F468467

General Info

Members Datasets Scaffolds Average Seq Length
605 266 605 233

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10416626|Ga0105243_104166262
Length 249
Sequence LDEACGNPFWGTLATMATTLTWLGHAAFRIDTPAGTRIYVDPFLEGNPSCPDGEQSPERCDLVVLTHGHDDHVGDTLALAGRFSCPVVAQVELRGWLSTKGLDEDMSQSPNKGGTIRVGDVRITLTDANHSTSAFENGTFTYLGEPCGLVLRPDGGPSIYIAGDTNVFGDMALIRRLYAPDVAVLPIGDHFTMGPEEAAVAAELVGAPRVVPSHYGTFGLLTGTPDALRELLPDGVELVAPAPGETVEL

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 6.45
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c009932 3300000044 Bacteria 794
2 JGI24739J22299_10035832 3300001989 Bacteria 1679
3 JGI24743J22301_10005203 3300001991 Bacteria 2163
4 JGI24738J21930_10005569 3300002075 Bacteria 3004
5 JGI25406J46586_10040463 3300003203 Bacteria 1652
6 Ga0070658_10119662 3300005327 Bacteria 2188
7 Ga0070683_100031599 3300005329 Bacteria 4816
8 Ga0070683_100044042 3300005329 Bacteria 4114
9 Ga0070683_100045947 3300005329 Bacteria 4032
10 Ga0070683_100133958 3300005329 Bacteria 2346
11 Ga0070683_100225107 3300005329 Bacteria 1782
12 Ga0070683_100752793 3300005329 Bacteria 933
13 Ga0070670_100098812 3300005331 Bacteria 2512
14 Ga0070670_100293172 3300005331 Bacteria 1422
15 Ga0070670_100683416 3300005331 Archaea 922
16 Ga0068869_100144702 3300005334 Bacteria 1839
17 Ga0068869_100977688 3300005334 Unclassified 736
18 Ga0070680_100006280 3300005336 Bacteria 9019
19 Ga0070680_100062689 3300005336 Bacteria 3044
20 Ga0070682_100030833 3300005337 Bacteria 3240
21 Ga0070682_100059146 3300005337 Bacteria 2419
22 Ga0070682_100095936 3300005337 Bacteria 1948
23 Ga0070682_100454119 3300005337 Bacteria 982
24 Ga0070682_100455509 3300005337 Archaea 981
25 Ga0068868_100157542 3300005338 Bacteria 1873
26 Ga0068868_100281276 3300005338 Bacteria 1408
27 Ga0070660_100135498 3300005339 Bacteria 1973
28 Ga0070689_100334267 3300005340 Unclassified 1268
29 Ga0070691_10032236 3300005341 Bacteria 2461
30 Ga0070691_10088808 3300005341 Bacteria 1522
31 Ga0070661_100017514 3300005344 Bacteria 5085
32 Ga0070661_100168985 3300005344 Bacteria 1660
33 Ga0070668_100091866 3300005347 Bacteria 2394
34 Ga0070668_100103335 3300005347 Bacteria 2260
35 Ga0070675_100027707 3300005354 Bacteria 4555
36 Ga0070675_100069322 3300005354 Bacteria 2921
37 Ga0070674_100071031 3300005356 Archaea 2461
38 Ga0070674_100138997 3300005356 Bacteria 1821
39 Ga0070673_100005153 3300005364 Bacteria 8337
40 Ga0070673_100007612 3300005364 Bacteria 7166
41 Ga0070659_100009185 3300005366 Bacteria 7254
42 Ga0070659_100010513 3300005366 Bacteria 6810
43 Ga0070659_100031388 3300005366 Bacteria 4114
44 Ga0070659_100064759 3300005366 Bacteria 2893
45 Ga0070659_100376391 3300005366 Bacteria 1195
46 Ga0070667_100298941 3300005367 Unclassified 1449
47 Ga0070701_10006182 3300005438 Bacteria 5020
48 Ga0070701_10019521 3300005438 Bacteria 3202
49 Ga0070701_10121580 3300005438 Bacteria 1472
50 Ga0070705_100001459 3300005440 Bacteria 12501
51 Ga0070705_100120696 3300005440 Bacteria 1692
52 Ga0070700_100057241 3300005441 Bacteria 2446
53 Ga0070700_100417384 3300005441 Bacteria 1013
54 Ga0070694_100330198 3300005444 Bacteria 1176
55 Ga0070694_100512866 3300005444 Bacteria 956
56 Ga0070663_100011865 3300005455 Bacteria 5491
57 Ga0070678_100000052 3300005456 Bacteria 40622
58 Ga0070678_100015082 3300005456 Bacteria 4899
59 Ga0070678_100261374 3300005456 Unclassified 1456
60 Ga0070662_100036282 3300005457 Bacteria 3486
61 Ga0070662_100060621 3300005457 Bacteria 2759
62 Ga0070681_10161743 3300005458 Bacteria 2163
63 Ga0068867_100554733 3300005459 Bacteria 996
64 Ga0070685_10007843 3300005466 Bacteria 5467
65 Ga0070685_10062379 3300005466 Bacteria 2185
66 Ga0070685_10283100 3300005466 Bacteria 1111
67 Ga0070698_100102616 3300005471 Unclassified 2830
68 Ga0070699_100070877 3300005518 Bacteria 3030
69 Ga0070699_100699930 3300005518 Bacteria 926
70 Ga0070679_100063253 3300005530 Bacteria 3689
71 Ga0070679_100071314 3300005530 Bacteria 3465
72 Ga0070679_100142937 3300005530 Unclassified 2371
73 Ga0070679_100208506 3300005530 Bacteria 1918
74 Ga0070679_100351783 3300005530 Bacteria 1421
75 Ga0070684_100009821 3300005535 Bacteria 7557
76 Ga0070684_100030081 3300005535 Bacteria 4611
77 Ga0070684_100105826 3300005535 Bacteria 2518
78 Ga0070684_100147719 3300005535 Bacteria 2128
79 Ga0070684_100173337 3300005535 Bacteria 1960
80 Ga0070684_100213617 3300005535 Bacteria 1758
81 Ga0070684_100399143 3300005535 Bacteria 1267
82 Ga0070697_100162445 3300005536 Bacteria 1887
83 Ga0068853_100012719 3300005539 Bacteria 6851
84 Ga0068853_100067239 3300005539 Bacteria 3113
85 Ga0068853_100088341 3300005539 Bacteria 2721
86 Ga0070672_100103175 3300005543 Bacteria 2316
87 Ga0070672_100158549 3300005543 Bacteria 1876
88 Ga0070686_100001674 3300005544 Bacteria 12387
89 Ga0070686_100146896 3300005544 Unclassified 1647
90 Ga0070686_100232857 3300005544 Bacteria 1337
91 Ga0070696_100152127 3300005546 Unclassified 1699
92 Ga0070696_100580628 3300005546 Bacteria 901
93 Ga0070693_100009212 3300005547 Bacteria 4905
94 Ga0070693_100016326 3300005547 Bacteria 3841
95 Ga0070693_100081932 3300005547 Bacteria 1926
96 Ga0070693_100164333 3300005547 Bacteria 1416
97 Ga0070665_100046359 3300005548 Bacteria 4367
98 Ga0070665_100103425 3300005548 Bacteria 2851
99 Ga0070704_100023046 3300005549 Bacteria 4059
100 Ga0070704_100296643 3300005549 Unclassified 1345
101 Ga0070704_100390061 3300005549 Bacteria 1185
102 Ga0068855_100033474 3300005563 Bacteria 6133
103 Ga0070664_100061110 3300005564 Bacteria 3210
104 Ga0070664_100071615 3300005564 Bacteria 2971
105 Ga0070664_100096048 3300005564 Bacteria 2571
106 Ga0070664_100603663 3300005564 Unclassified 1018
107 Ga0068857_100030114 3300005577 Bacteria 4789
108 Ga0068857_100156668 3300005577 Bacteria 2065
109 Ga0068854_100066826 3300005578 Bacteria 2617
110 Ga0068854_100137398 3300005578 Bacteria 1872
111 Ga0068856_100032298 3300005614 Bacteria 5125
112 Ga0068856_100094815 3300005614 Bacteria 2972
113 Ga0070702_100044763 3300005615 Bacteria 2500
114 Ga0070702_100052912 3300005615 Bacteria 2330
115 Ga0070702_100058184 3300005615 Bacteria 2238
116 Ga0070702_100105698 3300005615 Bacteria 1735
117 Ga0070702_100223072 3300005615 Bacteria 1261
118 Ga0068852_100558112 3300005616 Archaea 1146
119 Ga0068859_100094205 3300005617 Bacteria 3047
120 Ga0068864_100019754 3300005618 Bacteria 5634
121 Ga0068866_10008968 3300005718 Bacteria 4235
122 Ga0068866_10076202 3300005718 Bacteria 1788
123 Ga0068866_10157838 3300005718 Unclassified 1320
124 Ga0068866_10357162 3300005718 Bacteria 930
125 Ga0068861_100028780 3300005719 Bacteria 4056
126 Ga0068851_10009084 3300005834 Bacteria 4613
127 Ga0068870_10016192 3300005840 Bacteria 3556
128 Ga0068870_10059327 3300005840 Bacteria 2051
129 Ga0068863_100110603 3300005841 Bacteria 2616
130 Ga0068858_100047996 3300005842 Bacteria 3958
131 Ga0068858_100206649 3300005842 Bacteria 1858
132 Ga0068858_100230765 3300005842 Unclassified 1755
133 Ga0068860_100027023 3300005843 Bacteria 5530
134 Ga0068860_100446760 3300005843 Bacteria 1285
135 Ga0068862_100131730 3300005844 Bacteria 2212
136 Ga0081455_10013098 3300005937 Bacteria 8220
137 Ga0081455_10026506 3300005937 Bacteria 5327
138 Ga0081455_10411539 3300005937 Unclassified 935
139 Ga0081538_10031464 3300005981 Bacteria 3578
140 Ga0081539_10000200 3300005985 Bacteria 139291
141 Ga0075364_10020761 3300006051 Unclassified 4133
142 Ga0075364_10149290 3300006051 Bacteria 1575
143 Ga0075432_10018362 3300006058 Bacteria 2386
144 Ga0070715_10019378 3300006163 Bacteria 2609
145 Ga0097621_100026124 3300006237 Bacteria 4577
146 Ga0068871_100046109 3300006358 Bacteria 3510
147 Ga0068871_100314221 3300006358 Bacteria 1378
148 Ga0068871_100506477 3300006358 Archaea 1089
149 Ga0075428_100260262 3300006844 Bacteria 1868
150 Ga0075428_100469626 3300006844 Archaea 1347
151 Ga0075431_100713536 3300006847 Bacteria 980
152 Ga0075433_10118193 3300006852 Bacteria 2353
153 Ga0075433_10924960 3300006852 Bacteria 760
154 Ga0068865_100008991 3300006881 Bacteria 6181
155 Ga0068865_100031732 3300006881 Bacteria 3524
156 Ga0097620_100094200 3300006931 Bacteria 3047
157 Ga0105240_10245173 3300009093 Bacteria 2075
158 Ga0111539_10157964 3300009094 Bacteria 2653
159 Ga0111539_10833348 3300009094 Bacteria 1073
160 Ga0105245_10023597 3300009098 Bacteria 5400
161 Ga0105245_10046418 3300009098 Bacteria 3882
162 Ga0105245_10070046 3300009098 Bacteria 3181
163 Ga0105245_10143776 3300009098 Bacteria 2249
164 Ga0105245_10978751 3300009098 Bacteria 890
165 Ga0114129_10038780 3300009147 Bacteria 6716
166 Ga0114129_10131500 3300009147 Unclassified 3436
167 Ga0114129_11421874 3300009147 Bacteria 855
168 Ga0114129_11518467 3300009147 Unclassified 822
169 Ga0105243_10007909 3300009148 Bacteria 8165
170 Ga0105243_10009015 3300009148 Bacteria 7623
171 Ga0105243_10023935 3300009148 Bacteria 4654
172 Ga0105243_10097084 3300009148 Bacteria 2439
173 Ga0105243_10164351 3300009148 Bacteria 1917
174 Ga0105243_10416626 3300009148 Archaea 1251
175 Ga0105241_10100207 3300009174 Bacteria 2302
176 Ga0105241_10159922 3300009174 Bacteria 1851
177 Ga0105242_10009065 3300009176 Bacteria 7645
178 Ga0105242_10040774 3300009176 Bacteria 3742
179 Ga0105242_10557308 3300009176 Bacteria 1100
180 Ga0105242_11187675 3300009176 Archaea 781
181 Ga0105248_10015219 3300009177 Bacteria 8476
182 Ga0105248_10024950 3300009177 Bacteria 6645
183 Ga0105248_10045330 3300009177 Bacteria 4932
184 Ga0105248_11043442 3300009177 Bacteria 924
185 Ga0105237_10390820 3300009545 Unclassified 1396
186 Ga0105238_10160285 3300009551 Bacteria 2225
187 Ga0105238_10252584 3300009551 Unclassified 1742
188 Ga0105249_10085675 3300009553 Bacteria 2937
189 Ga0105249_10641698 3300009553 Bacteria 1119
190 Ga0105249_10687761 3300009553 Unclassified 1082
191 Ga0105239_10031030 3300010375 Bacteria 5879
192 Ga0105239_10250057 3300010375 Bacteria 1991
193 Ga0105246_10008656 3300011119 Bacteria 6257
194 Ga0105246_10111951 3300011119 Bacteria 2007
195 Ga0157371_10029676 3300013102 Bacteria 3952
196 Ga0157371_10137294 3300013102 Bacteria 1741
197 Ga0157369_10013890 3300013105 Bacteria 9097
198 Ga0157369_10102394 3300013105 Bacteria 3052
199 Ga0157378_10001752 3300013297 Bacteria 19468
200 Ga0163162_10259427 3300013306 Bacteria 1870
201 Ga0157372_10049404 3300013307 Bacteria 4677
202 Ga0157372_10124270 3300013307 Bacteria 2966
203 Ga0157372_10287824 3300013307 Bacteria 1911
204 Ga0157375_10064949 3300013308 Bacteria 3636
205 Ga0157375_10072916 3300013308 Bacteria 3451
206 Ga0157375_10080233 3300013308 Bacteria 3300
207 Ga0157375_10654906 3300013308 Bacteria 1206
208 Ga0163163_10245031 3300014325 Archaea 1842
209 Ga0157380_10000820 3300014326 Bacteria 19481
210 Ga0157380_10573076 3300014326 Archaea 1112
211 Ga0182008_10197189 3300014497 Bacteria 1023
212 Ga0157377_10005680 3300014745 Bacteria 5879
213 Ga0157377_10009457 3300014745 Bacteria 4782
214 Ga0157377_10015087 3300014745 Bacteria 3943
215 Ga0157377_10111314 3300014745 Bacteria 1646
216 Ga0157377_10406336 3300014745 Unclassified 929
217 Ga0157379_10009631 3300014968 Bacteria 8410
218 Ga0157379_10059591 3300014968 Bacteria 3413
219 Ga0157379_10094192 3300014968 Bacteria 2687
220 Ga0157376_10014368 3300014969 Bacteria 5941
221 Ga0157376_10036180 3300014969 Bacteria 3998
222 Ga0157376_10211245 3300014969 Bacteria 1792
223 Ga0163161_10053935 3300017792 Bacteria 2916
224 Ga0206351_10482556 3300020077 Bacteria 868
225 Ga0206350_11107442 3300020080 Bacteria 889
226 Ga0206354_11183149 3300020081 Bacteria 1559
227 Ga0206353_10994781 3300020082 Bacteria 956
228 Ga0206353_11119996 3300020082 Bacteria 6428
229 Ga0207653_10066552 3300025885 Bacteria 1224
230 Ga0207642_10005610 3300025899 Bacteria 4108
231 Ga0207688_10001403 3300025901 Bacteria 12559
232 Ga0207688_10006162 3300025901 Bacteria 6527
233 Ga0207688_10194107 3300025901 Bacteria 1215
234 Ga0207680_10288812 3300025903 Unclassified 1141
235 Ga0207647_10199761 3300025904 Bacteria 1157
236 Ga0207685_10280871 3300025905 Bacteria 817
237 Ga0207645_10023350 3300025907 Unclassified 4020
238 Ga0207643_10033044 3300025908 Bacteria 2894
239 Ga0207643_10114507 3300025908 Bacteria 1591
240 Ga0207705_10065729 3300025909 Bacteria 2622
241 Ga0207707_10238996 3300025912 Unclassified 1579
242 Ga0207707_10253793 3300025912 Bacteria 1527
243 Ga0207695_10056425 3300025913 Bacteria 4086
244 Ga0207660_10049258 3300025917 Bacteria 2985
245 Ga0207662_10067432 3300025918 Bacteria 2158
246 Ga0207662_10107962 3300025918 Bacteria 1732
247 Ga0207657_10001010 3300025919 Bacteria 29952
248 Ga0207657_10059901 3300025919 Bacteria 3269
249 Ga0207657_10186079 3300025919 Bacteria 1677
250 Ga0207657_10265952 3300025919 Unclassified 1364
251 Ga0207649_10034246 3300025920 Bacteria 3041
252 Ga0207649_10035028 3300025920 Bacteria 3013
253 Ga0207649_10166286 3300025920 Bacteria 1532
254 Ga0207652_10064630 3300025921 Bacteria 3166
255 Ga0207694_10155637 3300025924 Bacteria 1843
256 Ga0207694_10297908 3300025924 Bacteria 1327
257 Ga0207650_10096434 3300025925 Unclassified 2269
258 Ga0207650_10112424 3300025925 Bacteria 2110
259 Ga0207687_10008752 3300025927 Bacteria 6614
260 Ga0207687_10102095 3300025927 Bacteria 2112
261 Ga0207687_10136027 3300025927 Bacteria 1859
262 Ga0207690_10069688 3300025932 Bacteria 2420
263 Ga0207706_10023980 3300025933 Bacteria 5474
264 Ga0207706_10033910 3300025933 Bacteria 4544
265 Ga0207706_10039259 3300025933 Bacteria 4196
266 Ga0207706_10051168 3300025933 Bacteria 3649
267 Ga0207686_10074483 3300025934 Bacteria 2194
268 Ga0207686_10159028 3300025934 Bacteria 1581
269 Ga0207686_10178591 3300025934 Bacteria 1503
270 Ga0207686_10247646 3300025934 Bacteria 1300
271 Ga0207686_10316933 3300025934 Unclassified 1164
272 Ga0207709_10022156 3300025935 Bacteria 3601
273 Ga0207709_10022551 3300025935 Bacteria 3572
274 Ga0207709_10023219 3300025935 Bacteria 3528
275 Ga0207709_10083159 3300025935 Bacteria 2069
276 Ga0207709_10274812 3300025935 Bacteria 1242
277 Ga0207669_10019183 3300025937 Bacteria 3554
278 Ga0207669_10198467 3300025937 Bacteria 1454
279 Ga0207704_10029907 3300025938 Bacteria 3046
280 Ga0207704_10710805 3300025938 Bacteria 833
281 Ga0207665_10391597 3300025939 Bacteria 1056
282 Ga0207691_10010456 3300025940 Bacteria 8903
283 Ga0207691_10026609 3300025940 Bacteria 5428
284 Ga0207691_10096134 3300025940 Bacteria 2649
285 Ga0207691_10513083 3300025940 Bacteria 1018
286 Ga0207711_10023268 3300025941 Bacteria 5185
287 Ga0207711_10123290 3300025941 Bacteria 2316
288 Ga0207711_10222058 3300025941 Bacteria 1728
289 Ga0207711_10409906 3300025941 Unclassified 1260
290 Ga0207711_10543187 3300025941 Archaea 1084
291 Ga0207689_10047479 3300025942 Bacteria 3544
292 Ga0207661_10002116 3300025944 Bacteria 13667
293 Ga0207661_10102126 3300025944 Bacteria 2410
294 Ga0207661_10117674 3300025944 Bacteria 2258
295 Ga0207661_10123419 3300025944 Bacteria 2209
296 Ga0207661_10259337 3300025944 Bacteria 1548
297 Ga0207661_10391893 3300025944 Bacteria 1258
298 Ga0207679_10135944 3300025945 Bacteria 1979
299 Ga0207679_10240673 3300025945 Bacteria 1533
300 Ga0207679_10303011 3300025945 Bacteria 1378
301 Ga0207679_10356303 3300025945 Unclassified 1277
302 Ga0207667_10285817 3300025949 Unclassified 1685
303 Ga0207667_10649629 3300025949 Bacteria 1060
304 Ga0207651_10042627 3300025960 Bacteria 3022
305 Ga0207712_10049006 3300025961 Bacteria 2941
306 Ga0207712_10336470 3300025961 Bacteria 1250
307 Ga0207668_10082938 3300025972 Bacteria 2331
308 Ga0207640_10076045 3300025981 Bacteria 2278
309 Ga0207658_10059380 3300025986 Bacteria 2850
310 Ga0207677_10233022 3300026023 Bacteria 1484
311 Ga0207677_10438266 3300026023 Bacteria 1117
312 Ga0207677_10571710 3300026023 Bacteria 988
313 Ga0207703_10108622 3300026035 Bacteria 2363
314 Ga0207703_10742213 3300026035 Archaea 935
315 Ga0207639_10066505 3300026041 Bacteria 2802
316 Ga0207639_10070000 3300026041 Bacteria 2739
317 Ga0207639_10204830 3300026041 Bacteria 1694
318 Ga0207639_10568360 3300026041 Archaea 1043
319 Ga0207678_10025385 3300026067 Bacteria 5173
320 Ga0207678_10482932 3300026067 Bacteria 1079
321 Ga0207708_10026938 3300026075 Bacteria 4353
322 Ga0207708_10029313 3300026075 Bacteria 4171
323 Ga0207708_10210356 3300026075 Unclassified 1555
324 Ga0207708_10405516 3300026075 Bacteria 1128
325 Ga0207702_10094097 3300026078 Bacteria 2630
326 Ga0207702_10115772 3300026078 Bacteria 2391
327 Ga0207641_10324022 3300026088 Unclassified 1462
328 Ga0207648_10023616 3300026089 Bacteria 5505
329 Ga0207648_10043885 3300026089 Bacteria 3924
330 Ga0207648_10082064 3300026089 Bacteria 2811
331 Ga0207648_10194353 3300026089 Bacteria 1799
332 Ga0207648_10523448 3300026089 Bacteria 1087
333 Ga0207648_10592160 3300026089 Archaea 1021
334 Ga0207674_10017040 3300026116 Bacteria 7931
335 Ga0207674_10027394 3300026116 Bacteria 6028
336 Ga0207674_10248810 3300026116 Bacteria 1724
337 Ga0207674_10332750 3300026116 Bacteria 1468
338 Ga0207674_10653180 3300026116 Unclassified 1016
339 Ga0207675_100014934 3300026118 Bacteria 7249
340 Ga0207675_100129978 3300026118 Bacteria 2388
341 Ga0207683_10000088 3300026121 Bacteria 72940
342 Ga0207683_10003610 3300026121 Bacteria 13485
343 Ga0207683_10016673 3300026121 Bacteria 6252
344 Ga0207683_10205089 3300026121 Bacteria 1793
345 Ga0207683_10346410 3300026121 Bacteria 1363
346 Ga0207698_10073734 3300026142 Bacteria 2719
347 Ga0207698_10559089 3300026142 Bacteria 1123
348 Ga0207698_10629085 3300026142 Archaea 1061
349 Ga0207428_10000244 3300027907 Bacteria 74209
350 Ga0207428_10050859 3300027907 Bacteria 3313
351 Ga0207428_10149851 3300027907 Bacteria 1776
352 Ga0268266_10067580 3300028379 Bacteria 3094
353 Ga0268265_10132980 3300028380 Bacteria 2071
354 Ga0268265_10615168 3300028380 Bacteria 1040
355 Ga0268264_10104619 3300028381 Bacteria 2467
356 Ga0265319_1015620 3300028563 Bacteria 2938
357 Ga0265318_10008787 3300028577 Bacteria 4474
358 Ga0265338_10070748 3300028800 Bacteria 2989
359 Ga0265320_10014826 3300031240 Bacteria 4421
360 Ga0265320_10070740 3300031240 Bacteria 1645
361 Ga0265320_10100366 3300031240 Bacteria 1333
362 Ga0265340_10076615 3300031247 Bacteria 1579
363 Ga0307408_100223764 3300031548 Unclassified 1537
364 Ga0265313_10107135 3300031595 Unclassified 1233
365 Ga0307405_10388174 3300031731 Bacteria 1089
366 Ga0307410_10543068 3300031852 Bacteria 962
367 Ga0307406_10818474 3300031901 Bacteria 787
368 Ga0307407_10095402 3300031903 Bacteria 1834
369 Ga0307409_100060552 3300031995 Bacteria 2953
370 Ga0373938_0035511 3300034957 Bacteria 1087
371 Ga0373954_0053157 3300035118 Bacteria 1904
372 Ga0373960_0002607 3300035121 Bacteria 4073
373 Ga0373931_0101830 3300035691 Bacteria 1616
374 Ga0373925_0187262 3300037068 Bacteria 1641
375 Ga0395900_0219544 3300037418 Unclassified 1917
376 Ga0395898_0406647 3300037466 Bacteria 1298
377 Ga0395901_0454210 3300038443 Bacteria 1310
378 Ga0395901_0790099 3300038443 Unclassified 939
379 Ga0451807_1742402 3300041486 Bacteria 1223
380 Ga0439445_0062318 3300042004 Bacteria 1022
381 Ga0439448_0113386 3300042005 Bacteria 927
382 Ga0439432_104426 3300042006 Bacteria 846
383 Ga0439449_0079620 3300042007 Bacteria 1208
384 Ga0439462_0007795 3300042015 Bacteria 2687
385 Ga0450914_000276 3300042118 Bacteria 2128
386 Ga0450906_012059 3300042145 Bacteria 1606
387 Ga0439446_0001483 3300042156 Bacteria 5361
388 Ga0439459_0020854 3300042438 Bacteria 1254
389 Ga0466966_0013574 3300044684 Bacteria 5391
390 Ga0466961_0040354 3300044693 Bacteria 2993
391 Ga0466961_0218860 3300044693 Bacteria 1174
392 Ga0466963_0108183 3300044694 Bacteria 1907
393 Ga0466963_0256828 3300044694 Unclassified 1227
394 Ga0466957_0396843 3300044842 Bacteria 943
395 Ga0466959_0040893 3300045049 Bacteria 3424
396 Ga0466967_0256603 3300045976 Bacteria 1672
397 Ga0466967_0440093 3300045976 Bacteria 1273
398 Ga0495603_0006748 3300046455 Bacteria 6889
399 Ga0495603_0030234 3300046455 Bacteria 3263
400 Ga0495603_0086270 3300046455 Bacteria 1837
401 Ga0495641_0090870 3300046461 Bacteria 1364
402 Ga0495582_0122111 3300046473 Unclassified 1468
403 Ga0495596_0144180 3300046500 Unclassified 925
404 Ga0495637_0093037 3300046520 Bacteria 1187
405 Ga0495644_0091114 3300046523 Unclassified 1151
406 Ga0495656_0013806 3300046615 Bacteria 3014
407 Ga0495634_0188294 3300046642 Bacteria 1289
408 Ga0495659_0175426 3300046664 Unclassified 871
409 Ga0495658_0157095 3300046683 Bacteria 1400
410 Ga0495604_0315596 3300047317 Bacteria 1046
411 Ga0495602_0523589 3300048088 Bacteria 825
412 Ga0496100_0083321 3300048903 Bacteria 2165
413 Ga0496101_0001935 3300048904 Bacteria 12535
414 Ga0496101_0116460 3300048904 Bacteria 2016
415 Ga0496102_0262912 3300048905 Unclassified 1627
416 Ga0496102_0309936 3300048905 Bacteria 1487
417 Ga0496103_0016856 3300048906 Bacteria 4363
418 Ga0496104_0075582 3300048907 Bacteria 3208
419 Ga0496105_0001655 3300048908 Bacteria 15880
420 Ga0496105_0110301 3300048908 Bacteria 2271
421 Ga0496105_0465631 3300048908 Unclassified 996
422 Ga0496106_0067900 3300048909 Bacteria 2719
423 Ga0496106_0236419 3300048909 Archaea 1460
424 Ga0496107_0011271 3300048910 Bacteria 6221
425 Ga0496107_0241251 3300048910 Archaea 1345
426 Ga0496108_0009092 3300048911 Bacteria 8046
427 Ga0496108_0024449 3300048911 Bacteria 4973
428 Ga0496108_0063926 3300048911 Bacteria 3099
429 Ga0496108_0213713 3300048911 Bacteria 1674
430 Ga0496109_0008352 3300048912 Bacteria 8797
431 Ga0496109_0128506 3300048912 Bacteria 2364
432 Ga0496109_0293917 3300048912 Bacteria 1532
433 Ga0496110_0013159 3300048913 Bacteria 6831
434 Ga0496110_0060184 3300048913 Bacteria 3349
435 Ga0496110_0074971 3300048913 Bacteria 3006
436 Ga0496110_0084249 3300048913 Bacteria 2837
437 Ga0496111_0002857 3300048914 Bacteria 10543
438 Ga0496111_0023990 3300048914 Bacteria 4288
439 Ga0496111_0122453 3300048914 Unclassified 1921
440 Ga0496112_0020518 3300048915 Bacteria 6265
441 Ga0496112_0414650 3300048915 Archaea 1286
442 Ga0496112_0900082 3300048915 Bacteria 807
443 Ga0496113_0053237 3300048916 Bacteria 3026
444 Ga0496114_0035638 3300048917 Bacteria 4109
445 Ga0496114_0079772 3300048917 Bacteria 2764
446 Ga0496114_0087087 3300048917 Bacteria 2648
447 Ga0496114_0138237 3300048917 Bacteria 2107
448 Ga0496114_0411360 3300048917 Bacteria 1198
449 Ga0496114_0418944 3300048917 Bacteria 1186
450 Ga0501031_0015535 3300049568 Bacteria 4942
451 Ga0501031_0026848 3300049568 Bacteria 3753
452 Ga0501031_0052869 3300049568 Bacteria 2646
453 Ga0501032_0031634 3300049569 Bacteria 3627
454 Ga0501032_0063572 3300049569 Bacteria 2471
455 Ga0501032_0180072 3300049569 Bacteria 1384
456 Ga0501033_0022921 3300049570 Bacteria 4707
457 Ga0501033_0050721 3300049570 Bacteria 3077
458 Ga0501033_0152906 3300049570 Bacteria 1664
459 Ga0501034_0068007 3300049571 Bacteria 3574
460 Ga0501034_0186625 3300049571 Bacteria 2037
461 Ga0501036_0002878 3300049572 Bacteria 13648
462 Ga0501036_0007924 3300049572 Bacteria 8692
463 Ga0501036_0024789 3300049572 Bacteria 5058
464 Ga0501036_0176644 3300049572 Bacteria 1798
465 Ga0501037_0071846 3300049573 Bacteria 2517
466 Ga0501037_0141275 3300049573 Bacteria 1723
467 Ga0501038_0022126 3300049574 Bacteria 5699
468 Ga0501038_0037681 3300049574 Bacteria 4238
469 Ga0501038_0099779 3300049574 Bacteria 2420
470 Ga0501038_0271444 3300049574 Bacteria 1337
471 Ga0501039_0003065 3300049575 Bacteria 12496
472 Ga0501039_0008700 3300049575 Bacteria 7728
473 Ga0501039_0011656 3300049575 Bacteria 6695
474 Ga0501039_0052617 3300049575 Bacteria 3150
475 Ga0501039_0077813 3300049575 Bacteria 2579
476 Ga0501039_0165130 3300049575 Bacteria 1741
477 Ga0501039_0173222 3300049575 Archaea 1697
478 Ga0501040_0006377 3300049576 Bacteria 7656
479 Ga0501040_0015305 3300049576 Bacteria 5071
480 Ga0501040_0510060 3300049576 Bacteria 867
481 Ga0501041_0009685 3300049577 Bacteria 5678
482 Ga0501041_0014045 3300049577 Bacteria 4753
483 Ga0501041_0032310 3300049577 Bacteria 3163
484 Ga0501041_0073589 3300049577 Bacteria 2099
485 Ga0501041_0196945 3300049577 Bacteria 1262
486 Ga0501042_0005099 3300049578 Bacteria 8427
487 Ga0501042_0022473 3300049578 Bacteria 4406
488 Ga0501042_0046879 3300049578 Bacteria 3081
489 Ga0501042_0091668 3300049578 Bacteria 2181
490 Ga0501042_0617039 3300049578 Archaea 788
491 Ga0501043_0194724 3300049579 Bacteria 1575
492 Ga0501043_0203376 3300049579 Bacteria 1536
493 Ga0501046_0017152 3300049580 Bacteria 6051
494 Ga0501046_0019020 3300049580 Bacteria 5701
495 Ga0501046_0020889 3300049580 Bacteria 5407
496 Ga0501046_0089731 3300049580 Bacteria 2365
497 Ga0501046_0184611 3300049580 Bacteria 1558
498 Ga0501048_0038176 3300049582 Bacteria 3447
499 Ga0501048_0120565 3300049582 Bacteria 1853
500 Ga0501067_0000374 3300049583 Bacteria 24367
501 Ga0501067_0170092 3300049583 Unclassified 1214
502 Ga0501068_0007668 3300049584 Bacteria 5972
503 Ga0501068_0012680 3300049584 Bacteria 4784
504 Ga0501068_0038057 3300049584 Bacteria 2880
505 Ga0501069_0012844 3300049585 Bacteria 4459
506 Ga0501069_0053764 3300049585 Bacteria 2242
507 Ga0501070_0019174 3300049586 Bacteria 5737
508 Ga0501070_0231463 3300049586 Archaea 1514
509 Ga0501070_0481720 3300049586 Bacteria 998
510 Ga0501071_0005923 3300049587 Bacteria 7909
511 Ga0501071_0096896 3300049587 Bacteria 2171
512 Ga0501071_0117140 3300049587 Bacteria 1972
513 Ga0501071_0233063 3300049587 Unclassified 1387
514 Ga0501072_0002327 3300049588 Bacteria 14252
515 Ga0501072_0003758 3300049588 Bacteria 11459
516 Ga0501072_0007152 3300049588 Bacteria 8467
517 Ga0501072_0033001 3300049588 Bacteria 4055
518 Ga0501073_0046682 3300049589 Bacteria 3045
519 Ga0501073_0085238 3300049589 Bacteria 2198
520 Ga0501073_0097732 3300049589 Bacteria 2039
521 Ga0501073_0311730 3300049589 Bacteria 1085
522 Ga0501074_0019343 3300049590 Bacteria 4947
523 Ga0501074_0031823 3300049590 Bacteria 3822
524 Ga0501074_0049329 3300049590 Bacteria 3039
525 Ga0501074_0095028 3300049590 Bacteria 2134
526 Ga0501074_0160941 3300049590 Bacteria 1603
527 Ga0501075_0004047 3300049591 Bacteria 9893
528 Ga0501075_0011797 3300049591 Bacteria 6196
529 Ga0501075_0019900 3300049591 Bacteria 4874
530 Ga0501075_0033917 3300049591 Bacteria 3798
531 Ga0501075_0176841 3300049591 Bacteria 1628
532 Ga0501075_0182154 3300049591 Bacteria 1602
533 Ga0501075_0199524 3300049591 Bacteria 1526
534 Ga0501076_0002568 3300049592 Bacteria 12484
535 Ga0501076_0003503 3300049592 Bacteria 11030
536 Ga0501076_0016358 3300049592 Bacteria 5624
537 Ga0501076_0083280 3300049592 Bacteria 2569
538 Ga0501076_0260446 3300049592 Bacteria 1420
539 Ga0501076_0263385 3300049592 Bacteria 1411
540 Ga0501077_0001034 3300049593 Bacteria 16812
541 Ga0501077_0002923 3300049593 Bacteria 10251
542 Ga0501077_0011255 3300049593 Bacteria 5583
543 Ga0501077_0067603 3300049593 Bacteria 2265
544 Ga0501077_0125267 3300049593 Unclassified 1628
545 Ga0501079_0012125 3300049741 Bacteria 6580
546 Ga0501079_0012179 3300049741 Bacteria 6565
547 Ga0501079_0020392 3300049741 Bacteria 5066
548 Ga0501079_0040682 3300049741 Bacteria 3586
549 Ga0501079_0069672 3300049741 Bacteria 2715
550 Ga0501079_0132643 3300049741 Bacteria 1939
551 Ga0501079_0197744 3300049741 Bacteria 1569
552 Ga0501080_0006433 3300049742 Bacteria 10543
553 Ga0501080_0013557 3300049742 Bacteria 7503
554 Ga0501080_0087670 3300049742 Bacteria 2891
555 Ga0501080_0301272 3300049742 Archaea 1454
556 Ga0501080_0502330 3300049742 Bacteria 1084
557 Ga0501081_0006444 3300049743 Bacteria 7617
558 Ga0501081_0008703 3300049743 Bacteria 6596
559 Ga0501081_0017081 3300049743 Bacteria 4798
560 Ga0501081_0028015 3300049743 Bacteria 3799
561 Ga0501081_0062703 3300049743 Bacteria 2579
562 Ga0501081_0199537 3300049743 Bacteria 1450
563 Ga0501081_0207884 3300049743 Bacteria 1421
564 Ga0501083_0017700 3300049744 Bacteria 4969
565 Ga0501083_0092390 3300049744 Bacteria 1998
566 Ga0501083_0124860 3300049744 Bacteria 1687
567 Ga0501083_0151684 3300049744 Bacteria 1517
568 Ga0501035_0009648 3300049822 Bacteria 8978
569 Ga0501035_0037353 3300049822 Bacteria 4398
570 Ga0501035_0062526 3300049822 Bacteria 3313
571 Ga0501035_0104046 3300049822 Bacteria 2490
572 Ga0501044_0067505 3300049823 Bacteria 3644
573 Ga0501045_0014465 3300049824 Bacteria 5592
574 Ga0501045_0079071 3300049824 Bacteria 2424
575 Ga0501045_0145399 3300049824 Bacteria 1764
576 Ga0501045_0187667 3300049824 Bacteria 1540
577 nmdc:mga00v17_406073_c1 3300050491 Bacteria 885
578 nmdc:mga0yw44_4853_c2 3300050492 Bacteria 5672
579 nmdc:mga05p37_465308_c1 3300050507 Archaea 1460
580 nmdc:mga05p37_5841_c2 3300050507 Bacteria 10530
581 nmdc:mga06r32_655197_c1 3300050510 Unclassified 1018
582 nmdc:mga08y16_157665_c1 3300050511 Bacteria 2359
583 nmdc:mga08y16_578951_c1 3300050511 Unclassified 1133
584 nmdc:mga0a205_8363_c1 3300050515 Bacteria 9412
585 nmdc:mga0a205_840628_c1 3300050515 Bacteria 765
586 Ga0495612_0157588 3300053078 Bacteria 990
587 Ga0495655_0044135 3300053083 Bacteria 1152
588 Ga0495595_0075665 3300053084 Bacteria 1597
589 Ga0495619_0179126 3300053085 Unclassified 1466
590 Ga0501084_0006463 3300054114 Bacteria 9638
591 Ga0501084_0010024 3300054114 Bacteria 7827
592 Ga0501084_0013735 3300054114 Bacteria 6702
593 Ga0501084_0037042 3300054114 Bacteria 4075
594 Ga0501084_0287079 3300054114 Bacteria 1389
595 Ga0501082_0003992 3300060353 Bacteria 12878
596 Ga0501082_0004592 3300060353 Bacteria 12065
597 Ga0501082_0007538 3300060353 Bacteria 9388
598 Ga0501082_0046153 3300060353 Bacteria 3756
599 Ga0501082_0160346 3300060353 Bacteria 1954
600 Ga0501082_0658213 3300060353 Archaea 917
601 Ga0466962_0233401 3300061719 Bacteria 902
602 Ga0530510_0012356 3300061734 Bacteria 5997
603 Ga0530510_0052261 3300061734 Bacteria 2953
604 Ga0530510_0083757 3300061734 Bacteria 2322
605 Ga0530510_0102895 3300061734 Bacteria 2089

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0028015 Ga0501081_0028015_50_613 187
2 3300037068 Ga0373925_0187262 Ga0373925_0187262_270_968 198
3 3300046455 Ga0495603_0086270 Ga0495603_0086270_431_1129 198
4 3300046683 Ga0495658_0157095 Ga0495658_0157095_535_1233 198
5 3300049578 Ga0501042_0617039 Ga0501042_0617039_13_609 198
6 3300005440 Ga0070705_100120696 Ga0070705_1001206961 199
7 3300005518 Ga0070699_100699930 Ga0070699_1006999301 199
8 3300013105 Ga0157369_10013890 Ga0157369_100138909 199
9 3300020082 Ga0206353_11119996 Ga0206353_111199968 200
10 3300038443 Ga0395901_0454210 Ga0395901_0454210_23_634 202
11 3300025944 Ga0207661_10123419 Ga0207661_101234194 204
12 3300037466 Ga0395898_0406647 Ga0395898_0406647_353_1033 204
13 3300013307 Ga0157372_10287824 Ga0157372_102878242 206
14 3300044693 Ga0466961_0218860 Ga0466961_0218860_365_1045 207
15 3300045049 Ga0466959_0040893 Ga0466959_0040893_768_1448 207
16 3300009093 Ga0105240_10245173 Ga0105240_102451732 208
17 3300025913 Ga0207695_10056425 Ga0207695_100564252 208
18 3300048915 Ga0496112_0900082 Ga0496112_0900082_13_678 209
19 3300045976 Ga0466967_0440093 Ga0466967_0440093_353_1036 211
20 3300048911 Ga0496108_0213713 Ga0496108_0213713_1011_1649 212
21 3300005536 Ga0070697_100162445 Ga0070697_1001624451 218
22 3300005937 Ga0081455_10026506 Ga0081455_100265062 221
23 3300025907 Ga0207645_10023350 Ga0207645_100233503 221
24 3300025942 Ga0207689_10047479 Ga0207689_100474792 221
25 3300049583 Ga0501067_0170092 Ga0501067_0170092_34_699 221
26 3300049742 Ga0501080_0502330 Ga0501080_0502330_234_899 221
27 3300049744 Ga0501083_0151684 Ga0501083_0151684_16_714 222
28 3300005364 Ga0070673_100007612 Ga0070673_1000076123 223
29 3300009176 Ga0105242_10040774 Ga0105242_100407743 223
30 3300009545 Ga0105237_10390820 Ga0105237_103908202 223
31 3300009551 Ga0105238_10160285 Ga0105238_101602852 223
32 3300025904 Ga0207647_10199761 Ga0207647_101997612 223
33 3300025933 Ga0207706_10039259 Ga0207706_100392593 223
34 3300025938 Ga0207704_10029907 Ga0207704_100299073 223
35 3300025941 Ga0207711_10409906 Ga0207711_104099062 223
36 3300026067 Ga0207678_10025385 Ga0207678_100253856 223
37 3300044694 Ga0466963_0108183 Ga0466963_0108183_197_874 223
38 3300044842 Ga0466957_0396843 Ga0466957_0396843_177_857 224
39 3300020077 Ga0206351_10482556 Ga0206351_104825561 225
40 3300020080 Ga0206350_11107442 Ga0206350_111074421 225
41 3300044684 Ga0466966_0013574 Ga0466966_0013574_750_1436 225
42 3300044693 Ga0466961_0040354 Ga0466961_0040354_730_1410 225
43 3300044694 Ga0466963_0256828 Ga0466963_0256828_305_985 225
44 3300045976 Ga0466967_0256603 Ga0466967_0256603_455_1135 225
45 3300048088 Ga0495602_0523589 Ga0495602_0523589_117_797 225
46 3300048917 Ga0496114_0087087 Ga0496114_0087087_994_1674 225
47 3300049571 Ga0501034_0068007 Ga0501034_0068007_147_833 225
48 3300061719 Ga0466962_0233401 Ga0466962_0233401_74_760 225
49 3300005334 Ga0068869_100977688 Ga0068869_1009776881 226
50 3300005438 Ga0070701_10019521 Ga0070701_100195212 226
51 3300005456 Ga0070678_100000052 Ga0070678_10000005236 226
52 3300005544 Ga0070686_100001674 Ga0070686_1000016747 226
53 3300005546 Ga0070696_100580628 Ga0070696_1005806281 226
54 3300005547 Ga0070693_100081932 Ga0070693_1000819322 226
55 3300005548 Ga0070665_100103425 Ga0070665_1001034252 226
56 3300005615 Ga0070702_100044763 Ga0070702_1000447632 226
57 3300005718 Ga0068866_10008968 Ga0068866_100089683 226
58 3300005842 Ga0068858_100206649 Ga0068858_1002066492 226
59 3300005843 Ga0068860_100027023 Ga0068860_1000270236 226
60 3300006163 Ga0070715_10019378 Ga0070715_100193783 226
61 3300006237 Ga0097621_100026124 Ga0097621_1000261244 226
62 3300006358 Ga0068871_100046109 Ga0068871_1000461093 226
63 3300009098 Ga0105245_10978751 Ga0105245_109787512 226
64 3300009148 Ga0105243_10007909 Ga0105243_100079097 226
65 3300009176 Ga0105242_10009065 Ga0105242_100090652 226
66 3300009177 Ga0105248_10015219 Ga0105248_100152194 226
67 3300013297 Ga0157378_10001752 Ga0157378_1000175215 226
68 3300014497 Ga0182008_10197189 Ga0182008_101971892 226
69 3300014968 Ga0157379_10009631 Ga0157379_100096312 226
70 3300014969 Ga0157376_10014368 Ga0157376_100143684 226
71 3300025899 Ga0207642_10005610 Ga0207642_100056105 226
72 3300025901 Ga0207688_10194107 Ga0207688_101941072 226
73 3300025905 Ga0207685_10280871 Ga0207685_102808711 226
74 3300025918 Ga0207662_10067432 Ga0207662_100674322 226
75 3300025934 Ga0207686_10247646 Ga0207686_102476462 226
76 3300025935 Ga0207709_10083159 Ga0207709_100831593 226
77 3300025939 Ga0207665_10391597 Ga0207665_103915972 226
78 3300025941 Ga0207711_10023268 Ga0207711_100232683 226
79 3300026089 Ga0207648_10194353 Ga0207648_101943532 226
80 3300026121 Ga0207683_10000088 Ga0207683_1000008838 226
81 3300028381 Ga0268264_10104619 Ga0268264_101046193 226
82 3300028563 Ga0265319_1015620 Ga0265319_10156204 226
83 3300028577 Ga0265318_10008787 Ga0265318_100087874 226
84 3300031240 Ga0265320_10014826 Ga0265320_100148263 226
85 3300031240 Ga0265320_10070740 Ga0265320_100707402 226
86 3300031240 Ga0265320_10100366 Ga0265320_101003662 226
87 3300047317 Ga0495604_0315596 Ga0495604_0315596_222_920 226
88 3300048904 Ga0496101_0001935 Ga0496101_0001935_260_958 226
89 3300048905 Ga0496102_0309936 Ga0496102_0309936_105_803 226
90 3300048906 Ga0496103_0016856 Ga0496103_0016856_1745_2443 226
91 3300048908 Ga0496105_0001655 Ga0496105_0001655_7551_8249 226
92 3300048910 Ga0496107_0011271 Ga0496107_0011271_4716_5414 226
93 3300048917 Ga0496114_0035638 Ga0496114_0035638_2161_2859 226
94 3300020082 Ga0206353_10994781 Ga0206353_109947811 227
95 3300028800 Ga0265338_10070748 Ga0265338_100707483 227
96 3300031247 Ga0265340_10076615 Ga0265340_100766152 227
97 3300031595 Ga0265313_10107135 Ga0265313_101071351 227
98 3300035118 Ga0373954_0053157 Ga0373954_0053157_967_1683 227
99 3300048903 Ga0496100_0083321 Ga0496100_0083321_797_1480 227
100 3300048904 Ga0496101_0116460 Ga0496101_0116460_653_1336 227
101 3300048905 Ga0496102_0262912 Ga0496102_0262912_231_914 227
102 3300048909 Ga0496106_0067900 Ga0496106_0067900_753_1436 227
103 3300048911 Ga0496108_0024449 Ga0496108_0024449_174_857 227
104 3300048915 Ga0496112_0414650 Ga0496112_0414650_244_927 227
105 3300005366 Ga0070659_100376391 Ga0070659_1003763911 228
106 3300006847 Ga0075431_100713536 Ga0075431_1007135361 228
107 3300006852 Ga0075433_10924960 Ga0075433_109249601 228
108 3300009147 Ga0114129_11421874 Ga0114129_114218741 228
109 3300009147 Ga0114129_11518467 Ga0114129_115184671 228
110 3300025941 Ga0207711_10543187 Ga0207711_105431872 228
111 3300031548 Ga0307408_100223764 Ga0307408_1002237642 228
112 3300031731 Ga0307405_10388174 Ga0307405_103881741 228
113 3300031852 Ga0307410_10543068 Ga0307410_105430681 228
114 3300031903 Ga0307407_10095402 Ga0307407_100954023 228
115 3300031995 Ga0307409_100060552 Ga0307409_1000605522 228
116 3300037418 Ga0395900_0219544 Ga0395900_0219544_429_1148 228
117 3300038443 Ga0395901_0790099 Ga0395901_0790099_46_765 228
118 3300048909 Ga0496106_0236419 Ga0496106_0236419_581_1267 228
119 3300048910 Ga0496107_0241251 Ga0496107_0241251_462_1148 228
120 3300050510 nmdc:mga06r32_655197_c1 nmdc:mga06r32_655197_c1_264_959 228
121 3300050515 nmdc:mga0a205_840628_c1 nmdc:mga0a205_840628_c1_33_728 228
122 3300005331 Ga0070670_100293172 Ga0070670_1002931721 229
123 3300005337 Ga0070682_100454119 Ga0070682_1004541192 229
124 3300005456 Ga0070678_100261374 Ga0070678_1002613743 229
125 3300013308 Ga0157375_10654906 Ga0157375_106549062 229
126 3300014326 Ga0157380_10573076 Ga0157380_105730762 229
127 3300014969 Ga0157376_10211245 Ga0157376_102112451 229
128 3300025938 Ga0207704_10710805 Ga0207704_107108051 229
129 3300025944 Ga0207661_10259337 Ga0207661_102593371 229
130 3300026089 Ga0207648_10592160 Ga0207648_105921601 229
131 3300026121 Ga0207683_10346410 Ga0207683_103464102 229
132 3300046455 Ga0495603_0030234 Ga0495603_0030234_2069_2758 229
133 3300046461 Ga0495641_0090870 Ga0495641_0090870_490_1179 229
134 3300046642 Ga0495634_0188294 Ga0495634_0188294_204_893 229
135 3300046664 Ga0495659_0175426 Ga0495659_0175426_52_747 229
136 3300048908 Ga0496105_0465631 Ga0496105_0465631_45_734 229
137 3300048917 Ga0496114_0079772 Ga0496114_0079772_1899_2588 229
138 3300048917 Ga0496114_0418944 Ga0496114_0418944_429_1118 229
139 3300049583 Ga0501067_0000374 Ga0501067_0000374_12811_13506 229
140 3300049587 Ga0501071_0233063 Ga0501071_0233063_373_1068 229
141 3300053078 Ga0495612_0157588 Ga0495612_0157588_73_762 229
142 3300053084 Ga0495595_0075665 Ga0495595_0075665_57_746 229
143 3300053085 Ga0495619_0179126 Ga0495619_0179126_219_908 229
144 3300009147 Ga0114129_10131500 Ga0114129_101315005 230
145 3300020081 Ga0206354_11183149 Ga0206354_111831492 230
146 3300049569 Ga0501032_0180072 Ga0501032_0180072_134_832 230
147 3300049572 Ga0501036_0007924 Ga0501036_0007924_6665_7363 230
148 3300049574 Ga0501038_0099779 Ga0501038_0099779_1407_2105 230
149 3300049575 Ga0501039_0052617 Ga0501039_0052617_2003_2701 230
150 3300049577 Ga0501041_0014045 Ga0501041_0014045_3329_4027 230
151 3300049582 Ga0501048_0038176 Ga0501048_0038176_2395_3093 230
152 3300049586 Ga0501070_0231463 Ga0501070_0231463_723_1421 230
153 3300049587 Ga0501071_0096896 Ga0501071_0096896_798_1496 230
154 3300049588 Ga0501072_0007152 Ga0501072_0007152_3664_4362 230
155 3300049590 Ga0501074_0049329 Ga0501074_0049329_1831_2529 230
156 3300049591 Ga0501075_0182154 Ga0501075_0182154_579_1277 230
157 3300049592 Ga0501076_0083280 Ga0501076_0083280_1266_1964 230
158 3300049593 Ga0501077_0011255 Ga0501077_0011255_2349_3047 230
159 3300049741 Ga0501079_0040682 Ga0501079_0040682_235_933 230
160 3300049744 Ga0501083_0092390 Ga0501083_0092390_681_1379 230
161 3300049822 Ga0501035_0062526 Ga0501035_0062526_1505_2203 230
162 3300049824 Ga0501045_0079071 Ga0501045_0079071_455_1153 230
163 3300054114 Ga0501084_0013735 Ga0501084_0013735_159_857 230
164 3300060353 Ga0501082_0003992 Ga0501082_0003992_2931_3629 230
165 3300060353 Ga0501082_0658213 Ga0501082_0658213_115_813 230
166 3300005981 Ga0081538_10031464 Ga0081538_100314642 231
167 3300026121 Ga0207683_10205089 Ga0207683_102050892 231
168 3300049580 Ga0501046_0184611 Ga0501046_0184611_774_1472 232
169 3300049586 Ga0501070_0481720 Ga0501070_0481720_259_957 232
170 3300049591 Ga0501075_0199524 Ga0501075_0199524_764_1462 232
171 3300049592 Ga0501076_0260446 Ga0501076_0260446_27_725 232
172 3300049743 Ga0501081_0207884 Ga0501081_0207884_581_1279 232
173 3300005471 Ga0070698_100102616 Ga0070698_1001026164 233
174 3300005518 Ga0070699_100070877 Ga0070699_1000708773 233
175 3300005530 Ga0070679_100351783 Ga0070679_1003517833 233
176 3300026075 Ga0207708_10210356 Ga0207708_102103563 233
177 3300042004 Ga0439445_0062318 Ga0439445_0062318_280_984 233
178 3300042006 Ga0439432_104426 Ga0439432_104426_82_786 233
179 3300042007 Ga0439449_0079620 Ga0439449_0079620_308_1012 233
180 3300042015 Ga0439462_0007795 Ga0439462_0007795_1653_2357 233
181 3300042156 Ga0439446_0001483 Ga0439446_0001483_4311_5015 233
182 3300049568 Ga0501031_0026848 Ga0501031_0026848_2088_2789 233
183 3300049570 Ga0501033_0022921 Ga0501033_0022921_3893_4594 233
184 3300049571 Ga0501034_0186625 Ga0501034_0186625_213_914 233
185 3300049574 Ga0501038_0037681 Ga0501038_0037681_1328_2029 233
186 3300049575 Ga0501039_0077813 Ga0501039_0077813_1596_2297 233
187 3300049577 Ga0501041_0073589 Ga0501041_0073589_1250_1951 233
188 3300049578 Ga0501042_0091668 Ga0501042_0091668_1468_2169 233
189 3300049580 Ga0501046_0089731 Ga0501046_0089731_78_779 233
190 3300049584 Ga0501068_0007668 Ga0501068_0007668_3307_4008 233
191 3300049585 Ga0501069_0053764 Ga0501069_0053764_555_1256 233
192 3300049586 Ga0501070_0019174 Ga0501070_0019174_3425_4126 233
193 3300049587 Ga0501071_0117140 Ga0501071_0117140_560_1261 233
194 3300049588 Ga0501072_0033001 Ga0501072_0033001_1753_2454 233
195 3300049589 Ga0501073_0311730 Ga0501073_0311730_109_810 233
196 3300049590 Ga0501074_0095028 Ga0501074_0095028_470_1171 233
197 3300049591 Ga0501075_0176841 Ga0501075_0176841_106_807 233
198 3300049592 Ga0501076_0263385 Ga0501076_0263385_23_724 233
199 3300049593 Ga0501077_0067603 Ga0501077_0067603_946_1647 233
200 3300049741 Ga0501079_0197744 Ga0501079_0197744_688_1389 233
201 3300049743 Ga0501081_0199537 Ga0501081_0199537_302_1003 233
202 3300049744 Ga0501083_0124860 Ga0501083_0124860_687_1388 233
203 3300049822 Ga0501035_0037353 Ga0501035_0037353_510_1211 233
204 3300049823 Ga0501044_0067505 Ga0501044_0067505_1446_2147 233
205 3300049824 Ga0501045_0187667 Ga0501045_0187667_316_1017 233
206 3300054114 Ga0501084_0287079 Ga0501084_0287079_387_1088 233
207 3300060353 Ga0501082_0160346 Ga0501082_0160346_302_1003 233
208 3300003203 JGI25406J46586_10040463 JGI25406J46586_100404633 234
209 3300005329 Ga0070683_100133958 Ga0070683_1001339582 234
210 3300005331 Ga0070670_100683416 Ga0070670_1006834161 234
211 3300005337 Ga0070682_100455509 Ga0070682_1004555092 234
212 3300005340 Ga0070689_100334267 Ga0070689_1003342672 234
213 3300005356 Ga0070674_100071031 Ga0070674_1000710313 234
214 3300005367 Ga0070667_100298941 Ga0070667_1002989412 234
215 3300005456 Ga0070678_100015082 Ga0070678_1000150823 234
216 3300005466 Ga0070685_10062379 Ga0070685_100623792 234
217 3300005543 Ga0070672_100158549 Ga0070672_1001585493 234
218 3300005544 Ga0070686_100146896 Ga0070686_1001468961 234
219 3300005546 Ga0070696_100152127 Ga0070696_1001521272 234
220 3300005549 Ga0070704_100296643 Ga0070704_1002966432 234
221 3300005615 Ga0070702_100105698 Ga0070702_1001056981 234
222 3300005616 Ga0068852_100558112 Ga0068852_1005581122 234
223 3300005617 Ga0068859_100094205 Ga0068859_1000942054 234
224 3300005718 Ga0068866_10157838 Ga0068866_101578382 234
225 3300005840 Ga0068870_10059327 Ga0068870_100593272 234
226 3300005842 Ga0068858_100230765 Ga0068858_1002307652 234
227 3300005985 Ga0081539_10000200 Ga0081539_1000020061 234
228 3300006358 Ga0068871_100506477 Ga0068871_1005064772 234
229 3300006844 Ga0075428_100469626 Ga0075428_1004696262 234
230 3300006881 Ga0068865_100008991 Ga0068865_1000089912 234
231 3300006931 Ga0097620_100094200 Ga0097620_1000942002 234
232 3300009098 Ga0105245_10046418 Ga0105245_100464185 234
233 3300009148 Ga0105243_10009015 Ga0105243_100090157 234
234 3300009148 Ga0105243_10416626 Ga0105243_104166262 234
235 3300009176 Ga0105242_11187675 Ga0105242_111876751 234
236 3300009177 Ga0105248_10024950 Ga0105248_100249504 234
237 3300009551 Ga0105238_10252584 Ga0105238_102525843 234
238 3300009553 Ga0105249_10085675 Ga0105249_100856753 234
239 3300011119 Ga0105246_10008656 Ga0105246_100086563 234
240 3300013308 Ga0157375_10072916 Ga0157375_100729163 234
241 3300014325 Ga0163163_10245031 Ga0163163_102450313 234
242 3300014326 Ga0157380_10000820 Ga0157380_1000082025 234
243 3300014745 Ga0157377_10406336 Ga0157377_104063362 234
244 3300014968 Ga0157379_10094192 Ga0157379_100941922 234
245 3300014969 Ga0157376_10036180 Ga0157376_100361803 234
246 3300025903 Ga0207680_10288812 Ga0207680_102888122 234
247 3300025908 Ga0207643_10033044 Ga0207643_100330443 234
248 3300025919 Ga0207657_10265952 Ga0207657_102659522 234
249 3300025934 Ga0207686_10316933 Ga0207686_103169331 234
250 3300025935 Ga0207709_10023219 Ga0207709_100232194 234
251 3300025940 Ga0207691_10096134 Ga0207691_100961342 234
252 3300025941 Ga0207711_10123290 Ga0207711_101232902 234
253 3300025961 Ga0207712_10049006 Ga0207712_100490063 234
254 3300026035 Ga0207703_10742213 Ga0207703_107422132 234
255 3300026041 Ga0207639_10568360 Ga0207639_105683601 234
256 3300026089 Ga0207648_10043885 Ga0207648_100438853 234
257 3300026089 Ga0207648_10082064 Ga0207648_100820642 234
258 3300026121 Ga0207683_10003610 Ga0207683_100036105 234
259 3300026142 Ga0207698_10629085 Ga0207698_106290852 234
260 3300027907 Ga0207428_10149851 Ga0207428_101498513 234
261 3300046455 Ga0495603_0006748 Ga0495603_0006748_5168_5872 234
262 3300046473 Ga0495582_0122111 Ga0495582_0122111_727_1431 234
263 3300046500 Ga0495596_0144180 Ga0495596_0144180_79_783 234
264 3300046520 Ga0495637_0093037 Ga0495637_0093037_453_1157 234
265 3300046523 Ga0495644_0091114 Ga0495644_0091114_77_781 234
266 3300046615 Ga0495656_0013806 Ga0495656_0013806_1625_2329 234
267 3300048907 Ga0496104_0075582 Ga0496104_0075582_1238_1942 234
268 3300048912 Ga0496109_0128506 Ga0496109_0128506_759_1463 234
269 3300048917 Ga0496114_0138237 Ga0496114_0138237_899_1603 234
270 3300049575 Ga0501039_0173222 Ga0501039_0173222_556_1260 234
271 3300049576 Ga0501040_0510060 Ga0501040_0510060_82_786 234
272 3300049591 Ga0501075_0004047 Ga0501075_0004047_8272_8976 234
273 3300049741 Ga0501079_0069672 Ga0501079_0069672_766_1470 234
274 3300049742 Ga0501080_0301272 Ga0501080_0301272_10_714 234
275 3300049743 Ga0501081_0062703 Ga0501081_0062703_1392_2096 234
276 3300050507 nmdc:mga05p37_465308_c1 nmdc:mga05p37_465308_c1_351_1055 234
277 3300053083 Ga0495655_0044135 Ga0495655_0044135_249_953 234
278 3300000044 ARSoilOldRDRAFT_c009932 ARSoilOldRDRAFT_0099321 235
279 3300001989 JGI24739J22299_10035832 JGI24739J22299_100358322 235
280 3300001991 JGI24743J22301_10005203 JGI24743J22301_100052033 235
281 3300002075 JGI24738J21930_10005569 JGI24738J21930_100055693 235
282 3300005327 Ga0070658_10119662 Ga0070658_101196623 235
283 3300005329 Ga0070683_100031599 Ga0070683_1000315993 235
284 3300005329 Ga0070683_100044042 Ga0070683_1000440424 235
285 3300005329 Ga0070683_100045947 Ga0070683_1000459474 235
286 3300005329 Ga0070683_100225107 Ga0070683_1002251072 235
287 3300005329 Ga0070683_100752793 Ga0070683_1007527931 235
288 3300005331 Ga0070670_100098812 Ga0070670_1000988123 235
289 3300005334 Ga0068869_100144702 Ga0068869_1001447023 235
290 3300005336 Ga0070680_100006280 Ga0070680_1000062809 235
291 3300005336 Ga0070680_100062689 Ga0070680_1000626892 235
292 3300005337 Ga0070682_100030833 Ga0070682_1000308333 235
293 3300005337 Ga0070682_100059146 Ga0070682_1000591464 235
294 3300005337 Ga0070682_100095936 Ga0070682_1000959362 235
295 3300005338 Ga0068868_100157542 Ga0068868_1001575422 235
296 3300005338 Ga0068868_100281276 Ga0068868_1002812762 235
297 3300005339 Ga0070660_100135498 Ga0070660_1001354982 235
298 3300005341 Ga0070691_10032236 Ga0070691_100322364 235
299 3300005341 Ga0070691_10088808 Ga0070691_100888082 235
300 3300005344 Ga0070661_100017514 Ga0070661_1000175145 235
301 3300005344 Ga0070661_100168985 Ga0070661_1001689853 235
302 3300005347 Ga0070668_100091866 Ga0070668_1000918662 235
303 3300005347 Ga0070668_100103335 Ga0070668_1001033352 235
304 3300005354 Ga0070675_100027707 Ga0070675_1000277075 235
305 3300005354 Ga0070675_100069322 Ga0070675_1000693223 235
306 3300005356 Ga0070674_100138997 Ga0070674_1001389973 235
307 3300005364 Ga0070673_100005153 Ga0070673_1000051538 235
308 3300005366 Ga0070659_100009185 Ga0070659_1000091858 235
309 3300005366 Ga0070659_100010513 Ga0070659_1000105136 235
310 3300005366 Ga0070659_100031388 Ga0070659_1000313885 235
311 3300005366 Ga0070659_100064759 Ga0070659_1000647592 235
312 3300005438 Ga0070701_10006182 Ga0070701_100061824 235
313 3300005438 Ga0070701_10121580 Ga0070701_101215802 235
314 3300005440 Ga0070705_100001459 Ga0070705_1000014598 235
315 3300005441 Ga0070700_100057241 Ga0070700_1000572412 235
316 3300005441 Ga0070700_100417384 Ga0070700_1004173841 235
317 3300005444 Ga0070694_100330198 Ga0070694_1003301981 235
318 3300005444 Ga0070694_100512866 Ga0070694_1005128661 235
319 3300005455 Ga0070663_100011865 Ga0070663_1000118656 235
320 3300005457 Ga0070662_100036282 Ga0070662_1000362825 235
321 3300005457 Ga0070662_100060621 Ga0070662_1000606213 235
322 3300005458 Ga0070681_10161743 Ga0070681_101617432 235
323 3300005459 Ga0068867_100554733 Ga0068867_1005547332 235
324 3300005466 Ga0070685_10007843 Ga0070685_100078433 235
325 3300005466 Ga0070685_10283100 Ga0070685_102831002 235
326 3300005530 Ga0070679_100063253 Ga0070679_1000632533 235
327 3300005530 Ga0070679_100071314 Ga0070679_1000713142 235
328 3300005530 Ga0070679_100142937 Ga0070679_1001429373 235
329 3300005530 Ga0070679_100208506 Ga0070679_1002085062 235
330 3300005535 Ga0070684_100009821 Ga0070684_1000098215 235
331 3300005535 Ga0070684_100030081 Ga0070684_1000300813 235
332 3300005535 Ga0070684_100105826 Ga0070684_1001058263 235
333 3300005535 Ga0070684_100147719 Ga0070684_1001477193 235
334 3300005535 Ga0070684_100173337 Ga0070684_1001733372 235
335 3300005535 Ga0070684_100213617 Ga0070684_1002136173 235
336 3300005535 Ga0070684_100399143 Ga0070684_1003991433 235
337 3300005539 Ga0068853_100012719 Ga0068853_1000127198 235
338 3300005539 Ga0068853_100067239 Ga0068853_1000672392 235
339 3300005539 Ga0068853_100088341 Ga0068853_1000883414 235
340 3300005543 Ga0070672_100103175 Ga0070672_1001031752 235
341 3300005544 Ga0070686_100232857 Ga0070686_1002328571 235
342 3300005547 Ga0070693_100009212 Ga0070693_1000092126 235
343 3300005547 Ga0070693_100016326 Ga0070693_1000163265 235
344 3300005547 Ga0070693_100164333 Ga0070693_1001643333 235
345 3300005548 Ga0070665_100046359 Ga0070665_1000463594 235
346 3300005549 Ga0070704_100023046 Ga0070704_1000230463 235
347 3300005549 Ga0070704_100390061 Ga0070704_1003900612 235
348 3300005563 Ga0068855_100033474 Ga0068855_1000334746 235
349 3300005564 Ga0070664_100061110 Ga0070664_1000611102 235
350 3300005564 Ga0070664_100071615 Ga0070664_1000716154 235
351 3300005564 Ga0070664_100096048 Ga0070664_1000960483 235
352 3300005564 Ga0070664_100603663 Ga0070664_1006036631 235
353 3300005577 Ga0068857_100030114 Ga0068857_1000301144 235
354 3300005577 Ga0068857_100156668 Ga0068857_1001566682 235
355 3300005578 Ga0068854_100066826 Ga0068854_1000668262 235
356 3300005578 Ga0068854_100137398 Ga0068854_1001373983 235
357 3300005614 Ga0068856_100032298 Ga0068856_1000322983 235
358 3300005614 Ga0068856_100094815 Ga0068856_1000948153 235
359 3300005615 Ga0070702_100052912 Ga0070702_1000529123 235
360 3300005615 Ga0070702_100058184 Ga0070702_1000581842 235
361 3300005615 Ga0070702_100223072 Ga0070702_1002230722 235
362 3300005618 Ga0068864_100019754 Ga0068864_1000197545 235
363 3300005718 Ga0068866_10076202 Ga0068866_100762023 235
364 3300005718 Ga0068866_10357162 Ga0068866_103571621 235
365 3300005719 Ga0068861_100028780 Ga0068861_1000287801 235
366 3300005834 Ga0068851_10009084 Ga0068851_100090846 235
367 3300005840 Ga0068870_10016192 Ga0068870_100161923 235
368 3300005841 Ga0068863_100110603 Ga0068863_1001106033 235
369 3300005842 Ga0068858_100047996 Ga0068858_1000479962 235
370 3300005843 Ga0068860_100446760 Ga0068860_1004467602 235
371 3300005844 Ga0068862_100131730 Ga0068862_1001317302 235
372 3300005937 Ga0081455_10013098 Ga0081455_1001309810 235
373 3300005937 Ga0081455_10411539 Ga0081455_104115392 235
374 3300006051 Ga0075364_10020761 Ga0075364_100207616 235
375 3300006051 Ga0075364_10149290 Ga0075364_101492902 235
376 3300006058 Ga0075432_10018362 Ga0075432_100183622 235
377 3300006358 Ga0068871_100314221 Ga0068871_1003142212 235
378 3300006844 Ga0075428_100260262 Ga0075428_1002602622 235
379 3300006852 Ga0075433_10118193 Ga0075433_101181934 235
380 3300006881 Ga0068865_100031732 Ga0068865_1000317325 235
381 3300009094 Ga0111539_10157964 Ga0111539_101579643 235
382 3300009094 Ga0111539_10833348 Ga0111539_108333482 235
383 3300009098 Ga0105245_10023597 Ga0105245_100235976 235
384 3300009098 Ga0105245_10070046 Ga0105245_100700463 235
385 3300009098 Ga0105245_10143776 Ga0105245_101437763 235
386 3300009147 Ga0114129_10038780 Ga0114129_100387808 235
387 3300009148 Ga0105243_10023935 Ga0105243_100239355 235
388 3300009148 Ga0105243_10097084 Ga0105243_100970842 235
389 3300009148 Ga0105243_10164351 Ga0105243_101643511 235
390 3300009174 Ga0105241_10100207 Ga0105241_101002072 235
391 3300009174 Ga0105241_10159922 Ga0105241_101599222 235
392 3300009176 Ga0105242_10557308 Ga0105242_105573082 235
393 3300009177 Ga0105248_10045330 Ga0105248_100453304 235
394 3300009177 Ga0105248_11043442 Ga0105248_110434421 235
395 3300009553 Ga0105249_10641698 Ga0105249_106416982 235
396 3300009553 Ga0105249_10687761 Ga0105249_106877611 235
397 3300010375 Ga0105239_10031030 Ga0105239_100310303 235
398 3300010375 Ga0105239_10250057 Ga0105239_102500573 235
399 3300011119 Ga0105246_10111951 Ga0105246_101119512 235
400 3300013102 Ga0157371_10029676 Ga0157371_100296763 235
401 3300013102 Ga0157371_10137294 Ga0157371_101372942 235
402 3300013105 Ga0157369_10102394 Ga0157369_101023943 235
403 3300013306 Ga0163162_10259427 Ga0163162_102594273 235
404 3300013307 Ga0157372_10049404 Ga0157372_100494044 235
405 3300013307 Ga0157372_10124270 Ga0157372_101242703 235
406 3300013308 Ga0157375_10064949 Ga0157375_100649492 235
407 3300013308 Ga0157375_10080233 Ga0157375_100802332 235
408 3300014745 Ga0157377_10005680 Ga0157377_100056801 235
409 3300014745 Ga0157377_10009457 Ga0157377_100094576 235
410 3300014745 Ga0157377_10015087 Ga0157377_100150873 235
411 3300014745 Ga0157377_10111314 Ga0157377_101113142 235
412 3300014968 Ga0157379_10059591 Ga0157379_100595913 235
413 3300017792 Ga0163161_10053935 Ga0163161_100539354 235
414 3300025885 Ga0207653_10066552 Ga0207653_100665523 235
415 3300025901 Ga0207688_10001403 Ga0207688_100014039 235
416 3300025901 Ga0207688_10006162 Ga0207688_100061624 235
417 3300025908 Ga0207643_10114507 Ga0207643_101145073 235
418 3300025909 Ga0207705_10065729 Ga0207705_100657291 235
419 3300025912 Ga0207707_10238996 Ga0207707_102389961 235
420 3300025912 Ga0207707_10253793 Ga0207707_102537932 235
421 3300025917 Ga0207660_10049258 Ga0207660_100492582 235
422 3300025918 Ga0207662_10107962 Ga0207662_101079622 235
423 3300025919 Ga0207657_10001010 Ga0207657_1000101034 235
424 3300025919 Ga0207657_10059901 Ga0207657_100599012 235
425 3300025919 Ga0207657_10186079 Ga0207657_101860792 235
426 3300025920 Ga0207649_10034246 Ga0207649_100342463 235
427 3300025920 Ga0207649_10035028 Ga0207649_100350283 235
428 3300025920 Ga0207649_10166286 Ga0207649_101662862 235
429 3300025921 Ga0207652_10064630 Ga0207652_100646303 235
430 3300025924 Ga0207694_10155637 Ga0207694_101556372 235
431 3300025924 Ga0207694_10297908 Ga0207694_102979081 235
432 3300025925 Ga0207650_10096434 Ga0207650_100964344 235
433 3300025925 Ga0207650_10112424 Ga0207650_101124243 235
434 3300025927 Ga0207687_10008752 Ga0207687_100087522 235
435 3300025927 Ga0207687_10102095 Ga0207687_101020951 235
436 3300025927 Ga0207687_10136027 Ga0207687_101360271 235
437 3300025932 Ga0207690_10069688 Ga0207690_100696882 235
438 3300025933 Ga0207706_10023980 Ga0207706_100239805 235
439 3300025933 Ga0207706_10033910 Ga0207706_100339106 235
440 3300025933 Ga0207706_10051168 Ga0207706_100511684 235
441 3300025934 Ga0207686_10074483 Ga0207686_100744832 235
442 3300025934 Ga0207686_10159028 Ga0207686_101590282 235
443 3300025934 Ga0207686_10178591 Ga0207686_101785911 235
444 3300025935 Ga0207709_10022156 Ga0207709_100221564 235
445 3300025935 Ga0207709_10022551 Ga0207709_100225512 235
446 3300025935 Ga0207709_10274812 Ga0207709_102748122 235
447 3300025937 Ga0207669_10019183 Ga0207669_100191834 235
448 3300025937 Ga0207669_10198467 Ga0207669_101984672 235
449 3300025940 Ga0207691_10010456 Ga0207691_1001045610 235
450 3300025940 Ga0207691_10026609 Ga0207691_100266096 235
451 3300025940 Ga0207691_10513083 Ga0207691_105130832 235
452 3300025941 Ga0207711_10222058 Ga0207711_102220582 235
453 3300025944 Ga0207661_10002116 Ga0207661_100021169 235
454 3300025944 Ga0207661_10102126 Ga0207661_101021262 235
455 3300025944 Ga0207661_10117674 Ga0207661_101176743 235
456 3300025944 Ga0207661_10391893 Ga0207661_103918932 235
457 3300025945 Ga0207679_10135944 Ga0207679_101359442 235
458 3300025945 Ga0207679_10240673 Ga0207679_102406731 235
459 3300025945 Ga0207679_10303011 Ga0207679_103030113 235
460 3300025945 Ga0207679_10356303 Ga0207679_103563032 235
461 3300025949 Ga0207667_10285817 Ga0207667_102858172 235
462 3300025949 Ga0207667_10649629 Ga0207667_106496291 235
463 3300025960 Ga0207651_10042627 Ga0207651_100426273 235
464 3300025961 Ga0207712_10336470 Ga0207712_103364702 235
465 3300025972 Ga0207668_10082938 Ga0207668_100829382 235
466 3300025981 Ga0207640_10076045 Ga0207640_100760452 235
467 3300025986 Ga0207658_10059380 Ga0207658_100593803 235
468 3300026023 Ga0207677_10233022 Ga0207677_102330222 235
469 3300026023 Ga0207677_10438266 Ga0207677_104382661 235
470 3300026023 Ga0207677_10571710 Ga0207677_105717101 235
471 3300026035 Ga0207703_10108622 Ga0207703_101086223 235
472 3300026041 Ga0207639_10066505 Ga0207639_100665053 235
473 3300026041 Ga0207639_10070000 Ga0207639_100700005 235
474 3300026041 Ga0207639_10204830 Ga0207639_102048302 235
475 3300026067 Ga0207678_10482932 Ga0207678_104829322 235
476 3300026075 Ga0207708_10026938 Ga0207708_100269383 235
477 3300026075 Ga0207708_10029313 Ga0207708_100293135 235
478 3300026075 Ga0207708_10405516 Ga0207708_104055162 235
479 3300026078 Ga0207702_10094097 Ga0207702_100940971 235
480 3300026078 Ga0207702_10115772 Ga0207702_101157721 235
481 3300026088 Ga0207641_10324022 Ga0207641_103240222 235
482 3300026089 Ga0207648_10023616 Ga0207648_100236162 235
483 3300026089 Ga0207648_10523448 Ga0207648_105234482 235
484 3300026116 Ga0207674_10017040 Ga0207674_100170405 235
485 3300026116 Ga0207674_10027394 Ga0207674_100273942 235
486 3300026116 Ga0207674_10248810 Ga0207674_102488102 235
487 3300026116 Ga0207674_10332750 Ga0207674_103327503 235
488 3300026116 Ga0207674_10653180 Ga0207674_106531801 235
489 3300026118 Ga0207675_100014934 Ga0207675_1000149347 235
490 3300026118 Ga0207675_100129978 Ga0207675_1001299782 235
491 3300026121 Ga0207683_10016673 Ga0207683_100166737 235
492 3300026142 Ga0207698_10073734 Ga0207698_100737343 235
493 3300026142 Ga0207698_10559089 Ga0207698_105590892 235
494 3300027907 Ga0207428_10000244 Ga0207428_1000024414 235
495 3300027907 Ga0207428_10050859 Ga0207428_100508593 235
496 3300028379 Ga0268266_10067580 Ga0268266_100675804 235
497 3300028380 Ga0268265_10132980 Ga0268265_101329802 235
498 3300028380 Ga0268265_10615168 Ga0268265_106151681 235
499 3300031901 Ga0307406_10818474 Ga0307406_108184741 235
500 3300034957 Ga0373938_0035511 Ga0373938_0035511_121_828 235
501 3300035121 Ga0373960_0002607 Ga0373960_0002607_1427_2134 235
502 3300035691 Ga0373931_0101830 Ga0373931_0101830_342_1049 235
503 3300041486 Ga0451807_1742402 Ga0451807_1742402_147_854 235
504 3300042005 Ga0439448_0113386 Ga0439448_0113386_160_867 235
505 3300042118 Ga0450914_000276 Ga0450914_000276_482_1189 235
506 3300042145 Ga0450906_012059 Ga0450906_012059_419_1126 235
507 3300042438 Ga0439459_0020854 Ga0439459_0020854_239_946 235
508 3300048908 Ga0496105_0110301 Ga0496105_0110301_483_1190 235
509 3300048911 Ga0496108_0009092 Ga0496108_0009092_1602_2309 235
510 3300048911 Ga0496108_0063926 Ga0496108_0063926_1314_2021 235
511 3300048912 Ga0496109_0008352 Ga0496109_0008352_6617_7324 235
512 3300048912 Ga0496109_0293917 Ga0496109_0293917_546_1253 235
513 3300048913 Ga0496110_0013159 Ga0496110_0013159_5391_6098 235
514 3300048913 Ga0496110_0060184 Ga0496110_0060184_1165_1872 235
515 3300048913 Ga0496110_0074971 Ga0496110_0074971_2188_2895 235
516 3300048913 Ga0496110_0084249 Ga0496110_0084249_1277_1984 235
517 3300048914 Ga0496111_0002857 Ga0496111_0002857_8084_8791 235
518 3300048914 Ga0496111_0023990 Ga0496111_0023990_2035_2742 235
519 3300048914 Ga0496111_0122453 Ga0496111_0122453_773_1480 235
520 3300048915 Ga0496112_0020518 Ga0496112_0020518_4902_5609 235
521 3300048916 Ga0496113_0053237 Ga0496113_0053237_648_1355 235
522 3300048917 Ga0496114_0411360 Ga0496114_0411360_464_1171 235
523 3300049568 Ga0501031_0015535 Ga0501031_0015535_723_1430 235
524 3300049568 Ga0501031_0052869 Ga0501031_0052869_1022_1729 235
525 3300049569 Ga0501032_0031634 Ga0501032_0031634_2066_2773 235
526 3300049569 Ga0501032_0063572 Ga0501032_0063572_1644_2351 235
527 3300049570 Ga0501033_0050721 Ga0501033_0050721_1518_2225 235
528 3300049570 Ga0501033_0152906 Ga0501033_0152906_516_1223 235
529 3300049572 Ga0501036_0002878 Ga0501036_0002878_8558_9265 235
530 3300049572 Ga0501036_0024789 Ga0501036_0024789_30_737 235
531 3300049572 Ga0501036_0176644 Ga0501036_0176644_341_1048 235
532 3300049573 Ga0501037_0071846 Ga0501037_0071846_1254_1961 235
533 3300049573 Ga0501037_0141275 Ga0501037_0141275_997_1704 235
534 3300049574 Ga0501038_0022126 Ga0501038_0022126_1328_2035 235
535 3300049574 Ga0501038_0271444 Ga0501038_0271444_114_821 235
536 3300049575 Ga0501039_0003065 Ga0501039_0003065_6099_6806 235
537 3300049575 Ga0501039_0008700 Ga0501039_0008700_5529_6236 235
538 3300049575 Ga0501039_0011656 Ga0501039_0011656_1023_1730 235
539 3300049575 Ga0501039_0165130 Ga0501039_0165130_574_1281 235
540 3300049576 Ga0501040_0006377 Ga0501040_0006377_4224_4931 235
541 3300049576 Ga0501040_0015305 Ga0501040_0015305_3511_4218 235
542 3300049577 Ga0501041_0009685 Ga0501041_0009685_4147_4854 235
543 3300049577 Ga0501041_0032310 Ga0501041_0032310_2240_2947 235
544 3300049577 Ga0501041_0196945 Ga0501041_0196945_237_944 235
545 3300049578 Ga0501042_0005099 Ga0501042_0005099_4363_5070 235
546 3300049578 Ga0501042_0022473 Ga0501042_0022473_1895_2602 235
547 3300049578 Ga0501042_0046879 Ga0501042_0046879_901_1608 235
548 3300049579 Ga0501043_0194724 Ga0501043_0194724_124_831 235
549 3300049579 Ga0501043_0203376 Ga0501043_0203376_177_884 235
550 3300049580 Ga0501046_0017152 Ga0501046_0017152_5310_6017 235
551 3300049580 Ga0501046_0019020 Ga0501046_0019020_3233_3940 235
552 3300049580 Ga0501046_0020889 Ga0501046_0020889_3763_4470 235
553 3300049582 Ga0501048_0120565 Ga0501048_0120565_122_829 235
554 3300049584 Ga0501068_0012680 Ga0501068_0012680_1359_2066 235
555 3300049584 Ga0501068_0038057 Ga0501068_0038057_967_1674 235
556 3300049585 Ga0501069_0012844 Ga0501069_0012844_755_1462 235
557 3300049587 Ga0501071_0005923 Ga0501071_0005923_1942_2649 235
558 3300049588 Ga0501072_0002327 Ga0501072_0002327_1193_1900 235
559 3300049588 Ga0501072_0003758 Ga0501072_0003758_5134_5841 235
560 3300049589 Ga0501073_0046682 Ga0501073_0046682_1521_2228 235
561 3300049589 Ga0501073_0085238 Ga0501073_0085238_1382_2089 235
562 3300049589 Ga0501073_0097732 Ga0501073_0097732_454_1161 235
563 3300049590 Ga0501074_0019343 Ga0501074_0019343_90_797 235
564 3300049590 Ga0501074_0031823 Ga0501074_0031823_1368_2075 235
565 3300049590 Ga0501074_0160941 Ga0501074_0160941_258_965 235
566 3300049591 Ga0501075_0011797 Ga0501075_0011797_5363_6070 235
567 3300049591 Ga0501075_0019900 Ga0501075_0019900_2746_3453 235
568 3300049591 Ga0501075_0033917 Ga0501075_0033917_2772_3479 235
569 3300049592 Ga0501076_0002568 Ga0501076_0002568_5793_6500 235
570 3300049592 Ga0501076_0003503 Ga0501076_0003503_4830_5537 235
571 3300049592 Ga0501076_0016358 Ga0501076_0016358_3266_3973 235
572 3300049593 Ga0501077_0001034 Ga0501077_0001034_4875_5582 235
573 3300049593 Ga0501077_0002923 Ga0501077_0002923_5407_6114 235
574 3300049593 Ga0501077_0125267 Ga0501077_0125267_854_1561 235
575 3300049741 Ga0501079_0012125 Ga0501079_0012125_5461_6168 235
576 3300049741 Ga0501079_0012179 Ga0501079_0012179_4260_4967 235
577 3300049741 Ga0501079_0020392 Ga0501079_0020392_2119_2826 235
578 3300049741 Ga0501079_0132643 Ga0501079_0132643_108_815 235
579 3300049742 Ga0501080_0006433 Ga0501080_0006433_3890_4597 235
580 3300049742 Ga0501080_0013557 Ga0501080_0013557_5827_6534 235
581 3300049742 Ga0501080_0087670 Ga0501080_0087670_987_1694 235
582 3300049743 Ga0501081_0006444 Ga0501081_0006444_6033_6740 235
583 3300049743 Ga0501081_0008703 Ga0501081_0008703_1469_2176 235
584 3300049743 Ga0501081_0017081 Ga0501081_0017081_1895_2602 235
585 3300049744 Ga0501083_0017700 Ga0501083_0017700_372_1079 235
586 3300049822 Ga0501035_0009648 Ga0501035_0009648_1054_1761 235
587 3300049822 Ga0501035_0104046 Ga0501035_0104046_1448_2155 235
588 3300049824 Ga0501045_0014465 Ga0501045_0014465_4319_5026 235
589 3300049824 Ga0501045_0145399 Ga0501045_0145399_790_1497 235
590 3300050491 nmdc:mga00v17_406073_c1 nmdc:mga00v17_406073_c1_124_831 235
591 3300050492 nmdc:mga0yw44_4853_c2 nmdc:mga0yw44_4853_c2_2763_3470 235
592 3300050507 nmdc:mga05p37_5841_c2 nmdc:mga05p37_5841_c2_5051_5758 235
593 3300050511 nmdc:mga08y16_157665_c1 nmdc:mga08y16_157665_c1_291_998 235
594 3300050511 nmdc:mga08y16_578951_c1 nmdc:mga08y16_578951_c1_210_917 235
595 3300050515 nmdc:mga0a205_8363_c1 nmdc:mga0a205_8363_c1_5244_5951 235
596 3300054114 Ga0501084_0006463 Ga0501084_0006463_5967_6674 235
597 3300054114 Ga0501084_0010024 Ga0501084_0010024_1163_1870 235
598 3300054114 Ga0501084_0037042 Ga0501084_0037042_23_730 235
599 3300060353 Ga0501082_0004592 Ga0501082_0004592_5918_6625 235
600 3300060353 Ga0501082_0007538 Ga0501082_0007538_5021_5728 235
601 3300060353 Ga0501082_0046153 Ga0501082_0046153_1113_1820 235
602 3300061734 Ga0530510_0012356 Ga0530510_0012356_973_1680 235
603 3300061734 Ga0530510_0052261 Ga0530510_0052261_978_1685 235
604 3300061734 Ga0530510_0083757 Ga0530510_0083757_1299_2006 235
605 3300061734 Ga0530510_0102895 Ga0530510_0102895_1186_1893 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

36

215

0.85

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

20

214

0.84

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

19

214

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.9522 3 235
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.9467 3 235
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.944 3 235
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.9387 3 235
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.9376 3 235
ID Description Score Start End Superfamily
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9473 4 235 3.60.15.10
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9393 4 235 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9178 4 235 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9098 4 235 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8981 5 235 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W0TCX9-F1-model_v4 UPF0173 metal-dependent hydrolase H0U05_09140 0.9921 1 235 GO:0016787
AF-A0A7W0TCX9-F1-model_v4 UPF0173 metal-dependent hydrolase H0U05_09140 0.9879 1 235 GO:0016787
AF-A0A538GAP3-F1-model_v4 Metal-dependent hydrolase 0.9834 158 235
AF-A0A351B0Z3-F1-model_v4 deleted 0.9826 158 233
AF-A0A7J9YQF1-F1-model_v4 UPF0173 metal-dependent hydrolase GEU88_00955 0.981 2 234 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.6 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map