| 571 | Ga0500609_010288 | 3300053731 | Bacteria | 1260 |
| 572 | Ga0501084_0016558 | 3300054114 | Bacteria | 6121 |
| 573 | Ga0501084_0092786 | 3300054114 | Bacteria | 2535 |
| 574 | Ga0501084_0525682 | 3300054114 | Bacteria | 1000 |
| 575 | Ga0590071_016265 | 3300059421 | Bacteria | 1745 |
| 576 | Ga0590077_013729 | 3300059426 | Bacteria | 1685 |
| 577 | Ga0501082_0004607 | 3300060353 | Bacteria | 12038 |
| 578 | Ga0501082_0135795 | 3300060353 | Bacteria | 2134 |
| 579 | Ga0530510_0000797 | 3300061734 | Bacteria | 20554 |
| 580 | Ga0530510_0003533 | 3300061734 | Bacteria | 10763 |
| 581 | Ga0530510_0173758 | 3300061734 | Bacteria | 1596 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025899 | Ga0207642_10202354 | Ga0207642_102023542 | 269 |
| 2 | 3300005983 | Ga0081540_1023015 | Ga0081540_10230155 | 274 |
| 3 | 3300035112 | Ga0373932_0041234 | Ga0373932_0041234_469_1323 | 283 |
| 4 | 3300035695 | Ga0373927_0128384 | Ga0373927_0128384_306_1250 | 293 |
| 5 | 3300046616 | Ga0495668_0253398 | Ga0495668_0253398_46_927 | 293 |
| 6 | 3300047315 | Ga0495581_0086811 | Ga0495581_0086811_16_897 | 293 |
| 7 | 3300005937 | Ga0081455_10002253 | Ga0081455_100022539 | 296 |
| 8 | 3300005985 | Ga0081539_10044462 | Ga0081539_100444622 | 301 |
| 9 | 3300005841 | Ga0068863_100285773 | Ga0068863_1002857732 | 302 |
| 10 | 3300006178 | Ga0075367_10043882 | Ga0075367_100438823 | 302 |
| 11 | 3300049741 | Ga0501079_0133715 | Ga0501079_0133715_354_1325 | 302 |
| 12 | 3300050494 | nmdc:mga06z11_24310_c1 | nmdc:mga06z11_24310_c1_1189_2151 | 302 |
| 13 | 3300026023 | Ga0207677_10235094 | Ga0207677_102350941 | 303 |
| 14 | 3300035114 | Ga0373939_0059196 | Ga0373939_0059196_113_1072 | 303 |
| 15 | 3300005331 | Ga0070670_100219266 | Ga0070670_1002192662 | 304 |
| 16 | 3300005355 | Ga0070671_100068520 | Ga0070671_1000685202 | 304 |
| 17 | 3300005366 | Ga0070659_100054404 | Ga0070659_1000544042 | 304 |
| 18 | 3300005441 | Ga0070700_100154789 | Ga0070700_1001547892 | 304 |
| 19 | 3300005455 | Ga0070663_100092183 | Ga0070663_1000921832 | 304 |
| 20 | 3300005456 | Ga0070678_100059797 | Ga0070678_1000597973 | 304 |
| 21 | 3300005456 | Ga0070678_100073433 | Ga0070678_1000734332 | 304 |
| 22 | 3300005547 | Ga0070693_100054909 | Ga0070693_1000549092 | 304 |
| 23 | 3300005548 | Ga0070665_100110277 | Ga0070665_1001102772 | 304 |
| 24 | 3300005563 | Ga0068855_100030518 | Ga0068855_1000305184 | 304 |
| 25 | 3300005577 | Ga0068857_100110296 | Ga0068857_1001102962 | 304 |
| 26 | 3300005614 | Ga0068856_100070791 | Ga0068856_1000707912 | 304 |
| 27 | 3300005615 | Ga0070702_100107646 | Ga0070702_1001076462 | 304 |
| 28 | 3300005617 | Ga0068859_100091398 | Ga0068859_1000913982 | 304 |
| 29 | 3300005618 | Ga0068864_100125032 | Ga0068864_1001250322 | 304 |
| 30 | 3300005718 | Ga0068866_10022999 | Ga0068866_100229993 | 304 |
| 31 | 3300005719 | Ga0068861_100132611 | Ga0068861_1001326112 | 304 |
| 32 | 3300005842 | Ga0068858_100102517 | Ga0068858_1001025172 | 304 |
| 33 | 3300005843 | Ga0068860_100091350 | Ga0068860_1000913502 | 304 |
| 34 | 3300005844 | Ga0068862_100115607 | Ga0068862_1001156072 | 304 |
| 35 | 3300006051 | Ga0075364_10010611 | Ga0075364_100106115 | 304 |
| 36 | 3300006178 | Ga0075367_10028585 | Ga0075367_100285852 | 304 |
| 37 | 3300006358 | Ga0068871_100035845 | Ga0068871_1000358452 | 304 |
| 38 | 3300006931 | Ga0097620_100091400 | Ga0097620_1000914002 | 304 |
| 39 | 3300025321 | Ga0207656_10069167 | Ga0207656_100691672 | 304 |
| 40 | 3300025893 | Ga0207682_10046202 | Ga0207682_100462022 | 304 |
| 41 | 3300025914 | Ga0207671_10076432 | Ga0207671_100764322 | 304 |
| 42 | 3300025925 | Ga0207650_10320957 | Ga0207650_103209572 | 304 |
| 43 | 3300025931 | Ga0207644_10158453 | Ga0207644_101584532 | 304 |
| 44 | 3300025932 | Ga0207690_10092970 | Ga0207690_100929701 | 304 |
| 45 | 3300025949 | Ga0207667_10052440 | Ga0207667_100524402 | 304 |
| 46 | 3300025972 | Ga0207668_10027356 | Ga0207668_100273562 | 304 |
| 47 | 3300025981 | Ga0207640_10141739 | Ga0207640_101417391 | 304 |
| 48 | 3300025986 | Ga0207658_10167593 | Ga0207658_101675932 | 304 |
| 49 | 3300026035 | Ga0207703_10110871 | Ga0207703_101108712 | 304 |
| 50 | 3300026041 | Ga0207639_10056458 | Ga0207639_100564582 | 304 |
| 51 | 3300026067 | Ga0207678_10106613 | Ga0207678_101066132 | 304 |
| 52 | 3300026089 | Ga0207648_10117466 | Ga0207648_101174662 | 304 |
| 53 | 3300026118 | Ga0207675_100248544 | Ga0207675_1002485442 | 304 |
| 54 | 3300026121 | Ga0207683_10328691 | Ga0207683_103286911 | 304 |
| 55 | 3300027866 | Ga0209813_10022098 | Ga0209813_100220982 | 304 |
| 56 | 3300028379 | Ga0268266_10057871 | Ga0268266_100578712 | 304 |
| 57 | 3300034817 | Ga0373948_0024857 | Ga0373948_0024857_131_1078 | 304 |
| 58 | 3300035084 | Ga0373928_0016679 | Ga0373928_0016679_385_1332 | 304 |
| 59 | 3300035114 | Ga0373939_0006102 | Ga0373939_0006102_1303_2250 | 304 |
| 60 | 3300035121 | Ga0373960_0002213 | Ga0373960_0002213_1987_2934 | 304 |
| 61 | 3300005329 | Ga0070683_100295551 | Ga0070683_1002955511 | 305 |
| 62 | 3300005466 | Ga0070685_10186065 | Ga0070685_101860652 | 305 |
| 63 | 3300053077 | Ga0495601_0189290 | Ga0495601_0189290_162_1133 | 305 |
| 64 | 3300006881 | Ga0068865_100184990 | Ga0068865_1001849901 | 306 |
| 65 | 3300048911 | Ga0496108_0072516 | Ga0496108_0072516_1250_2170 | 306 |
| 66 | 3300048915 | Ga0496112_0174049 | Ga0496112_0174049_610_1530 | 306 |
| 67 | 3300049577 | Ga0501041_0151722 | Ga0501041_0151722_10_975 | 306 |
| 68 | 3300049591 | Ga0501075_0083898 | Ga0501075_0083898_408_1373 | 306 |
| 69 | 3300049592 | Ga0501076_0152314 | Ga0501076_0152314_494_1459 | 306 |
| 70 | 3300060353 | Ga0501082_0135795 | Ga0501082_0135795_773_1738 | 306 |
| 71 | 3300005617 | Ga0068859_100504564 | Ga0068859_1005045642 | 307 |
| 72 | 3300006931 | Ga0097620_100504571 | Ga0097620_1005045712 | 307 |
| 73 | 3300035170 | Ga0373943_0174011 | Ga0373943_0174011_168_1094 | 307 |
| 74 | 3300035692 | Ga0373935_0302106 | Ga0373935_0302106_120_1046 | 307 |
| 75 | 3300035725 | Ga0373947_0188659 | Ga0373947_0188659_333_1259 | 307 |
| 76 | 3300005355 | Ga0070671_100093563 | Ga0070671_1000935632 | 308 |
| 77 | 3300025931 | Ga0207644_10456387 | Ga0207644_104563871 | 308 |
| 78 | 3300053153 | Ga0500616_0009811 | Ga0500616_0009811_895_1833 | 308 |
| 79 | 3300061734 | Ga0530510_0173758 | Ga0530510_0173758_203_1168 | 309 |
| 80 | 3300005347 | Ga0070668_100017930 | Ga0070668_1000179307 | 310 |
| 81 | 3300014326 | Ga0157380_10446498 | Ga0157380_104464982 | 310 |
| 82 | 3300025940 | Ga0207691_10013055 | Ga0207691_100130558 | 310 |
| 83 | 3300046542 | Ga0495597_0020002 | Ga0495597_0020002_1880_2812 | 310 |
| 84 | 3300046557 | Ga0495622_0076558 | Ga0495622_0076558_595_1527 | 310 |
| 85 | 3300046684 | Ga0495669_0003001 | Ga0495669_0003001_3430_4362 | 310 |
| 86 | 3300005336 | Ga0070680_100089741 | Ga0070680_1000897412 | 311 |
| 87 | 3300005546 | Ga0070696_100082352 | Ga0070696_1000823522 | 311 |
| 88 | 3300005549 | Ga0070704_100019690 | Ga0070704_1000196902 | 311 |
| 89 | 3300005615 | Ga0070702_100021506 | Ga0070702_1000215064 | 311 |
| 90 | 3300006844 | Ga0075428_100065717 | Ga0075428_1000657176 | 311 |
| 91 | 3300006846 | Ga0075430_100047470 | Ga0075430_1000474702 | 311 |
| 92 | 3300006852 | Ga0075433_10053925 | Ga0075433_100539252 | 311 |
| 93 | 3300006871 | Ga0075434_100000358 | Ga0075434_10000035815 | 311 |
| 94 | 3300007076 | Ga0075435_100000614 | Ga0075435_1000006149 | 311 |
| 95 | 3300025917 | Ga0207660_10111596 | Ga0207660_101115962 | 311 |
| 96 | 3300027907 | Ga0207428_10062371 | Ga0207428_100623712 | 311 |
| 97 | 3300048928 | Ga0496125_0000164 | Ga0496125_0000164_6639_7616 | 311 |
| 98 | 3300048928 | Ga0496125_0003429 | Ga0496125_0003429_2802_3779 | 311 |
| 99 | 3300048929 | Ga0496126_0119351 | Ga0496126_0119351_863_1840 | 311 |
| 100 | 3300049575 | Ga0501039_0067008 | Ga0501039_0067008_215_1162 | 311 |
| 101 | 3300049577 | Ga0501041_0052884 | Ga0501041_0052884_55_1002 | 311 |
| 102 | 3300049587 | Ga0501071_0298745 | Ga0501071_0298745_11_958 | 311 |
| 103 | 3300049591 | Ga0501075_0012647 | Ga0501075_0012647_576_1523 | 311 |
| 104 | 3300049592 | Ga0501076_0001408 | Ga0501076_0001408_12578_13525 | 311 |
| 105 | 3300049742 | Ga0501080_0085967 | Ga0501080_0085967_349_1299 | 311 |
| 106 | 3300049743 | Ga0501081_0002316 | Ga0501081_0002316_5806_6753 | 311 |
| 107 | 3300050508 | nmdc:mga09592_23644_c1 | nmdc:mga09592_23644_c1_1335_2285 | 311 |
| 108 | 3300050509 | nmdc:mga0qj67_132904_c1 | nmdc:mga0qj67_132904_c1_382_1335 | 311 |
| 109 | 3300050509 | nmdc:mga0qj67_8051_c1 | nmdc:mga0qj67_8051_c1_5084_6031 | 311 |
| 110 | 3300050511 | nmdc:mga08y16_56934_c1 | nmdc:mga08y16_56934_c1_407_1357 | 311 |
| 111 | 3300050512 | nmdc:mga0n895_5209_c1 | nmdc:mga0n895_5209_c1_8785_9732 | 311 |
| 112 | 3300050513 | nmdc:mga0rr50_1387_c1 | nmdc:mga0rr50_1387_c1_10972_11919 | 311 |
| 113 | 3300050513 | nmdc:mga0rr50_3323_c1 | nmdc:mga0rr50_3323_c1_1611_2558 | 311 |
| 114 | 3300050514 | nmdc:mga08x19_14933_c1 | nmdc:mga08x19_14933_c1_680_1627 | 311 |
| 115 | 3300050515 | nmdc:mga0a205_105394_c1 | nmdc:mga0a205_105394_c1_769_1716 | 311 |
| 116 | 3300061734 | Ga0530510_0003533 | Ga0530510_0003533_4779_5726 | 311 |
| 117 | 3300005333 | Ga0070677_10075644 | Ga0070677_100756442 | 312 |
| 118 | 3300005335 | Ga0070666_10255695 | Ga0070666_102556952 | 312 |
| 119 | 3300005434 | Ga0070709_10010157 | Ga0070709_100101572 | 312 |
| 120 | 3300005435 | Ga0070714_100002637 | Ga0070714_1000026378 | 312 |
| 121 | 3300005436 | Ga0070713_100006368 | Ga0070713_1000063682 | 312 |
| 122 | 3300005439 | Ga0070711_100010693 | Ga0070711_1000106931 | 312 |
| 123 | 3300005548 | Ga0070665_100109032 | Ga0070665_1001090323 | 312 |
| 124 | 3300006028 | Ga0070717_10009751 | Ga0070717_100097514 | 312 |
| 125 | 3300009545 | Ga0105237_10044251 | Ga0105237_100442513 | 312 |
| 126 | 3300025898 | Ga0207692_10004880 | Ga0207692_100048801 | 312 |
| 127 | 3300025906 | Ga0207699_10040723 | Ga0207699_100407232 | 312 |
| 128 | 3300025915 | Ga0207693_10013978 | Ga0207693_100139785 | 312 |
| 129 | 3300025916 | Ga0207663_10001469 | Ga0207663_100014694 | 312 |
| 130 | 3300025929 | Ga0207664_10020236 | Ga0207664_100202362 | 312 |
| 131 | 3300048909 | Ga0496106_0177192 | Ga0496106_0177192_663_1601 | 312 |
| 132 | 3300048910 | Ga0496107_0212686 | Ga0496107_0212686_333_1310 | 312 |
| 133 | 3300048913 | Ga0496110_0164330 | Ga0496110_0164330_690_1628 | 312 |
| 134 | 3300048915 | Ga0496112_0140208 | Ga0496112_0140208_741_1679 | 312 |
| 135 | 3300048924 | Ga0496121_0114512 | Ga0496121_0114512_37_975 | 312 |
| 136 | 3300048924 | Ga0496121_0124208 | Ga0496121_0124208_21_959 | 312 |
| 137 | 3300050493 | nmdc:mga0k408_50713_c1 | nmdc:mga0k408_50713_c1_197_1135 | 312 |
| 138 | 3300050494 | nmdc:mga06z11_24041_c1 | nmdc:mga06z11_24041_c1_416_1354 | 312 |
| 139 | 3300050512 | nmdc:mga0n895_113655_c1 | nmdc:mga0n895_113655_c1_959_1897 | 312 |
| 140 | 3300005330 | Ga0070690_100000791 | Ga0070690_1000007918 | 313 |
| 141 | 3300005334 | Ga0068869_100001018 | Ga0068869_10000101814 | 313 |
| 142 | 3300005336 | Ga0070680_100070820 | Ga0070680_1000708202 | 313 |
| 143 | 3300005337 | Ga0070682_100047685 | Ga0070682_1000476853 | 313 |
| 144 | 3300005338 | Ga0068868_100001147 | Ga0068868_10000114712 | 313 |
| 145 | 3300005340 | Ga0070689_100005181 | Ga0070689_1000051813 | 313 |
| 146 | 3300005341 | Ga0070691_10000180 | Ga0070691_1000018010 | 313 |
| 147 | 3300005343 | Ga0070687_100000304 | Ga0070687_10000030413 | 313 |
| 148 | 3300005354 | Ga0070675_100189574 | Ga0070675_1001895741 | 313 |
| 149 | 3300005355 | Ga0070671_100328867 | Ga0070671_1003288672 | 313 |
| 150 | 3300005364 | Ga0070673_100193567 | Ga0070673_1001935672 | 313 |
| 151 | 3300005365 | Ga0070688_100040776 | Ga0070688_1000407762 | 313 |
| 152 | 3300005438 | Ga0070701_10000171 | Ga0070701_100001717 | 313 |
| 153 | 3300005440 | Ga0070705_100001907 | Ga0070705_1000019078 | 313 |
| 154 | 3300005441 | Ga0070700_100000396 | Ga0070700_10000039611 | 313 |
| 155 | 3300005444 | Ga0070694_100000367 | Ga0070694_10000036714 | 313 |
| 156 | 3300005459 | Ga0068867_100002868 | Ga0068867_10000286814 | 313 |
| 157 | 3300005530 | Ga0070679_100035218 | Ga0070679_1000352182 | 313 |
| 158 | 3300005539 | Ga0068853_100487288 | Ga0068853_1004872881 | 313 |
| 159 | 3300005543 | Ga0070672_100360364 | Ga0070672_1003603642 | 313 |
| 160 | 3300005544 | Ga0070686_100000664 | Ga0070686_10000066414 | 313 |
| 161 | 3300005545 | Ga0070695_100000111 | Ga0070695_10000011117 | 313 |
| 162 | 3300005546 | Ga0070696_100000082 | Ga0070696_10000008240 | 313 |
| 163 | 3300005547 | Ga0070693_100000114 | Ga0070693_10000011429 | 313 |
| 164 | 3300005549 | Ga0070704_100000018 | Ga0070704_10000001844 | 313 |
| 165 | 3300005563 | Ga0068855_100008462 | Ga0068855_10000846211 | 313 |
| 166 | 3300005578 | Ga0068854_100014836 | Ga0068854_1000148363 | 313 |
| 167 | 3300005614 | Ga0068856_100015015 | Ga0068856_1000150152 | 313 |
| 168 | 3300005615 | Ga0070702_100000345 | Ga0070702_10000034512 | 313 |
| 169 | 3300005617 | Ga0068859_100001261 | Ga0068859_10000126114 | 313 |
| 170 | 3300005719 | Ga0068861_100001057 | Ga0068861_1000010578 | 313 |
| 171 | 3300005840 | Ga0068870_10102035 | Ga0068870_101020352 | 313 |
| 172 | 3300005842 | Ga0068858_100003300 | Ga0068858_1000033008 | 313 |
| 173 | 3300005843 | Ga0068860_100002554 | Ga0068860_10000255412 | 313 |
| 174 | 3300005844 | Ga0068862_100002561 | Ga0068862_10000256112 | 313 |
| 175 | 3300005983 | Ga0081540_1001425 | Ga0081540_10014257 | 313 |
| 176 | 3300006237 | Ga0097621_100001358 | Ga0097621_10000135810 | 313 |
| 177 | 3300006847 | Ga0075431_100259473 | Ga0075431_1002594732 | 313 |
| 178 | 3300006852 | Ga0075433_10001083 | Ga0075433_100010838 | 313 |
| 179 | 3300006871 | Ga0075434_100002085 | Ga0075434_10000208517 | 313 |
| 180 | 3300006871 | Ga0075434_100094427 | Ga0075434_1000944274 | 313 |
| 181 | 3300006881 | Ga0068865_100000555 | Ga0068865_10000055514 | 313 |
| 182 | 3300006914 | Ga0075436_100001595 | Ga0075436_1000015956 | 313 |
| 183 | 3300006931 | Ga0097620_100001261 | Ga0097620_10000126114 | 313 |
| 184 | 3300007076 | Ga0075435_100000518 | Ga0075435_10000051811 | 313 |
| 185 | 3300009094 | Ga0111539_10014436 | Ga0111539_100144365 | 313 |
| 186 | 3300009094 | Ga0111539_10292922 | Ga0111539_102929222 | 313 |
| 187 | 3300009098 | Ga0105245_10006058 | Ga0105245_1000605812 | 313 |
| 188 | 3300009148 | Ga0105243_10002682 | Ga0105243_100026825 | 313 |
| 189 | 3300009174 | Ga0105241_10004461 | Ga0105241_100044616 | 313 |
| 190 | 3300009176 | Ga0105242_10000987 | Ga0105242_1000098712 | 313 |
| 191 | 3300011119 | Ga0105246_10147410 | Ga0105246_101474102 | 313 |
| 192 | 3300013297 | Ga0157378_10001843 | Ga0157378_1000184312 | 313 |
| 193 | 3300014969 | Ga0157376_10006926 | Ga0157376_100069263 | 313 |
| 194 | 3300025903 | Ga0207680_10126738 | Ga0207680_101267382 | 313 |
| 195 | 3300025908 | Ga0207643_10086869 | Ga0207643_100868692 | 313 |
| 196 | 3300025917 | Ga0207660_10042880 | Ga0207660_100428803 | 313 |
| 197 | 3300025918 | Ga0207662_10000269 | Ga0207662_1000026912 | 313 |
| 198 | 3300025921 | Ga0207652_10024979 | Ga0207652_100249796 | 313 |
| 199 | 3300025926 | Ga0207659_10147265 | Ga0207659_101472652 | 313 |
| 200 | 3300025927 | Ga0207687_10003693 | Ga0207687_1000369312 | 313 |
| 201 | 3300025934 | Ga0207686_10003451 | Ga0207686_1000345112 | 313 |
| 202 | 3300025935 | Ga0207709_10000759 | Ga0207709_100007597 | 313 |
| 203 | 3300025936 | Ga0207670_10010027 | Ga0207670_100100272 | 313 |
| 204 | 3300025938 | Ga0207704_10000698 | Ga0207704_1000069812 | 313 |
| 205 | 3300025940 | Ga0207691_10339921 | Ga0207691_103399212 | 313 |
| 206 | 3300025942 | Ga0207689_10001752 | Ga0207689_1000175214 | 313 |
| 207 | 3300025949 | Ga0207667_10011686 | Ga0207667_1001168611 | 313 |
| 208 | 3300025960 | Ga0207651_10154220 | Ga0207651_101542202 | 313 |
| 209 | 3300025981 | Ga0207640_10003047 | Ga0207640_100030474 | 313 |
| 210 | 3300026023 | Ga0207677_10000943 | Ga0207677_100009437 | 313 |
| 211 | 3300026035 | Ga0207703_10001924 | Ga0207703_1000192412 | 313 |
| 212 | 3300026075 | Ga0207708_10000736 | Ga0207708_1000073614 | 313 |
| 213 | 3300026078 | Ga0207702_10173941 | Ga0207702_101739412 | 313 |
| 214 | 3300026088 | Ga0207641_10415328 | Ga0207641_104153281 | 313 |
| 215 | 3300026089 | Ga0207648_10001763 | Ga0207648_1000176317 | 313 |
| 216 | 3300026118 | Ga0207675_100001316 | Ga0207675_10000131617 | 313 |
| 217 | 3300028380 | Ga0268265_10003454 | Ga0268265_100034542 | 313 |
| 218 | 3300028381 | Ga0268264_10001853 | Ga0268264_1000185312 | 313 |
| 219 | 3300031852 | Ga0307410_10129714 | Ga0307410_101297141 | 313 |
| 220 | 3300035089 | Ga0373944_0033990 | Ga0373944_0033990_454_1407 | 313 |
| 221 | 3300035113 | Ga0373936_0004291 | Ga0373936_0004291_1767_2720 | 313 |
| 222 | 3300037068 | Ga0373925_0009358 | Ga0373925_0009358_4157_5110 | 313 |
| 223 | 3300045051 | Ga0451576_0028297 | Ga0451576_0028297_3060_4013 | 313 |
| 224 | 3300046455 | Ga0495603_0004721 | Ga0495603_0004721_2413_3366 | 313 |
| 225 | 3300046472 | Ga0495580_0024507 | Ga0495580_0024507_1754_2707 | 313 |
| 226 | 3300046473 | Ga0495582_0005635 | Ga0495582_0005635_2388_3341 | 313 |
| 227 | 3300046535 | Ga0495586_0020218 | Ga0495586_0020218_2262_3215 | 313 |
| 228 | 3300046537 | Ga0495598_0016338 | Ga0495598_0016338_18_977 | 313 |
| 229 | 3300046615 | Ga0495656_0081090 | Ga0495656_0081090_91_1050 | 313 |
| 230 | 3300046674 | Ga0495588_0035971 | Ga0495588_0035971_520_1473 | 313 |
| 231 | 3300046683 | Ga0495658_0002492 | Ga0495658_0002492_4346_5299 | 313 |
| 232 | 3300048905 | Ga0496102_0089978 | Ga0496102_0089978_437_1378 | 313 |
| 233 | 3300048913 | Ga0496110_0130480 | Ga0496110_0130480_190_1131 | 313 |
| 234 | 3300048917 | Ga0496114_0043199 | Ga0496114_0043199_585_1526 | 313 |
| 235 | 3300048917 | Ga0496114_0464561 | Ga0496114_0464561_32_991 | 313 |
| 236 | 3300049572 | Ga0501036_0001769 | Ga0501036_0001769_2072_3025 | 313 |
| 237 | 3300049574 | Ga0501038_0001150 | Ga0501038_0001150_14860_15813 | 313 |
| 238 | 3300049575 | Ga0501039_0002050 | Ga0501039_0002050_2961_3914 | 313 |
| 239 | 3300049576 | Ga0501040_0000302 | Ga0501040_0000302_14044_14997 | 313 |
| 240 | 3300049577 | Ga0501041_0000813 | Ga0501041_0000813_3265_4218 | 313 |
| 241 | 3300049577 | Ga0501041_0172794 | Ga0501041_0172794_338_1291 | 313 |
| 242 | 3300049578 | Ga0501042_0008176 | Ga0501042_0008176_5251_6204 | 313 |
| 243 | 3300049579 | Ga0501043_0040321 | Ga0501043_0040321_1531_2484 | 313 |
| 244 | 3300049580 | Ga0501046_0004835 | Ga0501046_0004835_8180_9133 | 313 |
| 245 | 3300049582 | Ga0501048_0002096 | Ga0501048_0002096_1024_1977 | 313 |
| 246 | 3300049587 | Ga0501071_0020545 | Ga0501071_0020545_1917_2870 | 313 |
| 247 | 3300049588 | Ga0501072_0001721 | Ga0501072_0001721_2740_3693 | 313 |
| 248 | 3300049588 | Ga0501072_0164526 | Ga0501072_0164526_253_1206 | 313 |
| 249 | 3300049590 | Ga0501074_0004817 | Ga0501074_0004817_2862_3815 | 313 |
| 250 | 3300049591 | Ga0501075_0000045 | Ga0501075_0000045_41402_42355 | 313 |
| 251 | 3300049592 | Ga0501076_0000394 | Ga0501076_0000394_11774_12727 | 313 |
| 252 | 3300049593 | Ga0501077_0000629 | Ga0501077_0000629_19056_20009 | 313 |
| 253 | 3300049741 | Ga0501079_0001910 | Ga0501079_0001910_3038_3991 | 313 |
| 254 | 3300049742 | Ga0501080_0037353 | Ga0501080_0037353_1857_2810 | 313 |
| 255 | 3300049743 | Ga0501081_0006209 | Ga0501081_0006209_3751_4704 | 313 |
| 256 | 3300049744 | Ga0501083_0140230 | Ga0501083_0140230_305_1258 | 313 |
| 257 | 3300049822 | Ga0501035_0015747 | Ga0501035_0015747_1538_2491 | 313 |
| 258 | 3300049824 | Ga0501045_0001370 | Ga0501045_0001370_8062_9015 | 313 |
| 259 | 3300050511 | nmdc:mga08y16_24194_c1 | nmdc:mga08y16_24194_c1_5128_6081 | 313 |
| 260 | 3300050511 | nmdc:mga08y16_421956_c1 | nmdc:mga08y16_421956_c1_251_1204 | 313 |
| 261 | 3300050512 | nmdc:mga0n895_129071_c1 | nmdc:mga0n895_129071_c1_568_1509 | 313 |
| 262 | 3300050513 | nmdc:mga0rr50_7963_c1 | nmdc:mga0rr50_7963_c1_1394_2347 | 313 |
| 263 | 3300050514 | nmdc:mga08x19_10442_c1 | nmdc:mga08x19_10442_c1_1863_2816 | 313 |
| 264 | 3300050515 | nmdc:mga0a205_8535_c1 | nmdc:mga0a205_8535_c1_4474_5427 | 313 |
| 265 | 3300054114 | Ga0501084_0016558 | Ga0501084_0016558_941_1894 | 313 |
| 266 | 3300054114 | Ga0501084_0092786 | Ga0501084_0092786_927_1880 | 313 |
| 267 | 3300054114 | Ga0501084_0525682 | Ga0501084_0525682_32_985 | 313 |
| 268 | 3300059421 | Ga0590071_016265 | Ga0590071_016265_666_1619 | 313 |
| 269 | 3300059426 | Ga0590077_013729 | Ga0590077_013729_331_1284 | 313 |
| 270 | 3300060353 | Ga0501082_0004607 | Ga0501082_0004607_5281_6234 | 313 |
| 271 | 3300061734 | Ga0530510_0000797 | Ga0530510_0000797_4689_5642 | 313 |
| 272 | 3300005331 | Ga0070670_100025554 | Ga0070670_1000255542 | 314 |
| 273 | 3300005341 | Ga0070691_10162977 | Ga0070691_101629771 | 314 |
| 274 | 3300005366 | Ga0070659_100104435 | Ga0070659_1001044352 | 314 |
| 275 | 3300005458 | Ga0070681_10145128 | Ga0070681_101451282 | 314 |
| 276 | 3300005539 | Ga0068853_100208784 | Ga0068853_1002087841 | 314 |
| 277 | 3300005539 | Ga0068853_100211361 | Ga0068853_1002113612 | 314 |
| 278 | 3300005543 | Ga0070672_100029603 | Ga0070672_1000296032 | 314 |
| 279 | 3300005577 | Ga0068857_100065746 | Ga0068857_1000657462 | 314 |
| 280 | 3300005578 | Ga0068854_100068691 | Ga0068854_1000686912 | 314 |
| 281 | 3300005616 | Ga0068852_100164377 | Ga0068852_1001643772 | 314 |
| 282 | 3300005617 | Ga0068859_100045230 | Ga0068859_1000452303 | 314 |
| 283 | 3300005617 | Ga0068859_100390420 | Ga0068859_1003904202 | 314 |
| 284 | 3300005618 | Ga0068864_100099012 | Ga0068864_1000990122 | 314 |
| 285 | 3300005834 | Ga0068851_10025656 | Ga0068851_100256563 | 314 |
| 286 | 3300005842 | Ga0068858_100105936 | Ga0068858_1001059362 | 314 |
| 287 | 3300006931 | Ga0097620_100045232 | Ga0097620_1000452323 | 314 |
| 288 | 3300006931 | Ga0097620_100390398 | Ga0097620_1003903982 | 314 |
| 289 | 3300009094 | Ga0111539_10023073 | Ga0111539_1002307310 | 314 |
| 290 | 3300009094 | Ga0111539_10067195 | Ga0111539_100671956 | 314 |
| 291 | 3300013307 | Ga0157372_10166417 | Ga0157372_101664172 | 314 |
| 292 | 3300014326 | Ga0157380_10031003 | Ga0157380_100310033 | 314 |
| 293 | 3300025321 | Ga0207656_10039581 | Ga0207656_100395812 | 314 |
| 294 | 3300025918 | Ga0207662_10106992 | Ga0207662_101069922 | 314 |
| 295 | 3300025920 | Ga0207649_10014762 | Ga0207649_100147623 | 314 |
| 296 | 3300025925 | Ga0207650_10251659 | Ga0207650_102516592 | 314 |
| 297 | 3300025932 | Ga0207690_10330082 | Ga0207690_103300821 | 314 |
| 298 | 3300025940 | Ga0207691_10079903 | Ga0207691_100799033 | 314 |
| 299 | 3300025981 | Ga0207640_10060375 | Ga0207640_100603752 | 314 |
| 300 | 3300026116 | Ga0207674_10273990 | Ga0207674_102739902 | 314 |
| 301 | 3300026121 | Ga0207683_10387552 | Ga0207683_103875521 | 314 |
| 302 | 3300026142 | Ga0207698_10233836 | Ga0207698_102338361 | 314 |
| 303 | 3300028379 | Ga0268266_10237173 | Ga0268266_102371731 | 314 |
| 304 | 3300028380 | Ga0268265_10339341 | Ga0268265_103393411 | 314 |
| 305 | 3300037312 | Ga0395899_0006994 | Ga0395899_0006994_2760_3716 | 314 |
| 306 | 3300045051 | Ga0451576_0253740 | Ga0451576_0253740_376_1335 | 314 |
| 307 | 3300047318 | Ga0495636_0022746 | Ga0495636_0022746_61_1017 | 314 |
| 308 | 3300050511 | nmdc:mga08y16_10503_c1 | nmdc:mga08y16_10503_c1_3665_4621 | 314 |
| 309 | 3300005518 | Ga0070699_100074011 | Ga0070699_1000740111 | 315 |
| 310 | 3300005536 | Ga0070697_100036963 | Ga0070697_1000369632 | 315 |
| 311 | 3300005545 | Ga0070695_100000897 | Ga0070695_10000089717 | 315 |
| 312 | 3300005546 | Ga0070696_100007382 | Ga0070696_1000073826 | 315 |
| 313 | 3300006914 | Ga0075436_100035412 | Ga0075436_1000354122 | 315 |
| 314 | 3300025893 | Ga0207682_10000069 | Ga0207682_1000006937 | 315 |
| 315 | 3300050514 | nmdc:mga08x19_70221_c1 | nmdc:mga08x19_70221_c1_183_1145 | 315 |
| 316 | iso_pu_bacteria | 2513237101 | 2513694511 | 315 |
| 317 | iso_pu_bacteria | 2721755755 | 2723848960 | 315 |
| 318 | iso_pu_bacteria | 2791355199 | 2793079057 | 315 |
| 319 | iso_pu_bacteria | 2874604998 | 2874607092 | 315 |
| 320 | iso_pu_bacteria | 2889033259 | 2889034763 | 315 |
| 321 | iso_pu_bacteria | 2922361189 | 2922364766 | 315 |
| 322 | iso_pu_bacteria | 2922386360 | 2922391777 | 315 |
| 323 | iso_pu_bacteria | 8006964411 | 8006965099 | 315 |
| 324 | iso_pu_bacteria | 8006984368 | 8006993200 | 315 |
| 325 | iso_pu_bacteria | 8006994254 | 8006995347 | 315 |
| 326 | iso_pu_bacteria | 8056673599 | 8056679145 | 315 |
| 327 | 3300005578 | Ga0068854_100081524 | Ga0068854_1000815242 | 316 |
| 328 | 3300005843 | Ga0068860_100215423 | Ga0068860_1002154232 | 316 |
| 329 | 3300006844 | Ga0075428_100143090 | Ga0075428_1001430902 | 316 |
| 330 | 3300013308 | Ga0157375_10181580 | Ga0157375_101815803 | 316 |
| 331 | 3300025938 | Ga0207704_10060081 | Ga0207704_100600812 | 316 |
| 332 | 3300026089 | Ga0207648_10041839 | Ga0207648_100418394 | 316 |
| 333 | 3300026121 | Ga0207683_10007197 | Ga0207683_1000719712 | 316 |
| 334 | 3300027671 | Ga0209588_1009368 | Ga0209588_10093683 | 316 |
| 335 | 3300005985 | Ga0081539_10011100 | Ga0081539_100111004 | 317 |
| 336 | iso_pu_bacteria | 2876808645 | 2876815747 | 317 |
| 337 | iso_pu_bacteria | 2879110137 | 2879117063 | 317 |
| 338 | 3300005330 | Ga0070690_100055664 | Ga0070690_1000556642 | 318 |
| 339 | 3300005338 | Ga0068868_100033478 | Ga0068868_1000334781 | 318 |
| 340 | 3300005364 | Ga0070673_100321477 | Ga0070673_1003214772 | 318 |
| 341 | 3300005367 | Ga0070667_100081864 | Ga0070667_1000818642 | 318 |
| 342 | 3300005471 | Ga0070698_100510536 | Ga0070698_1005105361 | 318 |
| 343 | 3300005616 | Ga0068852_100037238 | Ga0068852_1000372384 | 318 |
| 344 | 3300005618 | Ga0068864_100289542 | Ga0068864_1002895422 | 318 |
| 345 | 3300005719 | Ga0068861_100344084 | Ga0068861_1003440841 | 318 |
| 346 | 3300005834 | Ga0068851_10055329 | Ga0068851_100553291 | 318 |
| 347 | 3300005842 | Ga0068858_100071799 | Ga0068858_1000717993 | 318 |
| 348 | 3300005983 | Ga0081540_1002471 | Ga0081540_10024712 | 318 |
| 349 | 3300006048 | Ga0075363_100006644 | Ga0075363_1000066441 | 318 |
| 350 | 3300006178 | Ga0075367_10011619 | Ga0075367_100116192 | 318 |
| 351 | 3300006178 | Ga0075367_10084720 | Ga0075367_100847202 | 318 |
| 352 | 3300006186 | Ga0075369_10003048 | Ga0075369_100030484 | 318 |
| 353 | 3300006846 | Ga0075430_100082487 | Ga0075430_1000824872 | 318 |
| 354 | 3300006847 | Ga0075431_100062005 | Ga0075431_1000620053 | 318 |
| 355 | 3300006871 | Ga0075434_100104296 | Ga0075434_1001042962 | 318 |
| 356 | 3300009098 | Ga0105245_10002939 | Ga0105245_1000293916 | 318 |
| 357 | 3300011119 | Ga0105246_10062671 | Ga0105246_100626713 | 318 |
| 358 | 3300013308 | Ga0157375_10147768 | Ga0157375_101477682 | 318 |
| 359 | 3300025321 | Ga0207656_10006815 | Ga0207656_100068152 | 318 |
| 360 | 3300025924 | Ga0207694_10049322 | Ga0207694_100493223 | 318 |
| 361 | 3300025927 | Ga0207687_10038544 | Ga0207687_100385441 | 318 |
| 362 | 3300025960 | Ga0207651_10074265 | Ga0207651_100742653 | 318 |
| 363 | 3300025960 | Ga0207651_10168366 | Ga0207651_101683662 | 318 |
| 364 | 3300026023 | Ga0207677_10019890 | Ga0207677_100198903 | 318 |
| 365 | 3300026067 | Ga0207678_10030236 | Ga0207678_100302362 | 318 |
| 366 | 3300026095 | Ga0207676_10265452 | Ga0207676_102654522 | 318 |
| 367 | 3300026142 | Ga0207698_10139101 | Ga0207698_101391012 | 318 |
| 368 | 3300027866 | Ga0209813_10067764 | Ga0209813_100677642 | 318 |
| 369 | 3300032126 | Ga0307415_100011650 | Ga0307415_1000116502 | 318 |
| 370 | 3300050490 | nmdc:mga03n38_55936_c1 | nmdc:mga03n38_55936_c1_239_1204 | 318 |
| 371 | 3300050491 | nmdc:mga00v17_210397_c1 | nmdc:mga00v17_210397_c1_173_1138 | 318 |
| 372 | 3300050492 | nmdc:mga0yw44_128928_c1 | nmdc:mga0yw44_128928_c1_191_1156 | 318 |
| 373 | 3300050494 | nmdc:mga06z11_35675_c1 | nmdc:mga06z11_35675_c1_1182_2147 | 318 |
| 374 | 3300050494 | nmdc:mga06z11_63801_c1 | nmdc:mga06z11_63801_c1_109_1074 | 318 |
| 375 | 3300050508 | nmdc:mga09592_67976_c1 | nmdc:mga09592_67976_c1_1729_2694 | 318 |
| 376 | 3300050510 | nmdc:mga06r32_10778_c1 | nmdc:mga06r32_10778_c1_4512_5477 | 318 |
| 377 | 3300005335 | Ga0070666_10117286 | Ga0070666_101172861 | 319 |
| 378 | 3300005347 | Ga0070668_100100845 | Ga0070668_1001008452 | 319 |
| 379 | 3300005436 | Ga0070713_100011188 | Ga0070713_1000111883 | 319 |
| 380 | 3300005437 | Ga0070710_10004375 | Ga0070710_100043752 | 319 |
| 381 | 3300005439 | Ga0070711_100017819 | Ga0070711_1000178193 | 319 |
| 382 | 3300005455 | Ga0070663_100041806 | Ga0070663_1000418062 | 319 |
| 383 | 3300005459 | Ga0068867_100115140 | Ga0068867_1001151403 | 319 |
| 384 | 3300005539 | Ga0068853_100159030 | Ga0068853_1001590301 | 319 |
| 385 | 3300005548 | Ga0070665_100056105 | Ga0070665_1000561054 | 319 |
| 386 | 3300005617 | Ga0068859_100099818 | Ga0068859_1000998182 | 319 |
| 387 | 3300005719 | Ga0068861_100231144 | Ga0068861_1002311442 | 319 |
| 388 | 3300005937 | Ga0081455_10055712 | Ga0081455_100557123 | 319 |
| 389 | 3300005981 | Ga0081538_10018942 | Ga0081538_100189422 | 319 |
| 390 | 3300005983 | Ga0081540_1003760 | Ga0081540_10037607 | 319 |
| 391 | 3300006048 | Ga0075363_100044802 | Ga0075363_1000448022 | 319 |
| 392 | 3300006177 | Ga0075362_10042086 | Ga0075362_100420862 | 319 |
| 393 | 3300006881 | Ga0068865_100190814 | Ga0068865_1001908143 | 319 |
| 394 | 3300006931 | Ga0097620_100099818 | Ga0097620_1000998182 | 319 |
| 395 | 3300009092 | Ga0105250_10098508 | Ga0105250_100985082 | 319 |
| 396 | 3300014325 | Ga0163163_10114371 | Ga0163163_101143712 | 319 |
| 397 | 3300017792 | Ga0163161_10043069 | Ga0163161_100430693 | 319 |
| 398 | 3300025901 | Ga0207688_10050963 | Ga0207688_100509632 | 319 |
| 399 | 3300025906 | Ga0207699_10007439 | Ga0207699_100074394 | 319 |
| 400 | 3300025916 | Ga0207663_10004543 | Ga0207663_100045432 | 319 |
| 401 | 3300025918 | Ga0207662_10101726 | Ga0207662_101017261 | 319 |
| 402 | 3300025924 | Ga0207694_10285236 | Ga0207694_102852362 | 319 |
| 403 | 3300025938 | Ga0207704_10114618 | Ga0207704_101146182 | 319 |
| 404 | 3300025961 | Ga0207712_10014753 | Ga0207712_100147533 | 319 |
| 405 | 3300025972 | Ga0207668_10076918 | Ga0207668_100769182 | 319 |
| 406 | 3300025972 | Ga0207668_10241948 | Ga0207668_102419481 | 319 |
| 407 | 3300026035 | Ga0207703_10198149 | Ga0207703_101981491 | 319 |
| 408 | 3300026067 | Ga0207678_10044806 | Ga0207678_100448064 | 319 |
| 409 | 3300026089 | Ga0207648_10020554 | Ga0207648_100205546 | 319 |
| 410 | 3300026116 | Ga0207674_10539896 | Ga0207674_105398961 | 319 |
| 411 | 3300026118 | Ga0207675_100308595 | Ga0207675_1003085952 | 319 |
| 412 | 3300026121 | Ga0207683_10270104 | Ga0207683_102701042 | 319 |
| 413 | 3300028379 | Ga0268266_10003236 | Ga0268266_1000323619 | 319 |
| 414 | 3300028379 | Ga0268266_10443498 | Ga0268266_104434981 | 319 |
| 415 | 3300028786 | Ga0307517_10094318 | Ga0307517_100943182 | 319 |
| 416 | 3300031241 | Ga0265325_10000052 | Ga0265325_1000005211 | 319 |
| 417 | 3300031507 | Ga0307509_10086077 | Ga0307509_100860773 | 319 |
| 418 | 3300031901 | Ga0307406_10259710 | Ga0307406_102597101 | 319 |
| 419 | 3300032126 | Ga0307415_100124964 | Ga0307415_1001249641 | 319 |
| 420 | 3300033180 | Ga0307510_10039344 | Ga0307510_100393442 | 319 |
| 421 | 3300035113 | Ga0373936_0079272 | Ga0373936_0079272_117_1082 | 319 |
| 422 | 3300035113 | Ga0373936_0090163 | Ga0373936_0090163_81_1046 | 319 |
| 423 | 3300035172 | Ga0373955_0008249 | Ga0373955_0008249_1669_2634 | 319 |
| 424 | 3300035724 | Ga0373933_0088192 | Ga0373933_0088192_691_1656 | 319 |
| 425 | 3300036401 | Ga0373937_0020492 | Ga0373937_0020492_3812_4777 | 319 |
| 426 | 3300037068 | Ga0373925_0019330 | Ga0373925_0019330_3681_4646 | 319 |
| 427 | 3300046454 | Ga0495592_0001683 | Ga0495592_0001683_4839_5804 | 319 |
| 428 | 3300046454 | Ga0495592_0255999 | Ga0495592_0255999_17_982 | 319 |
| 429 | 3300046460 | Ga0495638_0031422 | Ga0495638_0031422_206_1165 | 319 |
| 430 | 3300046516 | Ga0495628_0001265 | Ga0495628_0001265_14511_15476 | 319 |
| 431 | 3300046516 | Ga0495628_0167681 | Ga0495628_0167681_343_1308 | 319 |
| 432 | 3300046519 | Ga0495632_0104076 | Ga0495632_0104076_299_1258 | 319 |
| 433 | 3300046529 | Ga0495652_0017682 | Ga0495652_0017682_827_1792 | 319 |
| 434 | 3300046533 | Ga0495640_0065469 | Ga0495640_0065469_1073_2038 | 319 |
| 435 | 3300046543 | Ga0495645_0000689 | Ga0495645_0000689_2405_3370 | 319 |
| 436 | 3300046559 | Ga0495667_0001076 | Ga0495667_0001076_2428_3393 | 319 |
| 437 | 3300046615 | Ga0495656_0015638 | Ga0495656_0015638_588_1547 | 319 |
| 438 | 3300046683 | Ga0495658_0020102 | Ga0495658_0020102_458_1423 | 319 |
| 439 | 3300046809 | Ga0495600_0039981 | Ga0495600_0039981_699_1664 | 319 |
| 440 | 3300047317 | Ga0495604_0045426 | Ga0495604_0045426_1666_2631 | 319 |
| 441 | 3300047319 | Ga0495674_0116333 | Ga0495674_0116333_472_1437 | 319 |
| 442 | 3300047322 | Ga0495680_0009229 | Ga0495680_0009229_4894_5859 | 319 |
| 443 | 3300047322 | Ga0495680_0126216 | Ga0495680_0126216_487_1452 | 319 |
| 444 | 3300047444 | Ga0495675_0013450 | Ga0495675_0013450_3745_4710 | 319 |
| 445 | 3300048088 | Ga0495602_0044179 | Ga0495602_0044179_1014_1979 | 319 |
| 446 | 3300048905 | Ga0496102_0605192 | Ga0496102_0605192_32_991 | 319 |
| 447 | 3300048906 | Ga0496103_0036389 | Ga0496103_0036389_179_1138 | 319 |
| 448 | 3300048907 | Ga0496104_0000425 | Ga0496104_0000425_5650_6615 | 319 |
| 449 | 3300048908 | Ga0496105_0000531 | Ga0496105_0000531_14572_15537 | 319 |
| 450 | 3300048908 | Ga0496105_0040471 | Ga0496105_0040471_475_1440 | 319 |
| 451 | 3300048929 | Ga0496126_0004022 | Ga0496126_0004022_15334_16293 | 319 |
| 452 | 3300049459 | Ga0495678_067049 | Ga0495678_067049_301_1260 | 319 |
| 453 | 3300049572 | Ga0501036_0263092 | Ga0501036_0263092_394_1353 | 319 |
| 454 | 3300049587 | Ga0501071_0093838 | Ga0501071_0093838_313_1272 | 319 |
| 455 | 3300049592 | Ga0501076_0129014 | Ga0501076_0129014_953_1912 | 319 |
| 456 | 3300049743 | Ga0501081_0275064 | Ga0501081_0275064_87_1046 | 319 |
| 457 | 3300053077 | Ga0495601_0000408 | Ga0495601_0000408_9261_10226 | 319 |
| 458 | 3300053077 | Ga0495601_0023161 | Ga0495601_0023161_1916_2881 | 319 |
| 459 | 3300053084 | Ga0495595_0001343 | Ga0495595_0001343_8313_9278 | 319 |
| 460 | 3300053084 | Ga0495595_0002116 | Ga0495595_0002116_1005_1970 | 319 |
| 461 | 3300053085 | Ga0495619_0000086 | Ga0495619_0000086_34501_35466 | 319 |
| 462 | 3300053085 | Ga0495619_0001999 | Ga0495619_0001999_2881_3846 | 319 |
| 463 | 3300053096 | Ga0500641_0052497 | Ga0500641_0052497_506_1465 | 319 |
| 464 | 3300053133 | Ga0500655_013979 | Ga0500655_013979_211_1170 | 319 |
| 465 | 3300053730 | Ga0500645_012185 | Ga0500645_012185_119_1078 | 319 |
| 466 | 3300053730 | Ga0500645_018795 | Ga0500645_018795_604_1563 | 319 |
| 467 | 3300053731 | Ga0500609_010288 | Ga0500609_010288_24_983 | 319 |
| 468 | iso_pu_bacteria | 2602042107 | 2603862322 | 319 |
| 469 | iso_pu_bacteria | 2857524615 | 2857525789 | 319 |
| 470 | iso_pu_bacteria | 2893066018 | 2893067918 | 319 |
| 471 | iso_pu_bacteria | 2919073203 | 2919074347 | 319 |
| 472 | 3300005331 | Ga0070670_100185088 | Ga0070670_1001850882 | 320 |
| 473 | 3300005547 | Ga0070693_100052712 | Ga0070693_1000527121 | 320 |
| 474 | 3300005983 | Ga0081540_1000007 | Ga0081540_100000757 | 320 |
| 475 | 3300006038 | Ga0075365_10124679 | Ga0075365_101246792 | 320 |
| 476 | 3300006173 | Ga0070716_100091342 | Ga0070716_1000913422 | 320 |
| 477 | 3300006195 | Ga0075366_10054790 | Ga0075366_100547903 | 320 |
| 478 | 3300007788 | Ga0099795_10000703 | Ga0099795_100007033 | 320 |
| 479 | 3300009093 | Ga0105240_10115445 | Ga0105240_101154452 | 320 |
| 480 | 3300009174 | Ga0105241_10098442 | Ga0105241_100984422 | 320 |
| 481 | 3300009551 | Ga0105238_10212114 | Ga0105238_102121142 | 320 |
| 482 | 3300025909 | Ga0207705_10011317 | Ga0207705_100113172 | 320 |
| 483 | 3300025910 | Ga0207684_10044656 | Ga0207684_100446562 | 320 |
| 484 | 3300025911 | Ga0207654_10062373 | Ga0207654_100623732 | 320 |
| 485 | 3300025913 | Ga0207695_10149237 | Ga0207695_101492372 | 320 |
| 486 | 3300025924 | Ga0207694_10052701 | Ga0207694_100527012 | 320 |
| 487 | 3300025936 | Ga0207670_10119122 | Ga0207670_101191223 | 320 |
| 488 | 3300025939 | Ga0207665_10000825 | Ga0207665_100008255 | 320 |
| 489 | 3300046473 | Ga0495582_0042184 | Ga0495582_0042184_1075_2046 | 320 |
| 490 | 3300048904 | Ga0496101_0210005 | Ga0496101_0210005_325_1302 | 320 |
| 491 | 3300049579 | Ga0501043_0059467 | Ga0501043_0059467_1110_2078 | 320 |
| 492 | 3300049580 | Ga0501046_0014710 | Ga0501046_0014710_3698_4666 | 320 |
| 493 | 3300049590 | Ga0501074_0029088 | Ga0501074_0029088_38_1006 | 320 |
| 494 | 3300049592 | Ga0501076_0140669 | Ga0501076_0140669_389_1354 | 320 |
| 495 | 3300050492 | nmdc:mga0yw44_52052_c1 | nmdc:mga0yw44_52052_c1_1287_2258 | 320 |
| 496 | 3300050514 | nmdc:mga08x19_102629_c1 | nmdc:mga08x19_102629_c1_44_1021 | 320 |
| 497 | 3300053085 | Ga0495619_0028424 | Ga0495619_0028424_1618_2589 | 320 |
| 498 | iso_pu_bacteria | 2513237098 | 2513678718 | 320 |
| 499 | iso_pu_bacteria | 2524023210 | 2524465454 | 320 |
| 500 | iso_pu_bacteria | 2885383462 | 2885391524 | 320 |
| 501 | iso_pu_bacteria | 2903768456 | 2903776347 | 320 |
| 502 | iso_pu_bacteria | 8056681323 | 8056681519 | 320 |
| 503 | 3300003215 | JGI25153J46596_10000848 | JGI25153J46596_1000084819 | 321 |
| 504 | 3300005327 | Ga0070658_10118531 | Ga0070658_101185312 | 321 |
| 505 | 3300005329 | Ga0070683_100099443 | Ga0070683_1000994432 | 321 |
| 506 | 3300005338 | Ga0068868_100200790 | Ga0068868_1002007902 | 321 |
| 507 | 3300005355 | Ga0070671_100164986 | Ga0070671_1001649862 | 321 |
| 508 | 3300005364 | Ga0070673_100136831 | Ga0070673_1001368312 | 321 |
| 509 | 3300005456 | Ga0070678_100019735 | Ga0070678_1000197353 | 321 |
| 510 | 3300005457 | Ga0070662_100315020 | Ga0070662_1003150201 | 321 |
| 511 | 3300005518 | Ga0070699_100190953 | Ga0070699_1001909532 | 321 |
| 512 | 3300005548 | Ga0070665_100103879 | Ga0070665_1001038792 | 321 |
| 513 | 3300005564 | Ga0070664_100059073 | Ga0070664_1000590732 | 321 |
| 514 | 3300005577 | Ga0068857_100289977 | Ga0068857_1002899772 | 321 |
| 515 | 3300005616 | Ga0068852_100425866 | Ga0068852_1004258662 | 321 |
| 516 | 3300005618 | Ga0068864_100022139 | Ga0068864_1000221396 | 321 |
| 517 | 3300005983 | Ga0081540_1010261 | Ga0081540_10102612 | 321 |
| 518 | 3300006358 | Ga0068871_100024851 | Ga0068871_1000248512 | 321 |
| 519 | 3300006844 | Ga0075428_100029277 | Ga0075428_1000292773 | 321 |
| 520 | 3300014969 | Ga0157376_10078350 | Ga0157376_100783504 | 321 |
| 521 | 3300025297 | Ga0209758_1015586 | Ga0209758_10155862 | 321 |
| 522 | 3300025909 | Ga0207705_10079109 | Ga0207705_100791092 | 321 |
| 523 | 3300025934 | Ga0207686_10046307 | Ga0207686_100463071 | 321 |
| 524 | 3300025942 | Ga0207689_10042878 | Ga0207689_100428782 | 321 |
| 525 | 3300025945 | Ga0207679_10025720 | Ga0207679_100257202 | 321 |
| 526 | 3300025961 | Ga0207712_10196885 | Ga0207712_101968852 | 321 |
| 527 | 3300026023 | Ga0207677_10165186 | Ga0207677_101651862 | 321 |
| 528 | 3300026067 | Ga0207678_10018631 | Ga0207678_100186314 | 321 |
| 529 | 3300026095 | Ga0207676_10073096 | Ga0207676_100730961 | 321 |
| 530 | 3300028380 | Ga0268265_10009313 | Ga0268265_100093132 | 321 |
| 531 | 3300028381 | Ga0268264_10080039 | Ga0268264_100800392 | 321 |
| 532 | 3300028381 | Ga0268264_10382397 | Ga0268264_103823971 | 321 |
| 533 | 3300032005 | Ga0307411_10375976 | Ga0307411_103759762 | 321 |
| 534 | 3300046684 | Ga0495669_0039152 | Ga0495669_0039152_554_1519 | 321 |
| 535 | 3300048903 | Ga0496100_0065250 | Ga0496100_0065250_1379_2344 | 321 |
| 536 | 3300048907 | Ga0496104_0039091 | Ga0496104_0039091_733_1698 | 321 |
| 537 | 3300048924 | Ga0496121_0000214 | Ga0496121_0000214_46713_47678 | 321 |
| 538 | 3300048929 | Ga0496126_0061537 | Ga0496126_0061537_2198_3178 | 321 |
| 539 | 3300050490 | nmdc:mga03n38_2974_c1 | nmdc:mga03n38_2974_c1_4148_5113 | 321 |
| 540 | 3300050492 | nmdc:mga0yw44_64140_c1 | nmdc:mga0yw44_64140_c1_470_1435 | 321 |
| 541 | 3300050494 | nmdc:mga06z11_42145_c1 | nmdc:mga06z11_42145_c1_1088_2053 | 321 |
| 542 | 3300050496 | nmdc:mga07m45_1913_c3 | nmdc:mga07m45_1913_c3_4351_5316 | 321 |
| 543 | 3300005937 | Ga0081455_10010660 | Ga0081455_100106604 | 322 |
| 544 | 3300005983 | Ga0081540_1013903 | Ga0081540_10139032 | 322 |
| 545 | 3300047320 | Ga0495672_0076801 | Ga0495672_0076801_268_1236 | 322 |
| 546 | 3300048916 | Ga0496113_0251642 | Ga0496113_0251642_43_1011 | 322 |
| 547 | 3300006028 | Ga0070717_10245887 | Ga0070717_102458872 | 323 |
| 548 | 3300031456 | Ga0307513_10163215 | Ga0307513_101632152 | 323 |
| 549 | 3300048905 | Ga0496102_0028253 | Ga0496102_0028253_479_1507 | 323 |
| 550 | 3300049574 | Ga0501038_0164773 | Ga0501038_0164773_783_1760 | 323 |
| 551 | 3300049581 | Ga0501047_0012016 | Ga0501047_0012016_4953_5930 | 323 |
| 552 | 3300049586 | Ga0501070_0039003 | Ga0501070_0039003_2710_3687 | 323 |
| 553 | 3300049822 | Ga0501035_0101824 | Ga0501035_0101824_278_1255 | 323 |
| 554 | 3300049823 | Ga0501044_0211729 | Ga0501044_0211729_858_1835 | 323 |
| 555 | iso_pu_bacteria | 2643221651 | 2644289962 | 323 |
| 556 | 3300005456 | Ga0070678_100308295 | Ga0070678_1003082952 | 324 |
| 557 | 3300005536 | Ga0070697_100068617 | Ga0070697_1000686172 | 324 |
| 558 | 3300005548 | Ga0070665_100021790 | Ga0070665_1000217902 | 324 |
| 559 | 3300005981 | Ga0081538_10064152 | Ga0081538_100641522 | 324 |
| 560 | 3300006038 | Ga0075365_10003658 | Ga0075365_100036582 | 324 |
| 561 | 3300006042 | Ga0075368_10038643 | Ga0075368_100386432 | 324 |
| 562 | 3300006048 | Ga0075363_100017762 | Ga0075363_1000177622 | 324 |
| 563 | 3300006178 | Ga0075367_10057510 | Ga0075367_100575102 | 324 |
| 564 | 3300006353 | Ga0075370_10017942 | Ga0075370_100179423 | 324 |
| 565 | 3300007265 | Ga0099794_10011943 | Ga0099794_100119433 | 324 |
| 566 | 3300009147 | Ga0114129_10143177 | Ga0114129_101431773 | 324 |
| 567 | 3300026067 | Ga0207678_10000808 | Ga0207678_100008088 | 324 |
| 568 | 3300026121 | Ga0207683_10016805 | Ga0207683_100168056 | 324 |
| 569 | 3300026121 | Ga0207683_10548046 | Ga0207683_105480461 | 324 |
| 570 | 3300027866 | Ga0209813_10014130 | Ga0209813_100141302 | 324 |
| 571 | 3300028379 | Ga0268266_10039251 | Ga0268266_100392512 | 324 |
| 572 | 3300028786 | Ga0307517_10001037 | Ga0307517_100010379 | 324 |
| 573 | 3300028794 | Ga0307515_10079255 | Ga0307515_100792552 | 324 |
| 574 | 3300046523 | Ga0495644_0045670 | Ga0495644_0045670_310_1284 | 324 |
| 575 | 3300046537 | Ga0495598_0027515 | Ga0495598_0027515_573_1547 | 324 |
| 576 | 3300046558 | Ga0495633_0040139 | Ga0495633_0040139_382_1356 | 324 |
| 577 | 3300046664 | Ga0495659_0049239 | Ga0495659_0049239_400_1374 | 324 |
| 578 | 3300048905 | Ga0496102_0002605 | Ga0496102_0002605_10490_11464 | 324 |
| 579 | 3300048908 | Ga0496105_0017634 | Ga0496105_0017634_974_1948 | 324 |
| 580 | 3300048909 | Ga0496106_0005613 | Ga0496106_0005613_8212_9186 | 324 |
| 581 | 3300048911 | Ga0496108_0103812 | Ga0496108_0103812_708_1682 | 324 |
| 582 | 3300048912 | Ga0496109_0023243 | Ga0496109_0023243_669_1643 | 324 |
| 583 | 3300048913 | Ga0496110_0006549 | Ga0496110_0006549_5153_6127 | 324 |
| 584 | 3300048914 | Ga0496111_0069801 | Ga0496111_0069801_594_1568 | 324 |
| 585 | 3300048915 | Ga0496112_0113777 | Ga0496112_0113777_519_1493 | 324 |
| 586 | 3300048916 | Ga0496113_0009303 | Ga0496113_0009303_4861_5835 | 324 |
| 587 | 3300048918 | Ga0496115_0012773 | Ga0496115_0012773_4416_5390 | 324 |
| 588 | 3300048929 | Ga0496126_0019846 | Ga0496126_0019846_2403_3377 | 324 |
| 589 | 3300048929 | Ga0496126_0153496 | Ga0496126_0153496_882_1856 | 324 |
| 590 | 3300049572 | Ga0501036_0071937 | Ga0501036_0071937_1044_2024 | 324 |
| 591 | 3300049584 | Ga0501068_0292002 | Ga0501068_0292002_42_1016 | 324 |
| 592 | 3300050507 | nmdc:mga05p37_39963_c1 | nmdc:mga05p37_39963_c1_2288_3262 | 324 |
| 593 | 3300050508 | nmdc:mga09592_163159_c1 | nmdc:mga09592_163159_c1_686_1660 | 324 |
| 594 | 3300050515 | nmdc:mga0a205_253298_c1 | nmdc:mga0a205_253298_c1_507_1481 | 324 |
| 595 | 3300050516 | nmdc:mga0sz30_37113_c1 | nmdc:mga0sz30_37113_c1_125_1099 | 324 |
| 596 | 3300053118 | Ga0500594_0008945 | Ga0500594_0008945_446_1420 | 324 |
| 597 | 3300053139 | Ga0500568_0024204 | Ga0500568_0024204_1321_2298 | 324 |
| 598 | 3300003203 | JGI25406J46586_10003204 | JGI25406J46586_100032045 | 325 |
| 599 | 3300005937 | Ga0081455_10010660 | Ga0081455_100106603 | 325 |
| 600 | 3300005983 | Ga0081540_1004726 | Ga0081540_10047268 | 325 |
| 601 | 3300005985 | Ga0081539_10000040 | Ga0081539_10000040125 | 325 |
| 602 | 3300007265 | Ga0099794_10001834 | Ga0099794_100018346 | 325 |
| 603 | 3300046507 | Ga0495606_0014980 | Ga0495606_0014980_2573_3550 | 325 |
| 604 | 3300047469 | Ga0495673_0083002 | Ga0495673_0083002_277_1260 | 325 |
| 605 | 3300048915 | Ga0496112_0000244 | Ga0496112_0000244_24631_25608 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1us5-assembly1.cif.gz_A | putative glur0 ligand binding core with l-glutamate | 0.9095 | 30 | 323 |
| 1us5-assembly1.cif.gz_A | putative glur0 ligand binding core with l-glutamate | 0.898 | 30 | 323 |
| 4ddd-assembly1.cif.gz_A | crystal structure of an immunogenic protein from ehrlichia chaffeensis | 0.8838 | 28 | 322 |
| 4ddd-assembly1.cif.gz_A | crystal structure of an immunogenic protein from ehrlichia chaffeensis | 0.8673 | 28 | 322 |
| 4esw-assembly1.cif.gz_B | crystal structure of c. albicans thi5 h66g mutant | 0.7352 | 31 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1us4A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9468 | 118 | 257 | 3.40.190.10 |
| 1us4A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9336 | 118 | 257 | 3.40.190.10 |
| 4dddA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9095 | 118 | 257 | 3.40.190.10 |
| 4dddA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8972 | 118 | 257 | 3.40.190.10 |
| 4dddA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8465 | 28 | 322 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C0GKC4-F1-model_v4 | TRAP transporter solute receptor, TAXI family | 0.9697 | 29 | 321 |
GO:0016020
|
| AF-A0A2N5K6P8-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9695 | 67 | 325 |
|
| AF-A0A7V8X6N9-F1-model_v4 | TAXI family TRAP transporter solute-binding subunit | 0.9656 | 35 | 325 |
|
| AF-A0A2N5K6P8-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9622 | 67 | 325 |
|
| AF-A0A139CWP3-F1-model_v4 | TRAP transporter solute receptor, TAXI family | 0.9544 | 48 | 321 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar