F468484

General Info

Members Datasets Scaffolds Average Seq Length
605 448 1210 404

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10095091|Ga0207674_100950913
Length 476
Sequence MPYGGRWTRYRAPNARPNPEVSACVSMGRSVIIAGHNYDQRLSRRPVTQWFVSAPPNPEPPSFVHNPYIRPGQKSVIVVGAGFAGLWAPLGAARKREEIGARAAEVEILVVDRNPYHNIRVRNYEVDLGDAAIPLTKLLDPVGVKHRVAEVETIDPAKQRVVVAAGGSRETLTYDRLVLTLGSELVRPAIPGLAEYTFDIDTYRSALKFDAHLAMLGTKEASAARSTMVVVGAGFTGIEVAAEMPAKLDKAGVAGKRRIVLVDPNTPVGASIGAHGQPVVDEALSALGVETRCGVKVDAVDAGGITLSSGEVIAAQTVVWCAGMRASPLAASLAGERDRHGRLVVDEFMRAKNIAHVFAAGDVACGWLDGVHASVMSCQFARPMGRYAGHNVVVDLFGEPMLPLHIDWYVTVLDLGRWGALYTTGWDRQVYTTGAAAKATKQTINHRRIYPPLNGSRADLLAAAAPSVQAPPPTRA

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
71 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
72 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
125 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
256 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
263 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
264 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
265 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
266 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
267 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
268 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
269 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
270 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
271 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
272 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
273 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
274 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
275 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
276 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
277 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
278 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
279 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
280 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
281 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
282 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
283 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
284 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
285 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
286 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
287 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
288 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
289 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
290 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
291 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
292 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
293 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
294 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
295 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
296 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
297 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
298 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
299 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
300 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
301 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
302 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
303 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
304 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
305 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
306 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
307 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
308 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
309 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
310 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
311 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
312 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
313 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
314 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
315 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
316 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
317 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
318 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
319 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
320 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
321 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
322 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
323 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
324 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
325 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
326 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
327 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
328 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
329 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
330 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
331 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
332 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
333 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
334 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
335 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
336 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
337 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
338 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
339 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
340 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
341 2906610324
342 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
343 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
344 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
345 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
346 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
347 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
348 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
349 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
350 2922368715
351 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
352 2922425934
353 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
354 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
355 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
356 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
357 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
358 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
359 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
360 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
361 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
362 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
363 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
364 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
365 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
366 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
367 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
368 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
369 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
370 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
371 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
372 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
373 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
374 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
375 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
376 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
377 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
378 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
379 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
380 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
381 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
382 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
383 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
384 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
385 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
386 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
387 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
388 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
389 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
390 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
391 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
392 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
393 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
394 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
395 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
396 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
397 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
398 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
399 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
400 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
401 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
402 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
403 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
404 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
405 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
406 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
407 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
408 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
409 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
410 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
411 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
412 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
413 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
414 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
415 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
416 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
417 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
418 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
419 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
420 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
421 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
422 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
423 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
424 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
425 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
426 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
427 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
428 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
429 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
430 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
431 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
432 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
433 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
434 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
435 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
436 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
437 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
438 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
439 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
440 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
441 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
442 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
443 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
444 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
445 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
446 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
447 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
448 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.44
Metatranscriptomes 0
Isolates 30.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.91
Nodule 24.13
Rhizoplane 3.31
Rhizosphere 48.6
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10095091 3300026116 Bacteria 2966
2 JGI25156J39149_1000816 3300002705 Bacteria 15877
3 JGI25165J46597_1001744 3300003214 Bacteria 9565
4 JGI25153J46596_10007060 3300003215 Bacteria 5583
5 JGI25160J50197_1004372 3300003354 Bacteria 6125
6 Ga0055533_1000152 3300003756 Bacteria 69971
7 Ga0055532_1000011 3300003758 Bacteria 385294
8 Ga0055527_1000009 3300003760 Bacteria 385294
9 Ga0055535_1000008 3300003761 Bacteria 385294
10 Ga0055542_1000014 3300003762 Bacteria 385294
11 Ga0055529_1000010 3300003763 Bacteria 385294
12 Ga0065165_1003518 3300005262 Bacteria 10868
13 Ga0070683_100061939 3300005329 Bacteria 3478
14 Ga0070683_100134557 3300005329 Bacteria 2340
15 Ga0070680_100058263 3300005336 Bacteria 3159
16 Ga0070668_100121721 3300005347 Bacteria 2086
17 Ga0070709_10001955 3300005434 Bacteria 11227
18 Ga0070709_10030042 3300005434 Bacteria 3257
19 Ga0070709_10056748 3300005434 Bacteria 2477
20 Ga0070709_10138675 3300005434 Bacteria 1669
21 Ga0070709_10224732 3300005434 Bacteria 1340
22 Ga0070714_100030824 3300005435 Bacteria 4468
23 Ga0070714_100037010 3300005435 Bacteria 4098
24 Ga0070714_100043366 3300005435 Bacteria 3804
25 Ga0070714_100063049 3300005435 Bacteria 3186
26 Ga0070713_100064600 3300005436 Bacteria 3072
27 Ga0070713_100067390 3300005436 Bacteria 3013
28 Ga0070710_10001670 3300005437 Bacteria 10456
29 Ga0070710_10050522 3300005437 Bacteria 2331
30 Ga0070711_100000196 3300005439 Bacteria 31936
31 Ga0070711_100007247 3300005439 Bacteria 6739
32 Ga0070711_100017206 3300005439 Bacteria 4601
33 Ga0070711_100021810 3300005439 Bacteria 4145
34 Ga0070700_100012547 3300005441 Bacteria 4734
35 Ga0070678_100076672 3300005456 Bacteria 2519
36 Ga0070681_10034382 3300005458 Bacteria 5089
37 Ga0070681_10087538 3300005458 Bacteria 3067
38 Ga0070698_100000944 3300005471 Bacteria 31812
39 Ga0070679_100013845 3300005530 Bacteria 7728
40 Ga0070684_100024451 3300005535 Bacteria 5068
41 Ga0070665_100107555 3300005548 Bacteria 2791
42 Ga0070665_100133667 3300005548 Bacteria 2482
43 Ga0068855_100069698 3300005563 Bacteria 4092
44 Ga0068855_100119409 3300005563 Bacteria 3019
45 Ga0068855_100188382 3300005563 Bacteria 2329
46 Ga0070664_100221445 3300005564 Bacteria 1693
47 Ga0068854_100049848 3300005578 Bacteria 2993
48 Ga0068852_100008763 3300005616 Bacteria 7482
49 Ga0068861_100126976 3300005719 Unclassified 2065
50 Ga0081455_10009982 3300005937 Bacteria 9706
51 Ga0081540_1002311 3300005983 Bacteria 15633
52 Ga0070717_10097412 3300006028 Bacteria 2492
53 Ga0075365_10017866 3300006038 Bacteria 4350
54 Ga0075365_10106335 3300006038 Bacteria 1925
55 Ga0075368_10003075 3300006042 Bacteria 5529
56 Ga0075364_10089246 3300006051 Bacteria 2044
57 Ga0070715_10006241 3300006163 Bacteria 4038
58 Ga0070716_100003672 3300006173 Bacteria 7265
59 Ga0070716_100076395 3300006173 Bacteria 1985
60 Ga0070712_100136046 3300006175 Bacteria 1868
61 Ga0075362_10002315 3300006177 Bacteria 6367
62 Ga0075367_10032805 3300006178 Bacteria 2990
63 Ga0075367_10049008 3300006178 Bacteria 2489
64 Ga0075369_10006374 3300006186 Bacteria 4460
65 Ga0075366_10016138 3300006195 Bacteria 4288
66 Ga0075366_10041472 3300006195 Bacteria 2725
67 Ga0075370_10062183 3300006353 Bacteria 2127
68 Ga0075428_100044085 3300006844 Bacteria 4903
69 Ga0075428_100240126 3300006844 Bacteria 1955
70 Ga0075430_100003796 3300006846 Bacteria 12713
71 Ga0075431_100032907 3300006847 Bacteria 5343
72 Ga0075434_100048508 3300006871 Bacteria 4213
73 Ga0075434_100057423 3300006871 Bacteria 3868
74 Ga0075434_100157200 3300006871 Bacteria 2292
75 Ga0099824_1015574 3300006942 Bacteria 7150
76 Ga0075435_100004985 3300007076 Bacteria 9218
77 Ga0075435_100082229 3300007076 Bacteria 2647
78 Ga0105240_10003154 3300009093 Bacteria 25940
79 Ga0105240_10041254 3300009093 Bacteria 5892
80 Ga0105240_10048260 3300009093 Bacteria 5383
81 Ga0105240_10095458 3300009093 Bacteria 3625
82 Ga0105240_10128657 3300009093 Bacteria 3040
83 Ga0105240_10284321 3300009093 Bacteria 1899
84 Ga0111539_10429639 3300009094 Bacteria 1538
85 Ga0105245_10084274 3300009098 Bacteria 2911
86 Ga0114129_10013109 3300009147 Bacteria 11806
87 Ga0114129_10026928 3300009147 Bacteria 8138
88 Ga0105241_10017920 3300009174 Bacteria 5207
89 Ga0105242_10201974 3300009176 Bacteria 1766
90 Ga0105237_10004746 3300009545 Bacteria 15628
91 Ga0105237_10023571 3300009545 Bacteria 6304
92 Ga0105237_10026849 3300009545 Bacteria 5884
93 Ga0105237_10093379 3300009545 Bacteria 2998
94 Ga0105237_10257424 3300009545 Bacteria 1747
95 Ga0105238_10026979 3300009551 Bacteria 5855
96 Ga0105238_10068798 3300009551 Bacteria 3542
97 Ga0099796_10001862 3300010159 Bacteria 4441
98 Ga0105239_10022111 3300010375 Bacteria 7009
99 Ga0105239_10051112 3300010375 Bacteria 4532
100 Ga0105239_10054985 3300010375 Bacteria 4366
101 Ga0157369_10015551 3300013105 Bacteria 8577
102 Ga0157369_10054613 3300013105 Bacteria 4314
103 Ga0157369_10223526 3300013105 Bacteria 1970
104 Ga0157374_10227884 3300013296 Bacteria 1830
105 Ga0157374_10319261 3300013296 Bacteria 1539
106 Ga0157374_10428481 3300013296 Bacteria 1322
107 Ga0157378_10193048 3300013297 Bacteria 1922
108 Ga0163162_10249346 3300013306 Bacteria 1907
109 Ga0157375_10060090 3300013308 Bacteria 3768
110 Ga0163163_10048710 3300014325 Bacteria 4168
111 Ga0157376_10192444 3300014969 Bacteria 1871
112 Ga0214544_1000035 3300021320 Bacteria 146874
113 Ga0214542_1000181 3300021321 Bacteria 97233
114 Ga0214545_1000094 3300021324 Bacteria 98180
115 Ga0214543_1000155 3300021327 Bacteria 97353
116 Ga0213876_10003396 3300021384 Bacteria 9115
117 Ga0213876_10016465 3300021384 Bacteria 3907
118 Ga0209674_100011 3300025226 Bacteria 997175
119 Ga0209672_100002 3300025228 Bacteria 1733325
120 Ga0209147_100003 3300025229 Bacteria 1733325
121 Ga0207427_102041 3300025231 Bacteria 6056
122 Ga0209258_100005 3300025242 Bacteria 1087938
123 Ga0209677_100588 3300025253 Bacteria 19808
124 Ga0209148_1000006 3300025254 Bacteria 1733325
125 Ga0209148_1000306 3300025254 Bacteria 70293
126 Ga0209759_1000006 3300025256 Bacteria 492407
127 Ga0209233_1000018 3300025261 Bacteria 886857
128 Ga0209233_1008238 3300025261 Bacteria 3239
129 Ga0209565_1004117 3300025263 Bacteria 4526
130 Ga0209455_1000003 3300025272 Bacteria 1471893
131 Ga0209675_1001048 3300025291 Bacteria 17197
132 Ga0209025_1002751 3300025294 Bacteria 17794
133 Ga0209564_1012603 3300025295 Bacteria 3671
134 Ga0209758_1002505 3300025297 Bacteria 18644
135 Ga0209758_1007560 3300025297 Bacteria 7347
136 Ga0209256_1000086 3300025299 Bacteria 218837
137 Ga0207426_1001686 3300025302 Bacteria 17074
138 Ga0207426_1002545 3300025302 Bacteria 11426
139 Ga0207426_1027393 3300025302 Bacteria 1899
140 Ga0209051_1004115 3300025303 Bacteria 9119
141 Ga0209257_1010845 3300025304 Bacteria 4513
142 Ga0207710_10022858 3300025900 Bacteria 2684
143 Ga0207647_10006441 3300025904 Bacteria 8531
144 Ga0207685_10004855 3300025905 Bacteria 3476
145 Ga0207699_10001797 3300025906 Bacteria 10076
146 Ga0207684_10199170 3300025910 Unclassified 1727
147 Ga0207707_10003051 3300025912 Bacteria 14884
148 Ga0207707_10082041 3300025912 Bacteria 2815
149 Ga0207695_10000136 3300025913 Bacteria 217596
150 Ga0207695_10010587 3300025913 Bacteria 11273
151 Ga0207695_10049312 3300025913 Bacteria 4440
152 Ga0207695_10111059 3300025913 Bacteria 2721
153 Ga0207671_10001211 3300025914 Bacteria 30648
154 Ga0207671_10003193 3300025914 Bacteria 16519
155 Ga0207693_10015879 3300025915 Bacteria 6029
156 Ga0207693_10037338 3300025915 Bacteria 3829
157 Ga0207663_10004539 3300025916 Bacteria 6914
158 Ga0207663_10034354 3300025916 Bacteria 3031
159 Ga0207663_10077906 3300025916 Bacteria 2159
160 Ga0207652_10031613 3300025921 Bacteria 4447
161 Ga0207652_10090994 3300025921 Bacteria 2682
162 Ga0207687_10268055 3300025927 Bacteria 1364
163 Ga0207700_10044558 3300025928 Bacteria 3267
164 Ga0207664_10012276 3300025929 Bacteria 6122
165 Ga0207664_10021449 3300025929 Bacteria 4804
166 Ga0207664_10030192 3300025929 Bacteria 4138
167 Ga0207644_10044694 3300025931 Bacteria 3148
168 Ga0207706_10118493 3300025933 Bacteria 2328
169 Ga0207704_10256517 3300025938 Bacteria 1316
170 Ga0207665_10022501 3300025939 Bacteria 4147
171 Ga0207665_10050654 3300025939 Bacteria 2793
172 Ga0207661_10027104 3300025944 Bacteria 4374
173 Ga0207667_10067950 3300025949 Bacteria 3712
174 Ga0207667_10246372 3300025949 Bacteria 1828
175 Ga0207651_10174647 3300025960 Bacteria 1698
176 Ga0207668_10157164 3300025972 Bacteria 1767
177 Ga0207640_10141426 3300025981 Bacteria 1755
178 Ga0207703_10171852 3300026035 Bacteria 1907
179 Ga0207678_10049949 3300026067 Bacteria 3614
180 Ga0207708_10043127 3300026075 Unclassified 3438
181 Ga0207674_10235975 3300026116 Bacteria 1776
182 Ga0207675_100070651 3300026118 Unclassified 3263
183 Ga0207698_10180345 3300026142 Bacteria 1870
184 Ga0209389_1001196 3300027296 Bacteria 17831
185 Ga0209589_1000014 3300027357 Bacteria 227996
186 Ga0209489_100014 3300027361 Bacteria 227996
187 Ga0209489_106825 3300027361 Bacteria 17831
188 Ga0209700_100024 3300027363 Bacteria 227996
189 Ga0209700_104961 3300027363 Bacteria 23195
190 Ga0265332_10011597 3300031238 Bacteria 3915
191 Ga0265329_10021830 3300031242 Bacteria 2147
192 Ga0265339_10013976 3300031249 Bacteria 4854
193 Ga0265339_10033726 3300031249 Bacteria 2880
194 Ga0265314_10012875 3300031711 Bacteria 6796
195 Ga0265342_10000178 3300031712 Bacteria 70648
196 Ga0265342_10007344 3300031712 Bacteria 8085
197 Ga0307510_10037179 3300033180 Bacteria 5406
198 Ga0373926_0059932 3300035083 Bacteria 1386
199 Ga0373956_0048460 3300035119 Bacteria 1903
200 Ga0373946_0019980 3300035171 Bacteria 2585
201 Ga0373924_0006791 3300035410 Bacteria 4111
202 Ga0373925_0255808 3300037068 Bacteria 1405
203 Ga0395900_0017532 3300037418 Bacteria 7307
204 Ga0395900_0126628 3300037418 Bacteria 2620
205 Ga0395900_0300773 3300037418 Bacteria 1591
206 Ga0436364_0530572 3300037853 Bacteria 11631
207 Ga0395901_0084484 3300038443 Bacteria 3318
208 Ga0436365_1172571 3300039437 Bacteria 49899
209 Ga0436360_0675095 3300039438 Bacteria 5400
210 Ga0436360_0783709 3300039438 Bacteria 2740
211 Ga0436362_0079543 3300039453 Bacteria 5210
212 Ga0436362_0179984 3300039453 Bacteria 4924
213 Ga0466972_0001618 3300044658 Bacteria 11013
214 Ga0466963_0029236 3300044694 Bacteria 3545
215 Ga0466957_0038682 3300044842 Bacteria 2875
216 Ga0466960_0010051 3300044901 Bacteria 3920
217 Ga0466960_0020485 3300044901 Bacteria 2929
218 Ga0466959_0130879 3300045049 Bacteria 1778
219 Ga0466967_0100975 3300045976 Bacteria 2636
220 Ga0495592_0082176 3300046454 Bacteria 2329
221 Ga0495603_0001725 3300046455 Bacteria 12879
222 Ga0495603_0129835 3300046455 Bacteria 1468
223 Ga0495590_0004167 3300046457 Bacteria 5852
224 Ga0495629_0000037 3300046459 Bacteria 117099
225 Ga0495629_0005693 3300046459 Bacteria 9306
226 Ga0495629_0013777 3300046459 Bacteria 5834
227 Ga0495629_0083326 3300046459 Bacteria 2232
228 Ga0495638_0016554 3300046460 Bacteria 4935
229 Ga0495651_0030798 3300046462 Bacteria 4183
230 Ga0495653_0000048 3300046463 Bacteria 109560
231 Ga0495650_0000512 3300046471 Bacteria 57758
232 Ga0495650_0006780 3300046471 Bacteria 7070
233 Ga0495580_0000783 3300046472 Bacteria 27409
234 Ga0495580_0085174 3300046472 Bacteria 2201
235 Ga0495582_0007936 3300046473 Bacteria 5864
236 Ga0495582_0010289 3300046473 Bacteria 5146
237 Ga0495582_0010715 3300046473 Bacteria 5043
238 Ga0495605_0020473 3300046474 Bacteria 3514
239 Ga0495605_0062716 3300046474 Bacteria 1775
240 Ga0495664_0007134 3300046477 Bacteria 6193
241 Ga0495664_0007508 3300046477 Bacteria 6061
242 Ga0495664_0033088 3300046477 Bacteria 3037
243 Ga0495584_0088517 3300046491 Unclassified 1561
244 Ga0495583_0002063 3300046506 Bacteria 18176
245 Ga0495606_0005064 3300046507 Bacteria 12822
246 Ga0495606_0033520 3300046507 Bacteria 3541
247 Ga0495606_0039260 3300046507 Bacteria 3193
248 Ga0495606_0076609 3300046507 Bacteria 2090
249 Ga0495608_0032073 3300046511 Bacteria 3551
250 Ga0495608_0106875 3300046511 Bacteria 1801
251 Ga0495610_0086397 3300046512 Bacteria 1429
252 Ga0495618_0036523 3300046514 Bacteria 3083
253 Ga0495618_0108664 3300046514 Bacteria 1776
254 Ga0495620_0022460 3300046515 Bacteria 3037
255 Ga0495648_0009868 3300046524 Bacteria 7337
256 Ga0495666_0009105 3300046526 Bacteria 4966
257 Ga0495642_0001510 3300046528 Bacteria 10360
258 Ga0495652_0012560 3300046529 Bacteria 7637
259 Ga0495652_0031270 3300046529 Bacteria 4662
260 Ga0495652_0070459 3300046529 Bacteria 2922
261 Ga0495640_0021996 3300046533 Bacteria 4670
262 Ga0495640_0048015 3300046533 Bacteria 2952
263 Ga0495586_0008547 3300046535 Bacteria 5451
264 Ga0495586_0015664 3300046535 Bacteria 4035
265 Ga0495587_0016650 3300046536 Bacteria 4573
266 Ga0495645_0000597 3300046543 Bacteria 24914
267 Ga0495645_0009546 3300046543 Bacteria 6784
268 Ga0495645_0057564 3300046543 Bacteria 2821
269 Ga0495645_0081721 3300046543 Bacteria 2318
270 Ga0495667_0006245 3300046559 Bacteria 8079
271 Ga0495667_0012788 3300046559 Bacteria 5687
272 Ga0495667_0064344 3300046559 Bacteria 2399
273 Ga0495668_0035563 3300046616 Bacteria 2792
274 Ga0495634_0065737 3300046642 Bacteria 2403
275 Ga0495634_0073094 3300046642 Bacteria 2255
276 Ga0495635_0001740 3300046663 Bacteria 14652
277 Ga0495588_0001796 3300046674 Bacteria 9150
278 Ga0495588_0100963 3300046674 Bacteria 1516
279 Ga0495657_0021783 3300046675 Bacteria 4597
280 Ga0495657_0025361 3300046675 Bacteria 4211
281 Ga0495657_0041792 3300046675 Bacteria 3135
282 Ga0495599_0021661 3300046678 Bacteria 4010
283 Ga0495623_0007621 3300046679 Bacteria 7031
284 Ga0495646_0002049 3300046680 Bacteria 12220
285 Ga0495646_0010703 3300046680 Bacteria 5827
286 Ga0495646_0084038 3300046680 Bacteria 1849
287 Ga0495613_0011301 3300046689 Bacteria 6632
288 Ga0495613_0039158 3300046689 Bacteria 3514
289 Ga0495613_0041214 3300046689 Bacteria 3420
290 Ga0495624_0029348 3300046690 Bacteria 3588
291 Ga0495671_0036953 3300046692 Bacteria 2472
292 Ga0495649_0003175 3300046694 Bacteria 11233
293 Ga0495649_0006790 3300046694 Bacteria 7087
294 Ga0495589_0006712 3300046794 Bacteria 6062
295 Ga0495600_0019537 3300046809 Bacteria 4327
296 Ga0495600_0058750 3300046809 Bacteria 2512
297 Ga0495660_0068379 3300046810 Bacteria 1890
298 Ga0495581_0001404 3300047315 Bacteria 13340
299 Ga0495581_0003102 3300047315 Bacteria 9515
300 Ga0495604_0009576 3300047317 Bacteria 7661
301 Ga0495604_0011467 3300047317 Bacteria 7037
302 Ga0495604_0161352 3300047317 Bacteria 1584
303 Ga0495674_0009842 3300047319 Bacteria 9073
304 Ga0495674_0027392 3300047319 Bacteria 5208
305 Ga0495674_0027552 3300047319 Bacteria 5191
306 Ga0495674_0085784 3300047319 Bacteria 2697
307 Ga0495674_0096047 3300047319 Bacteria 2526
308 Ga0495676_0129521 3300047321 Bacteria 1824
309 Ga0495680_0014808 3300047322 Bacteria 6743
310 Ga0495680_0061333 3300047322 Bacteria 2893
311 Ga0495683_0000197 3300047323 Bacteria 57373
312 Ga0495683_0038576 3300047323 Bacteria 2418
313 Ga0495683_0073874 3300047323 Bacteria 1672
314 Ga0495687_004082 3300047443 Bacteria 10105
315 Ga0495687_007230 3300047443 Bacteria 6596
316 Ga0495687_024114 3300047443 Bacteria 2897
317 Ga0495687_024759 3300047443 Bacteria 2848
318 Ga0495675_0005919 3300047444 Bacteria 7475
319 Ga0495675_0045070 3300047444 Bacteria 2808
320 Ga0495679_000038 3300047446 Bacteria 157311
321 Ga0495593_0023011 3300047673 Bacteria 3467
322 Ga0495602_0026762 3300048088 Bacteria 5557
323 Ga0495614_0023033 3300048089 Bacteria 2686
324 Ga0495614_0065866 3300048089 Bacteria 1558
325 Ga0495626_0003914 3300048091 Bacteria 9332
326 Ga0495626_0017422 3300048091 Bacteria 3627
327 Ga0496101_0049302 3300048904 Bacteria 3029
328 Ga0496101_0051462 3300048904 Bacteria 2968
329 Ga0496102_0151037 3300048905 Bacteria 2183
330 Ga0496102_0184626 3300048905 Bacteria 1965
331 Ga0496104_0019958 3300048907 Bacteria 6137
332 Ga0496104_0021829 3300048907 Bacteria 5879
333 Ga0496104_0112691 3300048907 Bacteria 2608
334 Ga0496105_0007387 3300048908 Bacteria 8507
335 Ga0496105_0102966 3300048908 Bacteria 2357
336 Ga0496106_0104953 3300048909 Bacteria 2195
337 Ga0496106_0198701 3300048909 Bacteria 1595
338 Ga0496107_0073308 3300048910 Bacteria 2490
339 Ga0496108_0039107 3300048911 Bacteria 3954
340 Ga0496109_0164211 3300048912 Bacteria 2081
341 Ga0496114_0001094 3300048917 Bacteria 20441
342 Ga0496115_0014550 3300048918 Bacteria 5956
343 Ga0496115_0056934 3300048918 Bacteria 3143
344 Ga0496115_0069947 3300048918 Bacteria 2844
345 Ga0496115_0089801 3300048918 Bacteria 2509
346 Ga0496116_0017551 3300048919 Bacteria 5549
347 Ga0496117_0139394 3300048920 Bacteria 1455
348 Ga0496118_0029510 3300048921 Bacteria 4597
349 Ga0496118_0035180 3300048921 Bacteria 4072
350 Ga0496119_0013986 3300048922 Bacteria 6325
351 Ga0496119_0030037 3300048922 Bacteria 3671
352 Ga0496119_0080406 3300048922 Bacteria 1880
353 Ga0496120_0014026 3300048923 Bacteria 5360
354 Ga0496121_0024272 3300048924 Bacteria 5807
355 Ga0496121_0034755 3300048924 Bacteria 4531
356 Ga0496121_0040301 3300048924 Bacteria 4100
357 Ga0496121_0119412 3300048924 Bacteria 1994
358 Ga0496121_0131741 3300048924 Bacteria 1869
359 Ga0496122_0087522 3300048925 Bacteria 2140
360 Ga0496123_0085520 3300048926 Bacteria 1897
361 Ga0496124_0034938 3300048927 Bacteria 4402
362 Ga0496125_0028927 3300048928 Bacteria 4991
363 Ga0496125_0047706 3300048928 Bacteria 3578
364 Ga0496126_0030874 3300048929 Bacteria 5072
365 Ga0496126_0183506 3300048929 Bacteria 1776
366 Ga0496126_0243775 3300048929 Bacteria 1500
367 Ga0495678_002987 3300049459 Bacteria 10783
368 Ga0495682_0005292 3300049460 Bacteria 5384
369 Ga0501033_0046021 3300049570 Bacteria 3245
370 Ga0501034_0029547 3300049571 Bacteria 5572
371 Ga0501034_0106711 3300049571 Bacteria 2794
372 Ga0501034_0382113 3300049571 Unclassified 1333
373 Ga0501043_0030167 3300049579 Bacteria 4260
374 Ga0501046_0054594 3300049580 Bacteria 3142
375 Ga0501047_0041042 3300049581 Bacteria 4472
376 Ga0501047_0084460 3300049581 Bacteria 3051
377 Ga0501070_0000277 3300049586 Bacteria 48215
378 Ga0501070_0082953 3300049586 Bacteria 2653
379 Ga0501074_0051590 3300049590 Bacteria 2969
380 Ga0501035_0024447 3300049822 Bacteria 5540
381 Ga0501035_0026609 3300049822 Bacteria 5291
382 Ga0501035_0035230 3300049822 Bacteria 4543
383 Ga0501044_0000076 3300049823 Bacteria 120755
384 Ga0501044_0023896 3300049823 Bacteria 6496
385 Ga0501044_0088534 3300049823 Bacteria 3125
386 nmdc:mga0yw44_10871_c1 3300050492 Bacteria 4667
387 nmdc:mga0yw44_62262_c1 3300050492 Bacteria 2291
388 nmdc:mga0k408_110453_c1 3300050493 Bacteria 1625
389 nmdc:mga06z11_66582_c1 3300050494 Bacteria 1894
390 nmdc:mga07m45_85110_c1 3300050496 Bacteria 1808
391 nmdc:mga05p37_93549_c1 3300050507 Bacteria 3704
392 nmdc:mga0qj67_122813_c1 3300050509 Bacteria 2101
393 nmdc:mga08y16_54574_c1 3300050511 Bacteria 4175
394 nmdc:mga0n895_16612_c1 3300050512 Bacteria 6759
395 nmdc:mga0n895_291270_c1 3300050512 Bacteria 1655
396 nmdc:mga0n895_47091_c1 3300050512 Bacteria 4215
397 nmdc:mga0rr50_152972_c1 3300050513 Bacteria 1866
398 nmdc:mga0rr50_47654_c1 3300050513 Bacteria 3163
399 nmdc:mga0sz30_21904_c1 3300050516 Bacteria 2590
400 nmdc:mga0sz30_42910_c1 3300050516 Bacteria 1903
401 Ga0495612_0010694 3300053078 Bacteria 3707
402 Ga0495612_0026646 3300053078 Bacteria 2323
403 Ga0500635_0016363 3300053080 Bacteria 2205
404 Ga0500578_0048699 3300053086 Bacteria 2719
405 Ga0500578_0126581 3300053086 Bacteria 1604
406 Ga0500643_001638 3300053087 Bacteria 12502
407 Ga0500566_0005639 3300053094 Bacteria 7436
408 Ga0500556_0045249 3300053104 Bacteria 1569
409 Ga0500557_000206 3300053105 Bacteria 9788
410 Ga0500562_014286 3300053108 Bacteria 2033
411 Ga0500572_006661 3300053111 Bacteria 2652
412 Ga0500642_0057992 3300053130 Bacteria 1729
413 Ga0500616_0008487 3300053153 Bacteria 6373
414 Ga0500616_0050983 3300053153 Bacteria 2183
415 Ga0500620_007895 3300053155 Bacteria 2655
416 Ga0500636_0000460 3300053177 Bacteria 22203
417 Ga0500552_000211 3300053733 Bacteria 5230
418 Ga0501082_0063645 3300060353 Bacteria 3176
419 2507506772 2507262055 Bacteria 8048963
420 2508540786 2508501009 Bacteria 7784016
421 2509149594 2508501128 Bacteria 8613869
422 2513628915 2513237092 Bacteria 8341956
423 2513651821 2513237095 Bacteria 8976980
424 2513653942 2513237096 Bacteria 8722461
425 2513677973 2513237098 Bacteria 9902361
426 2513704732 2513237102 Bacteria 7703324
427 2513723531 2513237104 Bacteria 10034502
428 2513856376 2513237137 Bacteria 9558895
429 2513877321 2513237139 Bacteria 8737671
430 2513892726 2513237141 Bacteria 8496279
431 2513918282 2513237145 Bacteria 8979722
432 2514012999 2513237161 Bacteria 8871253
433 2515629597 2515154112 Bacteria 8294334
434 2517107909 2517093001 Bacteria 9002274
435 2517891488 2517572143 Bacteria 9484767
436 2524439295 2524023205 Bacteria 8918781
437 2524468333 2524023210 Bacteria 9029266
438 2524540999 2524023228 Bacteria 10118060
439 2528852139 2528768022 Bacteria 10457665
440 2617348297 2617270735 Bacteria 9163226
441 2617377428 2617270741 Bacteria 8201522
442 2671118743 2667528175 Bacteria 7532676
443 2745082664 2744054633 Bacteria 8678936
444 2793066856 2791355197 Bacteria 8420563
445 2805919028 2802429603 Bacteria 8777136
446 2818241986 2816332527 Bacteria 8933356
447 2824604915 2824600985 Bacteria 8488197
448 2824615254 2824609381 Bacteria 8672835
449 2824625585 2824617872 Bacteria 8814715
450 2824634585 2824626560 Bacteria 8813858
451 2824642339 2824635225 Bacteria 8785348
452 2824651503 2824644064 Bacteria 8743947
453 2824660716 2824653114 Bacteria 8493680
454 2824669476 2824661429 Bacteria 9877870
455 2824678399 2824671348 Bacteria 8369588
456 2824687645 2824679649 Bacteria 8248951
457 2824694843 2824687955 Bacteria 8360029
458 2824713784 2824704595 Bacteria 9667483
459 2824722416 2824714736 Bacteria 8717648
460 2824731476 2824723954 Bacteria 8758240
461 2824740583 2824732956 Bacteria 7810675
462 2824753348 2824746037 Bacteria 7911610
463 2824760803 2824753945 Bacteria 9787441
464 2824771415 2824763712 Bacteria 9792355
465 2824781142 2824773399 Bacteria 8360218
466 2841947666 2841941048 Bacteria 8688029
467 2841963173 2841957949 Bacteria 8652217
468 2842044723 2842038055 Bacteria 8002051
469 2842053090 2842045827 Bacteria 8006841
470 2844320901 2844315083 Bacteria 8138177
471 2847938383 2847930680 Bacteria 9342022
472 2847940293 2847939898 Bacteria 8606328
473 2849077505 2849076700 Bacteria 7039503
474 2857510738 2857509624 Bacteria 7472071
475 2874591826 2874590934 Bacteria 8299676
476 2874618781 2874612657 Bacteria 8252029
477 2874630860 2874628541 Bacteria 8630250
478 2874646284 2874645413 Bacteria 8214782
479 2876762053 2876761206 Bacteria 10111113
480 2876772097 2876771140 Bacteria 8287509
481 2876819370 2876818435 Bacteria 8274608
482 2879078793 2879074833 Bacteria 8279565
483 2879086031 2879083081 Bacteria 8587928
484 2879106179 2879099564 Bacteria 10442239
485 2881364258 2881364244 Bacteria 7710352
486 2885367595 2885366525 Bacteria 8326213
487 2885377807 2885374607 Bacteria 8927485
488 2885384649 2885383462 Bacteria 9473874
489 2888386264 2888378607 Bacteria 9652610
490 2888426407 2888419890 Bacteria 7857137
491 2903728028 2903727486 Bacteria 8281579
492 2903758730 2903748898 Bacteria 9972761
493 2903773447 2903768456 Bacteria 9749579
494 2904486665 2904483920 Bacteria 7545285
495 2904691344 2904690495 Bacteria 9412302
496 2904713314 2904711408 Bacteria 9771557
497 2906609053 2906602504 Bacteria 8295279
498 2906616664
499 2906627286 2906626472 Bacteria 8826946
500 2906643720 2906635258 Bacteria 8601019
501 2906649272 2906643746 Bacteria 8722424
502 2906666991 2906660503 Bacteria 8595048
503 2908741830 2908739725 Bacteria 8628932
504 2908759524 2908756301 Bacteria 8864324
505 2908782530 2908775508 Bacteria 8092255
506 2919527996 2919527303 Bacteria 7718827
507 2922376888
508 2922399627 2922393267 Bacteria 8285685
509 2922431311
510 2929621532 2929615660 Bacteria 9193770
511 2929631653 2929624759 Bacteria 9339455
512 2932790155 2932784394 Bacteria 9704911
513 2932798769 2932794094 Bacteria 7915132
514 2932809291 2932801729 Bacteria 7987968
515 2932815938 2932809354 Bacteria 9135765
516 2932824826 2932818245 Bacteria 9955613
517 2932833385 2932828146 Bacteria 9745859
518 2933583443 2933577622 Bacteria 9116884
519 2935615945 2935608549 Bacteria 8203142
520 2935621340 2935616580 Bacteria 9032984
521 2935633905 2935630451 Bacteria 8169952
522 2935644690 2935638405 Bacteria 10015038
523 2935672294 2935665750 Bacteria 9571747
524 2935682733 2935675223 Bacteria 9928132
525 2935693362 2935684952 Bacteria 9590419
526 2935702248 2935694250 Bacteria 9291695
527 2935710833 2935703347 Bacteria 10242284
528 2935720849 2935713505 Bacteria 9608509
529 2935730664 2935722832 Bacteria 9608746
530 2935740571 2935732158 Bacteria 9706831
531 2935749955 2935741537 Bacteria 9707219
532 2935759225 2935750917 Bacteria 9590372
533 2935767323 2935760218 Bacteria 9817913
534 2935772335 2935769743 Bacteria 7878163
535 2935783873 2935777560 Bacteria 8077691
536 2935787786 2935785616 Bacteria 7962367
537 2935793657 2935793552 Bacteria 8012592
538 2935808783 2935801545 Bacteria 9301974
539 2935817580 2935810662 Bacteria 9401221
540 2935826892 2935819856 Bacteria 8261050
541 2935833940 2935827899 Bacteria 10038562
542 2935845569 2935837841 Bacteria 9454360
543 2935854072 2935847175 Bacteria 8228321
544 2935859467 2935855204 Bacteria 9035059
545 2935869890 2935864058 Bacteria 9784707
546 2935880852 2935873716 Bacteria 9632195
547 2935889364 2935883170 Bacteria 7964738
548 2935916810 2935908558 Bacteria 8568796
549 2935923272 2935916978 Bacteria 9113783
550 2935934318 2935926038 Bacteria 8601059
551 2935942801 2935934488 Bacteria 8602579
552 2935951242 2935942939 Bacteria 8599779
553 2935959682 2935951376 Bacteria 8602333
554 2935964687 2935959822 Bacteria 7869783
555 2935975771 2935967501 Bacteria 8603075
556 2935981453 2935975950 Bacteria 8347125
557 2935998373 2935992306 Bacteria 9802711
558 2936009275 2936002035 Bacteria 9362176
559 2936044519 2936037263 Bacteria 9446081
560 2940565249 2940556831 Bacteria 9590747
561 2941510792 2941507105 Bacteria 8166816
562 2941518176 2941515067 Bacteria 8166720
563 2941526953 2941523033 Bacteria 8169134
564 2941542827 2941538514 Bacteria 9402094
565 3005481107 3005474847 Bacteria 9259049
566 3005488988 3005483717 Bacteria 7877331
567 3005507783 3005506211 Bacteria 6943378
568 3005593981 3005587118 Bacteria 7794411
569 3005601185 3005594810 Bacteria 8716512
570 3005723929 3005718088 Bacteria 8283608
571 8006929392 8006926726 Bacteria 6749210
572 8006939604 8006933436 Bacteria 10410654
573 8006979355 8006973647 Bacteria 10679141
574 8016519713 8016511872 Bacteria 9921665
575 8016527738 8016522445 Bacteria 8156687
576 8016532839 8016530956 Bacteria 8155261
577 8016546073 8016539877 Bacteria 8155419
578 8016556045 8016548790 Bacteria 8155074
579 8016564405 8016557553 Bacteria 8154380
580 8016571149 8016566248 Bacteria 8158151
581 8016583645 8016575299 Bacteria 8154085
582 8016584045 8016583857 Bacteria 10421953
583 8016602078 8016595262 Bacteria 8149947
584 8016608048 8016603502 Bacteria 8731218
585 8016616829 8016613128 Bacteria 8794220
586 8016624426 8016622563 Bacteria 7999408
587 8017065820 8017057580 Bacteria 10023680
588 8019532643 8019530166 Bacteria 8155624
589 8019547207 8019538911 Bacteria 7872763
590 8019551448 8019547302 Bacteria 7996444
591 8019565495 8019555841 Bacteria 9642137
592 8019575591 8019565922 Bacteria 9639779
593 8019585255 8019576017 Bacteria 10049540
594 8019593229 8019586578 Bacteria 10212056
595 8019610142 8019608314 Bacteria 10042931
596 8019620825 8019619141 Bacteria 9218857
597 8019632369 8019629233 Bacteria 8687553
598 8019655127 8019648815 Bacteria 10014479
599 8019692536 8019687851 Bacteria 8712826
600 8055267540 8055266321 Bacteria 7999742
601 8055304676 8055301274 Bacteria 8587385
602 8055744265 8055742211 Bacteria 9226248
603 8056681396 8056681323 Bacteria 8472857
604 8056693839 8056689827 Bacteria 6712655
605 8056973471 8056967851 Bacteria 9038162
606 Ga0207674_10095091
607 JGI25156J39149_1000816
608 JGI25165J46597_1001744
609 JGI25153J46596_10007060
610 JGI25160J50197_1004372
611 Ga0055533_1000152
612 Ga0055532_1000011
613 Ga0055527_1000009
614 Ga0055535_1000008
615 Ga0055542_1000014
616 Ga0055529_1000010
617 Ga0065165_1003518
618 Ga0070683_100061939
619 Ga0070683_100134557
620 Ga0070680_100058263
621 Ga0070668_100121721
622 Ga0070709_10001955
623 Ga0070709_10030042
624 Ga0070709_10056748
625 Ga0070709_10138675
626 Ga0070709_10224732
627 Ga0070714_100030824
628 Ga0070714_100037010
629 Ga0070714_100043366
630 Ga0070714_100063049
631 Ga0070713_100064600
632 Ga0070713_100067390
633 Ga0070710_10001670
634 Ga0070710_10050522
635 Ga0070711_100000196
636 Ga0070711_100007247
637 Ga0070711_100017206
638 Ga0070711_100021810
639 Ga0070700_100012547
640 Ga0070678_100076672
641 Ga0070681_10034382
642 Ga0070681_10087538
643 Ga0070698_100000944
644 Ga0070679_100013845
645 Ga0070684_100024451
646 Ga0070665_100107555
647 Ga0070665_100133667
648 Ga0068855_100069698
649 Ga0068855_100119409
650 Ga0068855_100188382
651 Ga0070664_100221445
652 Ga0068854_100049848
653 Ga0068852_100008763
654 Ga0068861_100126976
655 Ga0081455_10009982
656 Ga0081540_1002311
657 Ga0070717_10097412
658 Ga0075365_10017866
659 Ga0075365_10106335
660 Ga0075368_10003075
661 Ga0075364_10089246
662 Ga0070715_10006241
663 Ga0070716_100003672
664 Ga0070716_100076395
665 Ga0070712_100136046
666 Ga0075362_10002315
667 Ga0075367_10032805
668 Ga0075367_10049008
669 Ga0075369_10006374
670 Ga0075366_10016138
671 Ga0075366_10041472
672 Ga0075370_10062183
673 Ga0075428_100044085
674 Ga0075428_100240126
675 Ga0075430_100003796
676 Ga0075431_100032907
677 Ga0075434_100048508
678 Ga0075434_100057423
679 Ga0075434_100157200
680 Ga0099824_1015574
681 Ga0075435_100004985
682 Ga0075435_100082229
683 Ga0105240_10003154
684 Ga0105240_10041254
685 Ga0105240_10048260
686 Ga0105240_10095458
687 Ga0105240_10128657
688 Ga0105240_10284321
689 Ga0111539_10429639
690 Ga0105245_10084274
691 Ga0114129_10013109
692 Ga0114129_10026928
693 Ga0105241_10017920
694 Ga0105242_10201974
695 Ga0105237_10004746
696 Ga0105237_10023571
697 Ga0105237_10026849
698 Ga0105237_10093379
699 Ga0105237_10257424
700 Ga0105238_10026979
701 Ga0105238_10068798
702 Ga0099796_10001862
703 Ga0105239_10022111
704 Ga0105239_10051112
705 Ga0105239_10054985
706 Ga0157369_10015551
707 Ga0157369_10054613
708 Ga0157369_10223526
709 Ga0157374_10227884
710 Ga0157374_10319261
711 Ga0157374_10428481
712 Ga0157378_10193048
713 Ga0163162_10249346
714 Ga0157375_10060090
715 Ga0163163_10048710
716 Ga0157376_10192444
717 Ga0214544_1000035
718 Ga0214542_1000181
719 Ga0214545_1000094
720 Ga0214543_1000155
721 Ga0213876_10003396
722 Ga0213876_10016465
723 Ga0209674_100011
724 Ga0209672_100002
725 Ga0209147_100003
726 Ga0207427_102041
727 Ga0209258_100005
728 Ga0209677_100588
729 Ga0209148_1000006
730 Ga0209148_1000306
731 Ga0209759_1000006
732 Ga0209233_1000018
733 Ga0209233_1008238
734 Ga0209565_1004117
735 Ga0209455_1000003
736 Ga0209675_1001048
737 Ga0209025_1002751
738 Ga0209564_1012603
739 Ga0209758_1002505
740 Ga0209758_1007560
741 Ga0209256_1000086
742 Ga0207426_1001686
743 Ga0207426_1002545
744 Ga0207426_1027393
745 Ga0209051_1004115
746 Ga0209257_1010845
747 Ga0207710_10022858
748 Ga0207647_10006441
749 Ga0207685_10004855
750 Ga0207699_10001797
751 Ga0207684_10199170
752 Ga0207707_10003051
753 Ga0207707_10082041
754 Ga0207695_10000136
755 Ga0207695_10010587
756 Ga0207695_10049312
757 Ga0207695_10111059
758 Ga0207671_10001211
759 Ga0207671_10003193
760 Ga0207693_10015879
761 Ga0207693_10037338
762 Ga0207663_10004539
763 Ga0207663_10034354
764 Ga0207663_10077906
765 Ga0207652_10031613
766 Ga0207652_10090994
767 Ga0207687_10268055
768 Ga0207700_10044558
769 Ga0207664_10012276
770 Ga0207664_10021449
771 Ga0207664_10030192
772 Ga0207644_10044694
773 Ga0207706_10118493
774 Ga0207704_10256517
775 Ga0207665_10022501
776 Ga0207665_10050654
777 Ga0207661_10027104
778 Ga0207667_10067950
779 Ga0207667_10246372
780 Ga0207651_10174647
781 Ga0207668_10157164
782 Ga0207640_10141426
783 Ga0207703_10171852
784 Ga0207678_10049949
785 Ga0207708_10043127
786 Ga0207674_10235975
787 Ga0207675_100070651
788 Ga0207698_10180345
789 Ga0209389_1001196
790 Ga0209589_1000014
791 Ga0209489_100014
792 Ga0209489_106825
793 Ga0209700_100024
794 Ga0209700_104961
795 Ga0265332_10011597
796 Ga0265329_10021830
797 Ga0265339_10013976
798 Ga0265339_10033726
799 Ga0265314_10012875
800 Ga0265342_10000178
801 Ga0265342_10007344
802 Ga0307510_10037179
803 Ga0373926_0059932
804 Ga0373956_0048460
805 Ga0373946_0019980
806 Ga0373924_0006791
807 Ga0373925_0255808
808 Ga0395900_0017532
809 Ga0395900_0126628
810 Ga0395900_0300773
811 Ga0436364_0530572
812 Ga0395901_0084484
813 Ga0436365_1172571
814 Ga0436360_0675095
815 Ga0436360_0783709
816 Ga0436362_0079543
817 Ga0436362_0179984
818 Ga0466972_0001618
819 Ga0466963_0029236
820 Ga0466957_0038682
821 Ga0466960_0010051
822 Ga0466960_0020485
823 Ga0466959_0130879
824 Ga0466967_0100975
825 Ga0495592_0082176
826 Ga0495603_0001725
827 Ga0495603_0129835
828 Ga0495590_0004167
829 Ga0495629_0000037
830 Ga0495629_0005693
831 Ga0495629_0013777
832 Ga0495629_0083326
833 Ga0495638_0016554
834 Ga0495651_0030798
835 Ga0495653_0000048
836 Ga0495650_0000512
837 Ga0495650_0006780
838 Ga0495580_0000783
839 Ga0495580_0085174
840 Ga0495582_0007936
841 Ga0495582_0010289
842 Ga0495582_0010715
843 Ga0495605_0020473
844 Ga0495605_0062716
845 Ga0495664_0007134
846 Ga0495664_0007508
847 Ga0495664_0033088
848 Ga0495584_0088517
849 Ga0495583_0002063
850 Ga0495606_0005064
851 Ga0495606_0033520
852 Ga0495606_0039260
853 Ga0495606_0076609
854 Ga0495608_0032073
855 Ga0495608_0106875
856 Ga0495610_0086397
857 Ga0495618_0036523
858 Ga0495618_0108664
859 Ga0495620_0022460
860 Ga0495648_0009868
861 Ga0495666_0009105
862 Ga0495642_0001510
863 Ga0495652_0012560
864 Ga0495652_0031270
865 Ga0495652_0070459
866 Ga0495640_0021996
867 Ga0495640_0048015
868 Ga0495586_0008547
869 Ga0495586_0015664
870 Ga0495587_0016650
871 Ga0495645_0000597
872 Ga0495645_0009546
873 Ga0495645_0057564
874 Ga0495645_0081721
875 Ga0495667_0006245
876 Ga0495667_0012788
877 Ga0495667_0064344
878 Ga0495668_0035563
879 Ga0495634_0065737
880 Ga0495634_0073094
881 Ga0495635_0001740
882 Ga0495588_0001796
883 Ga0495588_0100963
884 Ga0495657_0021783
885 Ga0495657_0025361
886 Ga0495657_0041792
887 Ga0495599_0021661
888 Ga0495623_0007621
889 Ga0495646_0002049
890 Ga0495646_0010703
891 Ga0495646_0084038
892 Ga0495613_0011301
893 Ga0495613_0039158
894 Ga0495613_0041214
895 Ga0495624_0029348
896 Ga0495671_0036953
897 Ga0495649_0003175
898 Ga0495649_0006790
899 Ga0495589_0006712
900 Ga0495600_0019537
901 Ga0495600_0058750
902 Ga0495660_0068379
903 Ga0495581_0001404
904 Ga0495581_0003102
905 Ga0495604_0009576
906 Ga0495604_0011467
907 Ga0495604_0161352
908 Ga0495674_0009842
909 Ga0495674_0027392
910 Ga0495674_0027552
911 Ga0495674_0085784
912 Ga0495674_0096047
913 Ga0495676_0129521
914 Ga0495680_0014808
915 Ga0495680_0061333
916 Ga0495683_0000197
917 Ga0495683_0038576
918 Ga0495683_0073874
919 Ga0495687_004082
920 Ga0495687_007230
921 Ga0495687_024114
922 Ga0495687_024759
923 Ga0495675_0005919
924 Ga0495675_0045070
925 Ga0495679_000038
926 Ga0495593_0023011
927 Ga0495602_0026762
928 Ga0495614_0023033
929 Ga0495614_0065866
930 Ga0495626_0003914
931 Ga0495626_0017422
932 Ga0496101_0049302
933 Ga0496101_0051462
934 Ga0496102_0151037
935 Ga0496102_0184626
936 Ga0496104_0019958
937 Ga0496104_0021829
938 Ga0496104_0112691
939 Ga0496105_0007387
940 Ga0496105_0102966
941 Ga0496106_0104953
942 Ga0496106_0198701
943 Ga0496107_0073308
944 Ga0496108_0039107
945 Ga0496109_0164211
946 Ga0496114_0001094
947 Ga0496115_0014550
948 Ga0496115_0056934
949 Ga0496115_0069947
950 Ga0496115_0089801
951 Ga0496116_0017551
952 Ga0496117_0139394
953 Ga0496118_0029510
954 Ga0496118_0035180
955 Ga0496119_0013986
956 Ga0496119_0030037
957 Ga0496119_0080406
958 Ga0496120_0014026
959 Ga0496121_0024272
960 Ga0496121_0034755
961 Ga0496121_0040301
962 Ga0496121_0119412
963 Ga0496121_0131741
964 Ga0496122_0087522
965 Ga0496123_0085520
966 Ga0496124_0034938
967 Ga0496125_0028927
968 Ga0496125_0047706
969 Ga0496126_0030874
970 Ga0496126_0183506
971 Ga0496126_0243775
972 Ga0495678_002987
973 Ga0495682_0005292
974 Ga0501033_0046021
975 Ga0501034_0029547
976 Ga0501034_0106711
977 Ga0501034_0382113
978 Ga0501043_0030167
979 Ga0501046_0054594
980 Ga0501047_0041042
981 Ga0501047_0084460
982 Ga0501070_0000277
983 Ga0501070_0082953
984 Ga0501074_0051590
985 Ga0501035_0024447
986 Ga0501035_0026609
987 Ga0501035_0035230
988 Ga0501044_0000076
989 Ga0501044_0023896
990 Ga0501044_0088534
991 nmdc:mga0yw44_10871_c1
992 nmdc:mga0yw44_62262_c1
993 nmdc:mga0k408_110453_c1
994 nmdc:mga06z11_66582_c1
995 nmdc:mga07m45_85110_c1
996 nmdc:mga05p37_93549_c1
997 nmdc:mga0qj67_122813_c1
998 nmdc:mga08y16_54574_c1
999 nmdc:mga0n895_16612_c1
1000 nmdc:mga0n895_291270_c1
1001 nmdc:mga0n895_47091_c1
1002 nmdc:mga0rr50_152972_c1
1003 nmdc:mga0rr50_47654_c1
1004 nmdc:mga0sz30_21904_c1
1005 nmdc:mga0sz30_42910_c1
1006 Ga0495612_0010694
1007 Ga0495612_0026646
1008 Ga0500635_0016363
1009 Ga0500578_0048699
1010 Ga0500578_0126581
1011 Ga0500643_001638
1012 Ga0500566_0005639
1013 Ga0500556_0045249
1014 Ga0500557_000206
1015 Ga0500562_014286
1016 Ga0500572_006661
1017 Ga0500642_0057992
1018 Ga0500616_0008487
1019 Ga0500616_0050983
1020 Ga0500620_007895
1021 Ga0500636_0000460
1022 Ga0500552_000211
1023 Ga0501082_0063645
1024 2507506772
1025 2508540786
1026 2509149594
1027 2513628915
1028 2513651821
1029 2513653942
1030 2513677973
1031 2513704732
1032 2513723531
1033 2513856376
1034 2513877321
1035 2513892726
1036 2513918282
1037 2514012999
1038 2515629597
1039 2517107909
1040 2517891488
1041 2524439295
1042 2524468333
1043 2524540999
1044 2528852139
1045 2617348297
1046 2617377428
1047 2671118743
1048 2745082664
1049 2793066856
1050 2805919028
1051 2818241986
1052 2824604915
1053 2824615254
1054 2824625585
1055 2824634585
1056 2824642339
1057 2824651503
1058 2824660716
1059 2824669476
1060 2824678399
1061 2824687645
1062 2824694843
1063 2824713784
1064 2824722416
1065 2824731476
1066 2824740583
1067 2824753348
1068 2824760803
1069 2824771415
1070 2824781142
1071 2841947666
1072 2841963173
1073 2842044723
1074 2842053090
1075 2844320901
1076 2847938383
1077 2847940293
1078 2849077505
1079 2857510738
1080 2874591826
1081 2874618781
1082 2874630860
1083 2874646284
1084 2876762053
1085 2876772097
1086 2876819370
1087 2879078793
1088 2879086031
1089 2879106179
1090 2881364258
1091 2885367595
1092 2885377807
1093 2885384649
1094 2888386264
1095 2888426407
1096 2903728028
1097 2903758730
1098 2903773447
1099 2904486665
1100 2904691344
1101 2904713314
1102 2906609053
1103 2906616664
1104 2906627286
1105 2906643720
1106 2906649272
1107 2906666991
1108 2908741830
1109 2908759524
1110 2908782530
1111 2919527996
1112 2922376888
1113 2922399627
1114 2922431311
1115 2929621532
1116 2929631653
1117 2932790155
1118 2932798769
1119 2932809291
1120 2932815938
1121 2932824826
1122 2932833385
1123 2933583443
1124 2935615945
1125 2935621340
1126 2935633905
1127 2935644690
1128 2935672294
1129 2935682733
1130 2935693362
1131 2935702248
1132 2935710833
1133 2935720849
1134 2935730664
1135 2935740571
1136 2935749955
1137 2935759225
1138 2935767323
1139 2935772335
1140 2935783873
1141 2935787786
1142 2935793657
1143 2935808783
1144 2935817580
1145 2935826892
1146 2935833940
1147 2935845569
1148 2935854072
1149 2935859467
1150 2935869890
1151 2935880852
1152 2935889364
1153 2935916810
1154 2935923272
1155 2935934318
1156 2935942801
1157 2935951242
1158 2935959682
1159 2935964687
1160 2935975771
1161 2935981453
1162 2935998373
1163 2936009275
1164 2936044519
1165 2940565249
1166 2941510792
1167 2941518176
1168 2941526953
1169 2941542827
1170 3005481107
1171 3005488988
1172 3005507783
1173 3005593981
1174 3005601185
1175 3005723929
1176 8006929392
1177 8006939604
1178 8006979355
1179 8016519713
1180 8016527738
1181 8016532839
1182 8016546073
1183 8016556045
1184 8016564405
1185 8016571149
1186 8016583645
1187 8016584045
1188 8016602078
1189 8016608048
1190 8016616829
1191 8016624426
1192 8017065820
1193 8019532643
1194 8019547207
1195 8019551448
1196 8019565495
1197 8019575591
1198 8019585255
1199 8019593229
1200 8019610142
1201 8019620825
1202 8019632369
1203 8019655127
1204 8019692536
1205 8055267540
1206 8055304676
1207 8055744265
1208 8056681396
1209 8056693839
1210 8056973471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

74

385

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nwz-assembly1.cif.gz_A structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution 0.8856 1 378
5kmq-assembly1.cif.gz_B the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.8728 1 394
5kmq-assembly2.cif.gz_C the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.8687 1 378
5kmq-assembly1.cif.gz_B the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.8686 1 394
5kmp-assembly1.cif.gz_A the structure of g164e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.8644 1 378
ID Description Score Start End Superfamily
af_P9WJJ1_1_384_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9639 1 389 3.50.50.100
af_P9WJJ1_1_384_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9615 1 389 3.50.50.100
3d3rB00 Mainly Beta;Roll;SH3 type barrels.; 0.9597 76 100 2.30.30.140
af_P00393_5_413_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.8724 1 396 3.50.50.100
af_I1KF65_1_317_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.8561 30 298 3.50.50.100
ID Description Score Start End GO Terms
AF-A0A655JPU0-F1-model_v4 Dehydrogenase (EC 1.-.-.-) 0.9663 304 405 GO:0016491
AF-A0A388RQG8-F1-model_v4 deleted 0.9637 240 409
AF-A0A810B9C9-F1-model_v4 Uncharacterized protein 0.963 262 399
AF-A0A3N1W8K6-F1-model_v4 NADH dehydrogenase 0.9594 2 402 GO:0003955
GO:0019646
AF-A0A6I6DWI0-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9591 2 402 GO:0003955
GO:0019646

Map