F468467
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 266 | 605 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10416626|Ga0105243_104166262 |
| Length | 249 |
| Sequence | LDEACGNPFWGTLATMATTLTWLGHAAFRIDTPAGTRIYVDPFLEGNPSCPDGEQSPERCDLVVLTHGHDDHVGDTLALAGRFSCPVVAQVELRGWLSTKGLDEDMSQSPNKGGTIRVGDVRITLTDANHSTSAFENGTFTYLGEPCGLVLRPDGGPSIYIAGDTNVFGDMALIRRLYAPDVAVLPIGDHFTMGPEEAAVAAELVGAPRVVPSHYGTFGLLTGTPDALRELLPDGVELVAPAPGETVEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 179 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 184 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 185 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 186 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 187 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 266 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.17 |
| Metatranscriptomes | 0.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 6.45 |
| Rhizosphere | 92.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilOldRDRAFT_c009932 | 3300000044 | Bacteria | 794 |
| 2 | JGI24739J22299_10035832 | 3300001989 | Bacteria | 1679 |
| 3 | JGI24743J22301_10005203 | 3300001991 | Bacteria | 2163 |
| 4 | JGI24738J21930_10005569 | 3300002075 | Bacteria | 3004 |
| 5 | JGI25406J46586_10040463 | 3300003203 | Bacteria | 1652 |
| 6 | Ga0070658_10119662 | 3300005327 | Bacteria | 2188 |
| 7 | Ga0070683_100031599 | 3300005329 | Bacteria | 4816 |
| 8 | Ga0070683_100044042 | 3300005329 | Bacteria | 4114 |
| 9 | Ga0070683_100045947 | 3300005329 | Bacteria | 4032 |
| 10 | Ga0070683_100133958 | 3300005329 | Bacteria | 2346 |
| 11 | Ga0070683_100225107 | 3300005329 | Bacteria | 1782 |
| 12 | Ga0070683_100752793 | 3300005329 | Bacteria | 933 |
| 13 | Ga0070670_100098812 | 3300005331 | Bacteria | 2512 |
| 14 | Ga0070670_100293172 | 3300005331 | Bacteria | 1422 |
| 15 | Ga0070670_100683416 | 3300005331 | Archaea | 922 |
| 16 | Ga0068869_100144702 | 3300005334 | Bacteria | 1839 |
| 17 | Ga0068869_100977688 | 3300005334 | Unclassified | 736 |
| 18 | Ga0070680_100006280 | 3300005336 | Bacteria | 9019 |
| 19 | Ga0070680_100062689 | 3300005336 | Bacteria | 3044 |
| 20 | Ga0070682_100030833 | 3300005337 | Bacteria | 3240 |
| 21 | Ga0070682_100059146 | 3300005337 | Bacteria | 2419 |
| 22 | Ga0070682_100095936 | 3300005337 | Bacteria | 1948 |
| 23 | Ga0070682_100454119 | 3300005337 | Bacteria | 982 |
| 24 | Ga0070682_100455509 | 3300005337 | Archaea | 981 |
| 25 | Ga0068868_100157542 | 3300005338 | Bacteria | 1873 |
| 26 | Ga0068868_100281276 | 3300005338 | Bacteria | 1408 |
| 27 | Ga0070660_100135498 | 3300005339 | Bacteria | 1973 |
| 28 | Ga0070689_100334267 | 3300005340 | Unclassified | 1268 |
| 29 | Ga0070691_10032236 | 3300005341 | Bacteria | 2461 |
| 30 | Ga0070691_10088808 | 3300005341 | Bacteria | 1522 |
| 31 | Ga0070661_100017514 | 3300005344 | Bacteria | 5085 |
| 32 | Ga0070661_100168985 | 3300005344 | Bacteria | 1660 |
| 33 | Ga0070668_100091866 | 3300005347 | Bacteria | 2394 |
| 34 | Ga0070668_100103335 | 3300005347 | Bacteria | 2260 |
| 35 | Ga0070675_100027707 | 3300005354 | Bacteria | 4555 |
| 36 | Ga0070675_100069322 | 3300005354 | Bacteria | 2921 |
| 37 | Ga0070674_100071031 | 3300005356 | Archaea | 2461 |
| 38 | Ga0070674_100138997 | 3300005356 | Bacteria | 1821 |
| 39 | Ga0070673_100005153 | 3300005364 | Bacteria | 8337 |
| 40 | Ga0070673_100007612 | 3300005364 | Bacteria | 7166 |
| 41 | Ga0070659_100009185 | 3300005366 | Bacteria | 7254 |
| 42 | Ga0070659_100010513 | 3300005366 | Bacteria | 6810 |
| 43 | Ga0070659_100031388 | 3300005366 | Bacteria | 4114 |
| 44 | Ga0070659_100064759 | 3300005366 | Bacteria | 2893 |
| 45 | Ga0070659_100376391 | 3300005366 | Bacteria | 1195 |
| 46 | Ga0070667_100298941 | 3300005367 | Unclassified | 1449 |
| 47 | Ga0070701_10006182 | 3300005438 | Bacteria | 5020 |
| 48 | Ga0070701_10019521 | 3300005438 | Bacteria | 3202 |
| 49 | Ga0070701_10121580 | 3300005438 | Bacteria | 1472 |
| 50 | Ga0070705_100001459 | 3300005440 | Bacteria | 12501 |
| 51 | Ga0070705_100120696 | 3300005440 | Bacteria | 1692 |
| 52 | Ga0070700_100057241 | 3300005441 | Bacteria | 2446 |
| 53 | Ga0070700_100417384 | 3300005441 | Bacteria | 1013 |
| 54 | Ga0070694_100330198 | 3300005444 | Bacteria | 1176 |
| 55 | Ga0070694_100512866 | 3300005444 | Bacteria | 956 |
| 56 | Ga0070663_100011865 | 3300005455 | Bacteria | 5491 |
| 57 | Ga0070678_100000052 | 3300005456 | Bacteria | 40622 |
| 58 | Ga0070678_100015082 | 3300005456 | Bacteria | 4899 |
| 59 | Ga0070678_100261374 | 3300005456 | Unclassified | 1456 |
| 60 | Ga0070662_100036282 | 3300005457 | Bacteria | 3486 |
| 61 | Ga0070662_100060621 | 3300005457 | Bacteria | 2759 |
| 62 | Ga0070681_10161743 | 3300005458 | Bacteria | 2163 |
| 63 | Ga0068867_100554733 | 3300005459 | Bacteria | 996 |
| 64 | Ga0070685_10007843 | 3300005466 | Bacteria | 5467 |
| 65 | Ga0070685_10062379 | 3300005466 | Bacteria | 2185 |
| 66 | Ga0070685_10283100 | 3300005466 | Bacteria | 1111 |
| 67 | Ga0070698_100102616 | 3300005471 | Unclassified | 2830 |
| 68 | Ga0070699_100070877 | 3300005518 | Bacteria | 3030 |
| 69 | Ga0070699_100699930 | 3300005518 | Bacteria | 926 |
| 70 | Ga0070679_100063253 | 3300005530 | Bacteria | 3689 |
| 71 | Ga0070679_100071314 | 3300005530 | Bacteria | 3465 |
| 72 | Ga0070679_100142937 | 3300005530 | Unclassified | 2371 |
| 73 | Ga0070679_100208506 | 3300005530 | Bacteria | 1918 |
| 74 | Ga0070679_100351783 | 3300005530 | Bacteria | 1421 |
| 75 | Ga0070684_100009821 | 3300005535 | Bacteria | 7557 |
| 76 | Ga0070684_100030081 | 3300005535 | Bacteria | 4611 |
| 77 | Ga0070684_100105826 | 3300005535 | Bacteria | 2518 |
| 78 | Ga0070684_100147719 | 3300005535 | Bacteria | 2128 |
| 79 | Ga0070684_100173337 | 3300005535 | Bacteria | 1960 |
| 80 | Ga0070684_100213617 | 3300005535 | Bacteria | 1758 |
| 81 | Ga0070684_100399143 | 3300005535 | Bacteria | 1267 |
| 82 | Ga0070697_100162445 | 3300005536 | Bacteria | 1887 |
| 83 | Ga0068853_100012719 | 3300005539 | Bacteria | 6851 |
| 84 | Ga0068853_100067239 | 3300005539 | Bacteria | 3113 |
| 85 | Ga0068853_100088341 | 3300005539 | Bacteria | 2721 |
| 86 | Ga0070672_100103175 | 3300005543 | Bacteria | 2316 |
| 87 | Ga0070672_100158549 | 3300005543 | Bacteria | 1876 |
| 88 | Ga0070686_100001674 | 3300005544 | Bacteria | 12387 |
| 89 | Ga0070686_100146896 | 3300005544 | Unclassified | 1647 |
| 90 | Ga0070686_100232857 | 3300005544 | Bacteria | 1337 |
| 91 | Ga0070696_100152127 | 3300005546 | Unclassified | 1699 |
| 92 | Ga0070696_100580628 | 3300005546 | Bacteria | 901 |
| 93 | Ga0070693_100009212 | 3300005547 | Bacteria | 4905 |
| 94 | Ga0070693_100016326 | 3300005547 | Bacteria | 3841 |
| 95 | Ga0070693_100081932 | 3300005547 | Bacteria | 1926 |
| 96 | Ga0070693_100164333 | 3300005547 | Bacteria | 1416 |
| 97 | Ga0070665_100046359 | 3300005548 | Bacteria | 4367 |
| 98 | Ga0070665_100103425 | 3300005548 | Bacteria | 2851 |
| 99 | Ga0070704_100023046 | 3300005549 | Bacteria | 4059 |
| 100 | Ga0070704_100296643 | 3300005549 | Unclassified | 1345 |
| 101 | Ga0070704_100390061 | 3300005549 | Bacteria | 1185 |
| 102 | Ga0068855_100033474 | 3300005563 | Bacteria | 6133 |
| 103 | Ga0070664_100061110 | 3300005564 | Bacteria | 3210 |
| 104 | Ga0070664_100071615 | 3300005564 | Bacteria | 2971 |
| 105 | Ga0070664_100096048 | 3300005564 | Bacteria | 2571 |
| 106 | Ga0070664_100603663 | 3300005564 | Unclassified | 1018 |
| 107 | Ga0068857_100030114 | 3300005577 | Bacteria | 4789 |
| 108 | Ga0068857_100156668 | 3300005577 | Bacteria | 2065 |
| 109 | Ga0068854_100066826 | 3300005578 | Bacteria | 2617 |
| 110 | Ga0068854_100137398 | 3300005578 | Bacteria | 1872 |
| 111 | Ga0068856_100032298 | 3300005614 | Bacteria | 5125 |
| 112 | Ga0068856_100094815 | 3300005614 | Bacteria | 2972 |
| 113 | Ga0070702_100044763 | 3300005615 | Bacteria | 2500 |
| 114 | Ga0070702_100052912 | 3300005615 | Bacteria | 2330 |
| 115 | Ga0070702_100058184 | 3300005615 | Bacteria | 2238 |
| 116 | Ga0070702_100105698 | 3300005615 | Bacteria | 1735 |
| 117 | Ga0070702_100223072 | 3300005615 | Bacteria | 1261 |
| 118 | Ga0068852_100558112 | 3300005616 | Archaea | 1146 |
| 119 | Ga0068859_100094205 | 3300005617 | Bacteria | 3047 |
| 120 | Ga0068864_100019754 | 3300005618 | Bacteria | 5634 |
| 121 | Ga0068866_10008968 | 3300005718 | Bacteria | 4235 |
| 122 | Ga0068866_10076202 | 3300005718 | Bacteria | 1788 |
| 123 | Ga0068866_10157838 | 3300005718 | Unclassified | 1320 |
| 124 | Ga0068866_10357162 | 3300005718 | Bacteria | 930 |
| 125 | Ga0068861_100028780 | 3300005719 | Bacteria | 4056 |
| 126 | Ga0068851_10009084 | 3300005834 | Bacteria | 4613 |
| 127 | Ga0068870_10016192 | 3300005840 | Bacteria | 3556 |
| 128 | Ga0068870_10059327 | 3300005840 | Bacteria | 2051 |
| 129 | Ga0068863_100110603 | 3300005841 | Bacteria | 2616 |
| 130 | Ga0068858_100047996 | 3300005842 | Bacteria | 3958 |
| 131 | Ga0068858_100206649 | 3300005842 | Bacteria | 1858 |
| 132 | Ga0068858_100230765 | 3300005842 | Unclassified | 1755 |
| 133 | Ga0068860_100027023 | 3300005843 | Bacteria | 5530 |
| 134 | Ga0068860_100446760 | 3300005843 | Bacteria | 1285 |
| 135 | Ga0068862_100131730 | 3300005844 | Bacteria | 2212 |
| 136 | Ga0081455_10013098 | 3300005937 | Bacteria | 8220 |
| 137 | Ga0081455_10026506 | 3300005937 | Bacteria | 5327 |
| 138 | Ga0081455_10411539 | 3300005937 | Unclassified | 935 |
| 139 | Ga0081538_10031464 | 3300005981 | Bacteria | 3578 |
| 140 | Ga0081539_10000200 | 3300005985 | Bacteria | 139291 |
| 141 | Ga0075364_10020761 | 3300006051 | Unclassified | 4133 |
| 142 | Ga0075364_10149290 | 3300006051 | Bacteria | 1575 |
| 143 | Ga0075432_10018362 | 3300006058 | Bacteria | 2386 |
| 144 | Ga0070715_10019378 | 3300006163 | Bacteria | 2609 |
| 145 | Ga0097621_100026124 | 3300006237 | Bacteria | 4577 |
| 146 | Ga0068871_100046109 | 3300006358 | Bacteria | 3510 |
| 147 | Ga0068871_100314221 | 3300006358 | Bacteria | 1378 |
| 148 | Ga0068871_100506477 | 3300006358 | Archaea | 1089 |
| 149 | Ga0075428_100260262 | 3300006844 | Bacteria | 1868 |
| 150 | Ga0075428_100469626 | 3300006844 | Archaea | 1347 |
| 151 | Ga0075431_100713536 | 3300006847 | Bacteria | 980 |
| 152 | Ga0075433_10118193 | 3300006852 | Bacteria | 2353 |
| 153 | Ga0075433_10924960 | 3300006852 | Bacteria | 760 |
| 154 | Ga0068865_100008991 | 3300006881 | Bacteria | 6181 |
| 155 | Ga0068865_100031732 | 3300006881 | Bacteria | 3524 |
| 156 | Ga0097620_100094200 | 3300006931 | Bacteria | 3047 |
| 157 | Ga0105240_10245173 | 3300009093 | Bacteria | 2075 |
| 158 | Ga0111539_10157964 | 3300009094 | Bacteria | 2653 |
| 159 | Ga0111539_10833348 | 3300009094 | Bacteria | 1073 |
| 160 | Ga0105245_10023597 | 3300009098 | Bacteria | 5400 |
| 161 | Ga0105245_10046418 | 3300009098 | Bacteria | 3882 |
| 162 | Ga0105245_10070046 | 3300009098 | Bacteria | 3181 |
| 163 | Ga0105245_10143776 | 3300009098 | Bacteria | 2249 |
| 164 | Ga0105245_10978751 | 3300009098 | Bacteria | 890 |
| 165 | Ga0114129_10038780 | 3300009147 | Bacteria | 6716 |
| 166 | Ga0114129_10131500 | 3300009147 | Unclassified | 3436 |
| 167 | Ga0114129_11421874 | 3300009147 | Bacteria | 855 |
| 168 | Ga0114129_11518467 | 3300009147 | Unclassified | 822 |
| 169 | Ga0105243_10007909 | 3300009148 | Bacteria | 8165 |
| 170 | Ga0105243_10009015 | 3300009148 | Bacteria | 7623 |
| 171 | Ga0105243_10023935 | 3300009148 | Bacteria | 4654 |
| 172 | Ga0105243_10097084 | 3300009148 | Bacteria | 2439 |
| 173 | Ga0105243_10164351 | 3300009148 | Bacteria | 1917 |
| 174 | Ga0105243_10416626 | 3300009148 | Archaea | 1251 |
| 175 | Ga0105241_10100207 | 3300009174 | Bacteria | 2302 |
| 176 | Ga0105241_10159922 | 3300009174 | Bacteria | 1851 |
| 177 | Ga0105242_10009065 | 3300009176 | Bacteria | 7645 |
| 178 | Ga0105242_10040774 | 3300009176 | Bacteria | 3742 |
| 179 | Ga0105242_10557308 | 3300009176 | Bacteria | 1100 |
| 180 | Ga0105242_11187675 | 3300009176 | Archaea | 781 |
| 181 | Ga0105248_10015219 | 3300009177 | Bacteria | 8476 |
| 182 | Ga0105248_10024950 | 3300009177 | Bacteria | 6645 |
| 183 | Ga0105248_10045330 | 3300009177 | Bacteria | 4932 |
| 184 | Ga0105248_11043442 | 3300009177 | Bacteria | 924 |
| 185 | Ga0105237_10390820 | 3300009545 | Unclassified | 1396 |
| 186 | Ga0105238_10160285 | 3300009551 | Bacteria | 2225 |
| 187 | Ga0105238_10252584 | 3300009551 | Unclassified | 1742 |
| 188 | Ga0105249_10085675 | 3300009553 | Bacteria | 2937 |
| 189 | Ga0105249_10641698 | 3300009553 | Bacteria | 1119 |
| 190 | Ga0105249_10687761 | 3300009553 | Unclassified | 1082 |
| 191 | Ga0105239_10031030 | 3300010375 | Bacteria | 5879 |
| 192 | Ga0105239_10250057 | 3300010375 | Bacteria | 1991 |
| 193 | Ga0105246_10008656 | 3300011119 | Bacteria | 6257 |
| 194 | Ga0105246_10111951 | 3300011119 | Bacteria | 2007 |
| 195 | Ga0157371_10029676 | 3300013102 | Bacteria | 3952 |
| 196 | Ga0157371_10137294 | 3300013102 | Bacteria | 1741 |
| 197 | Ga0157369_10013890 | 3300013105 | Bacteria | 9097 |
| 198 | Ga0157369_10102394 | 3300013105 | Bacteria | 3052 |
| 199 | Ga0157378_10001752 | 3300013297 | Bacteria | 19468 |
| 200 | Ga0163162_10259427 | 3300013306 | Bacteria | 1870 |
| 201 | Ga0157372_10049404 | 3300013307 | Bacteria | 4677 |
| 202 | Ga0157372_10124270 | 3300013307 | Bacteria | 2966 |
| 203 | Ga0157372_10287824 | 3300013307 | Bacteria | 1911 |
| 204 | Ga0157375_10064949 | 3300013308 | Bacteria | 3636 |
| 205 | Ga0157375_10072916 | 3300013308 | Bacteria | 3451 |
| 206 | Ga0157375_10080233 | 3300013308 | Bacteria | 3300 |
| 207 | Ga0157375_10654906 | 3300013308 | Bacteria | 1206 |
| 208 | Ga0163163_10245031 | 3300014325 | Archaea | 1842 |
| 209 | Ga0157380_10000820 | 3300014326 | Bacteria | 19481 |
| 210 | Ga0157380_10573076 | 3300014326 | Archaea | 1112 |
| 211 | Ga0182008_10197189 | 3300014497 | Bacteria | 1023 |
| 212 | Ga0157377_10005680 | 3300014745 | Bacteria | 5879 |
| 213 | Ga0157377_10009457 | 3300014745 | Bacteria | 4782 |
| 214 | Ga0157377_10015087 | 3300014745 | Bacteria | 3943 |
| 215 | Ga0157377_10111314 | 3300014745 | Bacteria | 1646 |
| 216 | Ga0157377_10406336 | 3300014745 | Unclassified | 929 |
| 217 | Ga0157379_10009631 | 3300014968 | Bacteria | 8410 |
| 218 | Ga0157379_10059591 | 3300014968 | Bacteria | 3413 |
| 219 | Ga0157379_10094192 | 3300014968 | Bacteria | 2687 |
| 220 | Ga0157376_10014368 | 3300014969 | Bacteria | 5941 |
| 221 | Ga0157376_10036180 | 3300014969 | Bacteria | 3998 |
| 222 | Ga0157376_10211245 | 3300014969 | Bacteria | 1792 |
| 223 | Ga0163161_10053935 | 3300017792 | Bacteria | 2916 |
| 224 | Ga0206351_10482556 | 3300020077 | Bacteria | 868 |
| 225 | Ga0206350_11107442 | 3300020080 | Bacteria | 889 |
| 226 | Ga0206354_11183149 | 3300020081 | Bacteria | 1559 |
| 227 | Ga0206353_10994781 | 3300020082 | Bacteria | 956 |
| 228 | Ga0206353_11119996 | 3300020082 | Bacteria | 6428 |
| 229 | Ga0207653_10066552 | 3300025885 | Bacteria | 1224 |
| 230 | Ga0207642_10005610 | 3300025899 | Bacteria | 4108 |
| 231 | Ga0207688_10001403 | 3300025901 | Bacteria | 12559 |
| 232 | Ga0207688_10006162 | 3300025901 | Bacteria | 6527 |
| 233 | Ga0207688_10194107 | 3300025901 | Bacteria | 1215 |
| 234 | Ga0207680_10288812 | 3300025903 | Unclassified | 1141 |
| 235 | Ga0207647_10199761 | 3300025904 | Bacteria | 1157 |
| 236 | Ga0207685_10280871 | 3300025905 | Bacteria | 817 |
| 237 | Ga0207645_10023350 | 3300025907 | Unclassified | 4020 |
| 238 | Ga0207643_10033044 | 3300025908 | Bacteria | 2894 |
| 239 | Ga0207643_10114507 | 3300025908 | Bacteria | 1591 |
| 240 | Ga0207705_10065729 | 3300025909 | Bacteria | 2622 |
| 241 | Ga0207707_10238996 | 3300025912 | Unclassified | 1579 |
| 242 | Ga0207707_10253793 | 3300025912 | Bacteria | 1527 |
| 243 | Ga0207695_10056425 | 3300025913 | Bacteria | 4086 |
| 244 | Ga0207660_10049258 | 3300025917 | Bacteria | 2985 |
| 245 | Ga0207662_10067432 | 3300025918 | Bacteria | 2158 |
| 246 | Ga0207662_10107962 | 3300025918 | Bacteria | 1732 |
| 247 | Ga0207657_10001010 | 3300025919 | Bacteria | 29952 |
| 248 | Ga0207657_10059901 | 3300025919 | Bacteria | 3269 |
| 249 | Ga0207657_10186079 | 3300025919 | Bacteria | 1677 |
| 250 | Ga0207657_10265952 | 3300025919 | Unclassified | 1364 |
| 251 | Ga0207649_10034246 | 3300025920 | Bacteria | 3041 |
| 252 | Ga0207649_10035028 | 3300025920 | Bacteria | 3013 |
| 253 | Ga0207649_10166286 | 3300025920 | Bacteria | 1532 |
| 254 | Ga0207652_10064630 | 3300025921 | Bacteria | 3166 |
| 255 | Ga0207694_10155637 | 3300025924 | Bacteria | 1843 |
| 256 | Ga0207694_10297908 | 3300025924 | Bacteria | 1327 |
| 257 | Ga0207650_10096434 | 3300025925 | Unclassified | 2269 |
| 258 | Ga0207650_10112424 | 3300025925 | Bacteria | 2110 |
| 259 | Ga0207687_10008752 | 3300025927 | Bacteria | 6614 |
| 260 | Ga0207687_10102095 | 3300025927 | Bacteria | 2112 |
| 261 | Ga0207687_10136027 | 3300025927 | Bacteria | 1859 |
| 262 | Ga0207690_10069688 | 3300025932 | Bacteria | 2420 |
| 263 | Ga0207706_10023980 | 3300025933 | Bacteria | 5474 |
| 264 | Ga0207706_10033910 | 3300025933 | Bacteria | 4544 |
| 265 | Ga0207706_10039259 | 3300025933 | Bacteria | 4196 |
| 266 | Ga0207706_10051168 | 3300025933 | Bacteria | 3649 |
| 267 | Ga0207686_10074483 | 3300025934 | Bacteria | 2194 |
| 268 | Ga0207686_10159028 | 3300025934 | Bacteria | 1581 |
| 269 | Ga0207686_10178591 | 3300025934 | Bacteria | 1503 |
| 270 | Ga0207686_10247646 | 3300025934 | Bacteria | 1300 |
| 271 | Ga0207686_10316933 | 3300025934 | Unclassified | 1164 |
| 272 | Ga0207709_10022156 | 3300025935 | Bacteria | 3601 |
| 273 | Ga0207709_10022551 | 3300025935 | Bacteria | 3572 |
| 274 | Ga0207709_10023219 | 3300025935 | Bacteria | 3528 |
| 275 | Ga0207709_10083159 | 3300025935 | Bacteria | 2069 |
| 276 | Ga0207709_10274812 | 3300025935 | Bacteria | 1242 |
| 277 | Ga0207669_10019183 | 3300025937 | Bacteria | 3554 |
| 278 | Ga0207669_10198467 | 3300025937 | Bacteria | 1454 |
| 279 | Ga0207704_10029907 | 3300025938 | Bacteria | 3046 |
| 280 | Ga0207704_10710805 | 3300025938 | Bacteria | 833 |
| 281 | Ga0207665_10391597 | 3300025939 | Bacteria | 1056 |
| 282 | Ga0207691_10010456 | 3300025940 | Bacteria | 8903 |
| 283 | Ga0207691_10026609 | 3300025940 | Bacteria | 5428 |
| 284 | Ga0207691_10096134 | 3300025940 | Bacteria | 2649 |
| 285 | Ga0207691_10513083 | 3300025940 | Bacteria | 1018 |
| 286 | Ga0207711_10023268 | 3300025941 | Bacteria | 5185 |
| 287 | Ga0207711_10123290 | 3300025941 | Bacteria | 2316 |
| 288 | Ga0207711_10222058 | 3300025941 | Bacteria | 1728 |
| 289 | Ga0207711_10409906 | 3300025941 | Unclassified | 1260 |
| 290 | Ga0207711_10543187 | 3300025941 | Archaea | 1084 |
| 291 | Ga0207689_10047479 | 3300025942 | Bacteria | 3544 |
| 292 | Ga0207661_10002116 | 3300025944 | Bacteria | 13667 |
| 293 | Ga0207661_10102126 | 3300025944 | Bacteria | 2410 |
| 294 | Ga0207661_10117674 | 3300025944 | Bacteria | 2258 |
| 295 | Ga0207661_10123419 | 3300025944 | Bacteria | 2209 |
| 296 | Ga0207661_10259337 | 3300025944 | Bacteria | 1548 |
| 297 | Ga0207661_10391893 | 3300025944 | Bacteria | 1258 |
| 298 | Ga0207679_10135944 | 3300025945 | Bacteria | 1979 |
| 299 | Ga0207679_10240673 | 3300025945 | Bacteria | 1533 |
| 300 | Ga0207679_10303011 | 3300025945 | Bacteria | 1378 |
| 301 | Ga0207679_10356303 | 3300025945 | Unclassified | 1277 |
| 302 | Ga0207667_10285817 | 3300025949 | Unclassified | 1685 |
| 303 | Ga0207667_10649629 | 3300025949 | Bacteria | 1060 |
| 304 | Ga0207651_10042627 | 3300025960 | Bacteria | 3022 |
| 305 | Ga0207712_10049006 | 3300025961 | Bacteria | 2941 |
| 306 | Ga0207712_10336470 | 3300025961 | Bacteria | 1250 |
| 307 | Ga0207668_10082938 | 3300025972 | Bacteria | 2331 |
| 308 | Ga0207640_10076045 | 3300025981 | Bacteria | 2278 |
| 309 | Ga0207658_10059380 | 3300025986 | Bacteria | 2850 |
| 310 | Ga0207677_10233022 | 3300026023 | Bacteria | 1484 |
| 311 | Ga0207677_10438266 | 3300026023 | Bacteria | 1117 |
| 312 | Ga0207677_10571710 | 3300026023 | Bacteria | 988 |
| 313 | Ga0207703_10108622 | 3300026035 | Bacteria | 2363 |
| 314 | Ga0207703_10742213 | 3300026035 | Archaea | 935 |
| 315 | Ga0207639_10066505 | 3300026041 | Bacteria | 2802 |
| 316 | Ga0207639_10070000 | 3300026041 | Bacteria | 2739 |
| 317 | Ga0207639_10204830 | 3300026041 | Bacteria | 1694 |
| 318 | Ga0207639_10568360 | 3300026041 | Archaea | 1043 |
| 319 | Ga0207678_10025385 | 3300026067 | Bacteria | 5173 |
| 320 | Ga0207678_10482932 | 3300026067 | Bacteria | 1079 |
| 321 | Ga0207708_10026938 | 3300026075 | Bacteria | 4353 |
| 322 | Ga0207708_10029313 | 3300026075 | Bacteria | 4171 |
| 323 | Ga0207708_10210356 | 3300026075 | Unclassified | 1555 |
| 324 | Ga0207708_10405516 | 3300026075 | Bacteria | 1128 |
| 325 | Ga0207702_10094097 | 3300026078 | Bacteria | 2630 |
| 326 | Ga0207702_10115772 | 3300026078 | Bacteria | 2391 |
| 327 | Ga0207641_10324022 | 3300026088 | Unclassified | 1462 |
| 328 | Ga0207648_10023616 | 3300026089 | Bacteria | 5505 |
| 329 | Ga0207648_10043885 | 3300026089 | Bacteria | 3924 |
| 330 | Ga0207648_10082064 | 3300026089 | Bacteria | 2811 |
| 331 | Ga0207648_10194353 | 3300026089 | Bacteria | 1799 |
| 332 | Ga0207648_10523448 | 3300026089 | Bacteria | 1087 |
| 333 | Ga0207648_10592160 | 3300026089 | Archaea | 1021 |
| 334 | Ga0207674_10017040 | 3300026116 | Bacteria | 7931 |
| 335 | Ga0207674_10027394 | 3300026116 | Bacteria | 6028 |
| 336 | Ga0207674_10248810 | 3300026116 | Bacteria | 1724 |
| 337 | Ga0207674_10332750 | 3300026116 | Bacteria | 1468 |
| 338 | Ga0207674_10653180 | 3300026116 | Unclassified | 1016 |
| 339 | Ga0207675_100014934 | 3300026118 | Bacteria | 7249 |
| 340 | Ga0207675_100129978 | 3300026118 | Bacteria | 2388 |
| 341 | Ga0207683_10000088 | 3300026121 | Bacteria | 72940 |
| 342 | Ga0207683_10003610 | 3300026121 | Bacteria | 13485 |
| 343 | Ga0207683_10016673 | 3300026121 | Bacteria | 6252 |
| 344 | Ga0207683_10205089 | 3300026121 | Bacteria | 1793 |
| 345 | Ga0207683_10346410 | 3300026121 | Bacteria | 1363 |
| 346 | Ga0207698_10073734 | 3300026142 | Bacteria | 2719 |
| 347 | Ga0207698_10559089 | 3300026142 | Bacteria | 1123 |
| 348 | Ga0207698_10629085 | 3300026142 | Archaea | 1061 |
| 349 | Ga0207428_10000244 | 3300027907 | Bacteria | 74209 |
| 350 | Ga0207428_10050859 | 3300027907 | Bacteria | 3313 |
| 351 | Ga0207428_10149851 | 3300027907 | Bacteria | 1776 |
| 352 | Ga0268266_10067580 | 3300028379 | Bacteria | 3094 |
| 353 | Ga0268265_10132980 | 3300028380 | Bacteria | 2071 |
| 354 | Ga0268265_10615168 | 3300028380 | Bacteria | 1040 |
| 355 | Ga0268264_10104619 | 3300028381 | Bacteria | 2467 |
| 356 | Ga0265319_1015620 | 3300028563 | Bacteria | 2938 |
| 357 | Ga0265318_10008787 | 3300028577 | Bacteria | 4474 |
| 358 | Ga0265338_10070748 | 3300028800 | Bacteria | 2989 |
| 359 | Ga0265320_10014826 | 3300031240 | Bacteria | 4421 |
| 360 | Ga0265320_10070740 | 3300031240 | Bacteria | 1645 |
| 361 | Ga0265320_10100366 | 3300031240 | Bacteria | 1333 |
| 362 | Ga0265340_10076615 | 3300031247 | Bacteria | 1579 |
| 363 | Ga0307408_100223764 | 3300031548 | Unclassified | 1537 |
| 364 | Ga0265313_10107135 | 3300031595 | Unclassified | 1233 |
| 365 | Ga0307405_10388174 | 3300031731 | Bacteria | 1089 |
| 366 | Ga0307410_10543068 | 3300031852 | Bacteria | 962 |
| 367 | Ga0307406_10818474 | 3300031901 | Bacteria | 787 |
| 368 | Ga0307407_10095402 | 3300031903 | Bacteria | 1834 |
| 369 | Ga0307409_100060552 | 3300031995 | Bacteria | 2953 |
| 370 | Ga0373938_0035511 | 3300034957 | Bacteria | 1087 |
| 371 | Ga0373954_0053157 | 3300035118 | Bacteria | 1904 |
| 372 | Ga0373960_0002607 | 3300035121 | Bacteria | 4073 |
| 373 | Ga0373931_0101830 | 3300035691 | Bacteria | 1616 |
| 374 | Ga0373925_0187262 | 3300037068 | Bacteria | 1641 |
| 375 | Ga0395900_0219544 | 3300037418 | Unclassified | 1917 |
| 376 | Ga0395898_0406647 | 3300037466 | Bacteria | 1298 |
| 377 | Ga0395901_0454210 | 3300038443 | Bacteria | 1310 |
| 378 | Ga0395901_0790099 | 3300038443 | Unclassified | 939 |
| 379 | Ga0451807_1742402 | 3300041486 | Bacteria | 1223 |
| 380 | Ga0439445_0062318 | 3300042004 | Bacteria | 1022 |
| 381 | Ga0439448_0113386 | 3300042005 | Bacteria | 927 |
| 382 | Ga0439432_104426 | 3300042006 | Bacteria | 846 |
| 383 | Ga0439449_0079620 | 3300042007 | Bacteria | 1208 |
| 384 | Ga0439462_0007795 | 3300042015 | Bacteria | 2687 |
| 385 | Ga0450914_000276 | 3300042118 | Bacteria | 2128 |
| 386 | Ga0450906_012059 | 3300042145 | Bacteria | 1606 |
| 387 | Ga0439446_0001483 | 3300042156 | Bacteria | 5361 |
| 388 | Ga0439459_0020854 | 3300042438 | Bacteria | 1254 |
| 389 | Ga0466966_0013574 | 3300044684 | Bacteria | 5391 |
| 390 | Ga0466961_0040354 | 3300044693 | Bacteria | 2993 |
| 391 | Ga0466961_0218860 | 3300044693 | Bacteria | 1174 |
| 392 | Ga0466963_0108183 | 3300044694 | Bacteria | 1907 |
| 393 | Ga0466963_0256828 | 3300044694 | Unclassified | 1227 |
| 394 | Ga0466957_0396843 | 3300044842 | Bacteria | 943 |
| 395 | Ga0466959_0040893 | 3300045049 | Bacteria | 3424 |
| 396 | Ga0466967_0256603 | 3300045976 | Bacteria | 1672 |
| 397 | Ga0466967_0440093 | 3300045976 | Bacteria | 1273 |
| 398 | Ga0495603_0006748 | 3300046455 | Bacteria | 6889 |
| 399 | Ga0495603_0030234 | 3300046455 | Bacteria | 3263 |
| 400 | Ga0495603_0086270 | 3300046455 | Bacteria | 1837 |
| 401 | Ga0495641_0090870 | 3300046461 | Bacteria | 1364 |
| 402 | Ga0495582_0122111 | 3300046473 | Unclassified | 1468 |
| 403 | Ga0495596_0144180 | 3300046500 | Unclassified | 925 |
| 404 | Ga0495637_0093037 | 3300046520 | Bacteria | 1187 |
| 405 | Ga0495644_0091114 | 3300046523 | Unclassified | 1151 |
| 406 | Ga0495656_0013806 | 3300046615 | Bacteria | 3014 |
| 407 | Ga0495634_0188294 | 3300046642 | Bacteria | 1289 |
| 408 | Ga0495659_0175426 | 3300046664 | Unclassified | 871 |
| 409 | Ga0495658_0157095 | 3300046683 | Bacteria | 1400 |
| 410 | Ga0495604_0315596 | 3300047317 | Bacteria | 1046 |
| 411 | Ga0495602_0523589 | 3300048088 | Bacteria | 825 |
| 412 | Ga0496100_0083321 | 3300048903 | Bacteria | 2165 |
| 413 | Ga0496101_0001935 | 3300048904 | Bacteria | 12535 |
| 414 | Ga0496101_0116460 | 3300048904 | Bacteria | 2016 |
| 415 | Ga0496102_0262912 | 3300048905 | Unclassified | 1627 |
| 416 | Ga0496102_0309936 | 3300048905 | Bacteria | 1487 |
| 417 | Ga0496103_0016856 | 3300048906 | Bacteria | 4363 |
| 418 | Ga0496104_0075582 | 3300048907 | Bacteria | 3208 |
| 419 | Ga0496105_0001655 | 3300048908 | Bacteria | 15880 |
| 420 | Ga0496105_0110301 | 3300048908 | Bacteria | 2271 |
| 421 | Ga0496105_0465631 | 3300048908 | Unclassified | 996 |
| 422 | Ga0496106_0067900 | 3300048909 | Bacteria | 2719 |
| 423 | Ga0496106_0236419 | 3300048909 | Archaea | 1460 |
| 424 | Ga0496107_0011271 | 3300048910 | Bacteria | 6221 |
| 425 | Ga0496107_0241251 | 3300048910 | Archaea | 1345 |
| 426 | Ga0496108_0009092 | 3300048911 | Bacteria | 8046 |
| 427 | Ga0496108_0024449 | 3300048911 | Bacteria | 4973 |
| 428 | Ga0496108_0063926 | 3300048911 | Bacteria | 3099 |
| 429 | Ga0496108_0213713 | 3300048911 | Bacteria | 1674 |
| 430 | Ga0496109_0008352 | 3300048912 | Bacteria | 8797 |
| 431 | Ga0496109_0128506 | 3300048912 | Bacteria | 2364 |
| 432 | Ga0496109_0293917 | 3300048912 | Bacteria | 1532 |
| 433 | Ga0496110_0013159 | 3300048913 | Bacteria | 6831 |
| 434 | Ga0496110_0060184 | 3300048913 | Bacteria | 3349 |
| 435 | Ga0496110_0074971 | 3300048913 | Bacteria | 3006 |
| 436 | Ga0496110_0084249 | 3300048913 | Bacteria | 2837 |
| 437 | Ga0496111_0002857 | 3300048914 | Bacteria | 10543 |
| 438 | Ga0496111_0023990 | 3300048914 | Bacteria | 4288 |
| 439 | Ga0496111_0122453 | 3300048914 | Unclassified | 1921 |
| 440 | Ga0496112_0020518 | 3300048915 | Bacteria | 6265 |
| 441 | Ga0496112_0414650 | 3300048915 | Archaea | 1286 |
| 442 | Ga0496112_0900082 | 3300048915 | Bacteria | 807 |
| 443 | Ga0496113_0053237 | 3300048916 | Bacteria | 3026 |
| 444 | Ga0496114_0035638 | 3300048917 | Bacteria | 4109 |
| 445 | Ga0496114_0079772 | 3300048917 | Bacteria | 2764 |
| 446 | Ga0496114_0087087 | 3300048917 | Bacteria | 2648 |
| 447 | Ga0496114_0138237 | 3300048917 | Bacteria | 2107 |
| 448 | Ga0496114_0411360 | 3300048917 | Bacteria | 1198 |
| 449 | Ga0496114_0418944 | 3300048917 | Bacteria | 1186 |
| 450 | Ga0501031_0015535 | 3300049568 | Bacteria | 4942 |
| 451 | Ga0501031_0026848 | 3300049568 | Bacteria | 3753 |
| 452 | Ga0501031_0052869 | 3300049568 | Bacteria | 2646 |
| 453 | Ga0501032_0031634 | 3300049569 | Bacteria | 3627 |
| 454 | Ga0501032_0063572 | 3300049569 | Bacteria | 2471 |
| 455 | Ga0501032_0180072 | 3300049569 | Bacteria | 1384 |
| 456 | Ga0501033_0022921 | 3300049570 | Bacteria | 4707 |
| 457 | Ga0501033_0050721 | 3300049570 | Bacteria | 3077 |
| 458 | Ga0501033_0152906 | 3300049570 | Bacteria | 1664 |
| 459 | Ga0501034_0068007 | 3300049571 | Bacteria | 3574 |
| 460 | Ga0501034_0186625 | 3300049571 | Bacteria | 2037 |
| 461 | Ga0501036_0002878 | 3300049572 | Bacteria | 13648 |
| 462 | Ga0501036_0007924 | 3300049572 | Bacteria | 8692 |
| 463 | Ga0501036_0024789 | 3300049572 | Bacteria | 5058 |
| 464 | Ga0501036_0176644 | 3300049572 | Bacteria | 1798 |
| 465 | Ga0501037_0071846 | 3300049573 | Bacteria | 2517 |
| 466 | Ga0501037_0141275 | 3300049573 | Bacteria | 1723 |
| 467 | Ga0501038_0022126 | 3300049574 | Bacteria | 5699 |
| 468 | Ga0501038_0037681 | 3300049574 | Bacteria | 4238 |
| 469 | Ga0501038_0099779 | 3300049574 | Bacteria | 2420 |
| 470 | Ga0501038_0271444 | 3300049574 | Bacteria | 1337 |
| 471 | Ga0501039_0003065 | 3300049575 | Bacteria | 12496 |
| 472 | Ga0501039_0008700 | 3300049575 | Bacteria | 7728 |
| 473 | Ga0501039_0011656 | 3300049575 | Bacteria | 6695 |
| 474 | Ga0501039_0052617 | 3300049575 | Bacteria | 3150 |
| 475 | Ga0501039_0077813 | 3300049575 | Bacteria | 2579 |
| 476 | Ga0501039_0165130 | 3300049575 | Bacteria | 1741 |
| 477 | Ga0501039_0173222 | 3300049575 | Archaea | 1697 |
| 478 | Ga0501040_0006377 | 3300049576 | Bacteria | 7656 |
| 479 | Ga0501040_0015305 | 3300049576 | Bacteria | 5071 |
| 480 | Ga0501040_0510060 | 3300049576 | Bacteria | 867 |
| 481 | Ga0501041_0009685 | 3300049577 | Bacteria | 5678 |
| 482 | Ga0501041_0014045 | 3300049577 | Bacteria | 4753 |
| 483 | Ga0501041_0032310 | 3300049577 | Bacteria | 3163 |
| 484 | Ga0501041_0073589 | 3300049577 | Bacteria | 2099 |
| 485 | Ga0501041_0196945 | 3300049577 | Bacteria | 1262 |
| 486 | Ga0501042_0005099 | 3300049578 | Bacteria | 8427 |
| 487 | Ga0501042_0022473 | 3300049578 | Bacteria | 4406 |
| 488 | Ga0501042_0046879 | 3300049578 | Bacteria | 3081 |
| 489 | Ga0501042_0091668 | 3300049578 | Bacteria | 2181 |
| 490 | Ga0501042_0617039 | 3300049578 | Archaea | 788 |
| 491 | Ga0501043_0194724 | 3300049579 | Bacteria | 1575 |
| 492 | Ga0501043_0203376 | 3300049579 | Bacteria | 1536 |
| 493 | Ga0501046_0017152 | 3300049580 | Bacteria | 6051 |
| 494 | Ga0501046_0019020 | 3300049580 | Bacteria | 5701 |
| 495 | Ga0501046_0020889 | 3300049580 | Bacteria | 5407 |
| 496 | Ga0501046_0089731 | 3300049580 | Bacteria | 2365 |
| 497 | Ga0501046_0184611 | 3300049580 | Bacteria | 1558 |
| 498 | Ga0501048_0038176 | 3300049582 | Bacteria | 3447 |
| 499 | Ga0501048_0120565 | 3300049582 | Bacteria | 1853 |
| 500 | Ga0501067_0000374 | 3300049583 | Bacteria | 24367 |
| 501 | Ga0501067_0170092 | 3300049583 | Unclassified | 1214 |
| 502 | Ga0501068_0007668 | 3300049584 | Bacteria | 5972 |
| 503 | Ga0501068_0012680 | 3300049584 | Bacteria | 4784 |
| 504 | Ga0501068_0038057 | 3300049584 | Bacteria | 2880 |
| 505 | Ga0501069_0012844 | 3300049585 | Bacteria | 4459 |
| 506 | Ga0501069_0053764 | 3300049585 | Bacteria | 2242 |
| 507 | Ga0501070_0019174 | 3300049586 | Bacteria | 5737 |
| 508 | Ga0501070_0231463 | 3300049586 | Archaea | 1514 |
| 509 | Ga0501070_0481720 | 3300049586 | Bacteria | 998 |
| 510 | Ga0501071_0005923 | 3300049587 | Bacteria | 7909 |
| 511 | Ga0501071_0096896 | 3300049587 | Bacteria | 2171 |
| 512 | Ga0501071_0117140 | 3300049587 | Bacteria | 1972 |
| 513 | Ga0501071_0233063 | 3300049587 | Unclassified | 1387 |
| 514 | Ga0501072_0002327 | 3300049588 | Bacteria | 14252 |
| 515 | Ga0501072_0003758 | 3300049588 | Bacteria | 11459 |
| 516 | Ga0501072_0007152 | 3300049588 | Bacteria | 8467 |
| 517 | Ga0501072_0033001 | 3300049588 | Bacteria | 4055 |
| 518 | Ga0501073_0046682 | 3300049589 | Bacteria | 3045 |
| 519 | Ga0501073_0085238 | 3300049589 | Bacteria | 2198 |
| 520 | Ga0501073_0097732 | 3300049589 | Bacteria | 2039 |
| 521 | Ga0501073_0311730 | 3300049589 | Bacteria | 1085 |
| 522 | Ga0501074_0019343 | 3300049590 | Bacteria | 4947 |
| 523 | Ga0501074_0031823 | 3300049590 | Bacteria | 3822 |
| 524 | Ga0501074_0049329 | 3300049590 | Bacteria | 3039 |
| 525 | Ga0501074_0095028 | 3300049590 | Bacteria | 2134 |
| 526 | Ga0501074_0160941 | 3300049590 | Bacteria | 1603 |
| 527 | Ga0501075_0004047 | 3300049591 | Bacteria | 9893 |
| 528 | Ga0501075_0011797 | 3300049591 | Bacteria | 6196 |
| 529 | Ga0501075_0019900 | 3300049591 | Bacteria | 4874 |
| 530 | Ga0501075_0033917 | 3300049591 | Bacteria | 3798 |
| 531 | Ga0501075_0176841 | 3300049591 | Bacteria | 1628 |
| 532 | Ga0501075_0182154 | 3300049591 | Bacteria | 1602 |
| 533 | Ga0501075_0199524 | 3300049591 | Bacteria | 1526 |
| 534 | Ga0501076_0002568 | 3300049592 | Bacteria | 12484 |
| 535 | Ga0501076_0003503 | 3300049592 | Bacteria | 11030 |
| 536 | Ga0501076_0016358 | 3300049592 | Bacteria | 5624 |
| 537 | Ga0501076_0083280 | 3300049592 | Bacteria | 2569 |
| 538 | Ga0501076_0260446 | 3300049592 | Bacteria | 1420 |
| 539 | Ga0501076_0263385 | 3300049592 | Bacteria | 1411 |
| 540 | Ga0501077_0001034 | 3300049593 | Bacteria | 16812 |
| 541 | Ga0501077_0002923 | 3300049593 | Bacteria | 10251 |
| 542 | Ga0501077_0011255 | 3300049593 | Bacteria | 5583 |
| 543 | Ga0501077_0067603 | 3300049593 | Bacteria | 2265 |
| 544 | Ga0501077_0125267 | 3300049593 | Unclassified | 1628 |
| 545 | Ga0501079_0012125 | 3300049741 | Bacteria | 6580 |
| 546 | Ga0501079_0012179 | 3300049741 | Bacteria | 6565 |
| 547 | Ga0501079_0020392 | 3300049741 | Bacteria | 5066 |
| 548 | Ga0501079_0040682 | 3300049741 | Bacteria | 3586 |
| 549 | Ga0501079_0069672 | 3300049741 | Bacteria | 2715 |
| 550 | Ga0501079_0132643 | 3300049741 | Bacteria | 1939 |
| 551 | Ga0501079_0197744 | 3300049741 | Bacteria | 1569 |
| 552 | Ga0501080_0006433 | 3300049742 | Bacteria | 10543 |
| 553 | Ga0501080_0013557 | 3300049742 | Bacteria | 7503 |
| 554 | Ga0501080_0087670 | 3300049742 | Bacteria | 2891 |
| 555 | Ga0501080_0301272 | 3300049742 | Archaea | 1454 |
| 556 | Ga0501080_0502330 | 3300049742 | Bacteria | 1084 |
| 557 | Ga0501081_0006444 | 3300049743 | Bacteria | 7617 |
| 558 | Ga0501081_0008703 | 3300049743 | Bacteria | 6596 |
| 559 | Ga0501081_0017081 | 3300049743 | Bacteria | 4798 |
| 560 | Ga0501081_0028015 | 3300049743 | Bacteria | 3799 |
| 561 | Ga0501081_0062703 | 3300049743 | Bacteria | 2579 |
| 562 | Ga0501081_0199537 | 3300049743 | Bacteria | 1450 |
| 563 | Ga0501081_0207884 | 3300049743 | Bacteria | 1421 |
| 564 | Ga0501083_0017700 | 3300049744 | Bacteria | 4969 |
| 565 | Ga0501083_0092390 | 3300049744 | Bacteria | 1998 |
| 566 | Ga0501083_0124860 | 3300049744 | Bacteria | 1687 |
| 567 | Ga0501083_0151684 | 3300049744 | Bacteria | 1517 |
| 568 | Ga0501035_0009648 | 3300049822 | Bacteria | 8978 |
| 569 | Ga0501035_0037353 | 3300049822 | Bacteria | 4398 |
| 570 | Ga0501035_0062526 | 3300049822 | Bacteria | 3313 |
| 571 | Ga0501035_0104046 | 3300049822 | Bacteria | 2490 |
| 572 | Ga0501044_0067505 | 3300049823 | Bacteria | 3644 |
| 573 | Ga0501045_0014465 | 3300049824 | Bacteria | 5592 |
| 574 | Ga0501045_0079071 | 3300049824 | Bacteria | 2424 |
| 575 | Ga0501045_0145399 | 3300049824 | Bacteria | 1764 |
| 576 | Ga0501045_0187667 | 3300049824 | Bacteria | 1540 |
| 577 | nmdc:mga00v17_406073_c1 | 3300050491 | Bacteria | 885 |
| 578 | nmdc:mga0yw44_4853_c2 | 3300050492 | Bacteria | 5672 |
| 579 | nmdc:mga05p37_465308_c1 | 3300050507 | Archaea | 1460 |
| 580 | nmdc:mga05p37_5841_c2 | 3300050507 | Bacteria | 10530 |
| 581 | nmdc:mga06r32_655197_c1 | 3300050510 | Unclassified | 1018 |
| 582 | nmdc:mga08y16_157665_c1 | 3300050511 | Bacteria | 2359 |
| 583 | nmdc:mga08y16_578951_c1 | 3300050511 | Unclassified | 1133 |
| 584 | nmdc:mga0a205_8363_c1 | 3300050515 | Bacteria | 9412 |
| 585 | nmdc:mga0a205_840628_c1 | 3300050515 | Bacteria | 765 |
| 586 | Ga0495612_0157588 | 3300053078 | Bacteria | 990 |
| 587 | Ga0495655_0044135 | 3300053083 | Bacteria | 1152 |
| 588 | Ga0495595_0075665 | 3300053084 | Bacteria | 1597 |
| 589 | Ga0495619_0179126 | 3300053085 | Unclassified | 1466 |
| 590 | Ga0501084_0006463 | 3300054114 | Bacteria | 9638 |
| 591 | Ga0501084_0010024 | 3300054114 | Bacteria | 7827 |
| 592 | Ga0501084_0013735 | 3300054114 | Bacteria | 6702 |
| 593 | Ga0501084_0037042 | 3300054114 | Bacteria | 4075 |
| 594 | Ga0501084_0287079 | 3300054114 | Bacteria | 1389 |
| 595 | Ga0501082_0003992 | 3300060353 | Bacteria | 12878 |
| 596 | Ga0501082_0004592 | 3300060353 | Bacteria | 12065 |
| 597 | Ga0501082_0007538 | 3300060353 | Bacteria | 9388 |
| 598 | Ga0501082_0046153 | 3300060353 | Bacteria | 3756 |
| 599 | Ga0501082_0160346 | 3300060353 | Bacteria | 1954 |
| 600 | Ga0501082_0658213 | 3300060353 | Archaea | 917 |
| 601 | Ga0466962_0233401 | 3300061719 | Bacteria | 902 |
| 602 | Ga0530510_0012356 | 3300061734 | Bacteria | 5997 |
| 603 | Ga0530510_0052261 | 3300061734 | Bacteria | 2953 |
| 604 | Ga0530510_0083757 | 3300061734 | Bacteria | 2322 |
| 605 | Ga0530510_0102895 | 3300061734 | Bacteria | 2089 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0028015 | Ga0501081_0028015_50_613 | 187 |
| 2 | 3300037068 | Ga0373925_0187262 | Ga0373925_0187262_270_968 | 198 |
| 3 | 3300046455 | Ga0495603_0086270 | Ga0495603_0086270_431_1129 | 198 |
| 4 | 3300046683 | Ga0495658_0157095 | Ga0495658_0157095_535_1233 | 198 |
| 5 | 3300049578 | Ga0501042_0617039 | Ga0501042_0617039_13_609 | 198 |
| 6 | 3300005440 | Ga0070705_100120696 | Ga0070705_1001206961 | 199 |
| 7 | 3300005518 | Ga0070699_100699930 | Ga0070699_1006999301 | 199 |
| 8 | 3300013105 | Ga0157369_10013890 | Ga0157369_100138909 | 199 |
| 9 | 3300020082 | Ga0206353_11119996 | Ga0206353_111199968 | 200 |
| 10 | 3300038443 | Ga0395901_0454210 | Ga0395901_0454210_23_634 | 202 |
| 11 | 3300025944 | Ga0207661_10123419 | Ga0207661_101234194 | 204 |
| 12 | 3300037466 | Ga0395898_0406647 | Ga0395898_0406647_353_1033 | 204 |
| 13 | 3300013307 | Ga0157372_10287824 | Ga0157372_102878242 | 206 |
| 14 | 3300044693 | Ga0466961_0218860 | Ga0466961_0218860_365_1045 | 207 |
| 15 | 3300045049 | Ga0466959_0040893 | Ga0466959_0040893_768_1448 | 207 |
| 16 | 3300009093 | Ga0105240_10245173 | Ga0105240_102451732 | 208 |
| 17 | 3300025913 | Ga0207695_10056425 | Ga0207695_100564252 | 208 |
| 18 | 3300048915 | Ga0496112_0900082 | Ga0496112_0900082_13_678 | 209 |
| 19 | 3300045976 | Ga0466967_0440093 | Ga0466967_0440093_353_1036 | 211 |
| 20 | 3300048911 | Ga0496108_0213713 | Ga0496108_0213713_1011_1649 | 212 |
| 21 | 3300005536 | Ga0070697_100162445 | Ga0070697_1001624451 | 218 |
| 22 | 3300005937 | Ga0081455_10026506 | Ga0081455_100265062 | 221 |
| 23 | 3300025907 | Ga0207645_10023350 | Ga0207645_100233503 | 221 |
| 24 | 3300025942 | Ga0207689_10047479 | Ga0207689_100474792 | 221 |
| 25 | 3300049583 | Ga0501067_0170092 | Ga0501067_0170092_34_699 | 221 |
| 26 | 3300049742 | Ga0501080_0502330 | Ga0501080_0502330_234_899 | 221 |
| 27 | 3300049744 | Ga0501083_0151684 | Ga0501083_0151684_16_714 | 222 |
| 28 | 3300005364 | Ga0070673_100007612 | Ga0070673_1000076123 | 223 |
| 29 | 3300009176 | Ga0105242_10040774 | Ga0105242_100407743 | 223 |
| 30 | 3300009545 | Ga0105237_10390820 | Ga0105237_103908202 | 223 |
| 31 | 3300009551 | Ga0105238_10160285 | Ga0105238_101602852 | 223 |
| 32 | 3300025904 | Ga0207647_10199761 | Ga0207647_101997612 | 223 |
| 33 | 3300025933 | Ga0207706_10039259 | Ga0207706_100392593 | 223 |
| 34 | 3300025938 | Ga0207704_10029907 | Ga0207704_100299073 | 223 |
| 35 | 3300025941 | Ga0207711_10409906 | Ga0207711_104099062 | 223 |
| 36 | 3300026067 | Ga0207678_10025385 | Ga0207678_100253856 | 223 |
| 37 | 3300044694 | Ga0466963_0108183 | Ga0466963_0108183_197_874 | 223 |
| 38 | 3300044842 | Ga0466957_0396843 | Ga0466957_0396843_177_857 | 224 |
| 39 | 3300020077 | Ga0206351_10482556 | Ga0206351_104825561 | 225 |
| 40 | 3300020080 | Ga0206350_11107442 | Ga0206350_111074421 | 225 |
| 41 | 3300044684 | Ga0466966_0013574 | Ga0466966_0013574_750_1436 | 225 |
| 42 | 3300044693 | Ga0466961_0040354 | Ga0466961_0040354_730_1410 | 225 |
| 43 | 3300044694 | Ga0466963_0256828 | Ga0466963_0256828_305_985 | 225 |
| 44 | 3300045976 | Ga0466967_0256603 | Ga0466967_0256603_455_1135 | 225 |
| 45 | 3300048088 | Ga0495602_0523589 | Ga0495602_0523589_117_797 | 225 |
| 46 | 3300048917 | Ga0496114_0087087 | Ga0496114_0087087_994_1674 | 225 |
| 47 | 3300049571 | Ga0501034_0068007 | Ga0501034_0068007_147_833 | 225 |
| 48 | 3300061719 | Ga0466962_0233401 | Ga0466962_0233401_74_760 | 225 |
| 49 | 3300005334 | Ga0068869_100977688 | Ga0068869_1009776881 | 226 |
| 50 | 3300005438 | Ga0070701_10019521 | Ga0070701_100195212 | 226 |
| 51 | 3300005456 | Ga0070678_100000052 | Ga0070678_10000005236 | 226 |
| 52 | 3300005544 | Ga0070686_100001674 | Ga0070686_1000016747 | 226 |
| 53 | 3300005546 | Ga0070696_100580628 | Ga0070696_1005806281 | 226 |
| 54 | 3300005547 | Ga0070693_100081932 | Ga0070693_1000819322 | 226 |
| 55 | 3300005548 | Ga0070665_100103425 | Ga0070665_1001034252 | 226 |
| 56 | 3300005615 | Ga0070702_100044763 | Ga0070702_1000447632 | 226 |
| 57 | 3300005718 | Ga0068866_10008968 | Ga0068866_100089683 | 226 |
| 58 | 3300005842 | Ga0068858_100206649 | Ga0068858_1002066492 | 226 |
| 59 | 3300005843 | Ga0068860_100027023 | Ga0068860_1000270236 | 226 |
| 60 | 3300006163 | Ga0070715_10019378 | Ga0070715_100193783 | 226 |
| 61 | 3300006237 | Ga0097621_100026124 | Ga0097621_1000261244 | 226 |
| 62 | 3300006358 | Ga0068871_100046109 | Ga0068871_1000461093 | 226 |
| 63 | 3300009098 | Ga0105245_10978751 | Ga0105245_109787512 | 226 |
| 64 | 3300009148 | Ga0105243_10007909 | Ga0105243_100079097 | 226 |
| 65 | 3300009176 | Ga0105242_10009065 | Ga0105242_100090652 | 226 |
| 66 | 3300009177 | Ga0105248_10015219 | Ga0105248_100152194 | 226 |
| 67 | 3300013297 | Ga0157378_10001752 | Ga0157378_1000175215 | 226 |
| 68 | 3300014497 | Ga0182008_10197189 | Ga0182008_101971892 | 226 |
| 69 | 3300014968 | Ga0157379_10009631 | Ga0157379_100096312 | 226 |
| 70 | 3300014969 | Ga0157376_10014368 | Ga0157376_100143684 | 226 |
| 71 | 3300025899 | Ga0207642_10005610 | Ga0207642_100056105 | 226 |
| 72 | 3300025901 | Ga0207688_10194107 | Ga0207688_101941072 | 226 |
| 73 | 3300025905 | Ga0207685_10280871 | Ga0207685_102808711 | 226 |
| 74 | 3300025918 | Ga0207662_10067432 | Ga0207662_100674322 | 226 |
| 75 | 3300025934 | Ga0207686_10247646 | Ga0207686_102476462 | 226 |
| 76 | 3300025935 | Ga0207709_10083159 | Ga0207709_100831593 | 226 |
| 77 | 3300025939 | Ga0207665_10391597 | Ga0207665_103915972 | 226 |
| 78 | 3300025941 | Ga0207711_10023268 | Ga0207711_100232683 | 226 |
| 79 | 3300026089 | Ga0207648_10194353 | Ga0207648_101943532 | 226 |
| 80 | 3300026121 | Ga0207683_10000088 | Ga0207683_1000008838 | 226 |
| 81 | 3300028381 | Ga0268264_10104619 | Ga0268264_101046193 | 226 |
| 82 | 3300028563 | Ga0265319_1015620 | Ga0265319_10156204 | 226 |
| 83 | 3300028577 | Ga0265318_10008787 | Ga0265318_100087874 | 226 |
| 84 | 3300031240 | Ga0265320_10014826 | Ga0265320_100148263 | 226 |
| 85 | 3300031240 | Ga0265320_10070740 | Ga0265320_100707402 | 226 |
| 86 | 3300031240 | Ga0265320_10100366 | Ga0265320_101003662 | 226 |
| 87 | 3300047317 | Ga0495604_0315596 | Ga0495604_0315596_222_920 | 226 |
| 88 | 3300048904 | Ga0496101_0001935 | Ga0496101_0001935_260_958 | 226 |
| 89 | 3300048905 | Ga0496102_0309936 | Ga0496102_0309936_105_803 | 226 |
| 90 | 3300048906 | Ga0496103_0016856 | Ga0496103_0016856_1745_2443 | 226 |
| 91 | 3300048908 | Ga0496105_0001655 | Ga0496105_0001655_7551_8249 | 226 |
| 92 | 3300048910 | Ga0496107_0011271 | Ga0496107_0011271_4716_5414 | 226 |
| 93 | 3300048917 | Ga0496114_0035638 | Ga0496114_0035638_2161_2859 | 226 |
| 94 | 3300020082 | Ga0206353_10994781 | Ga0206353_109947811 | 227 |
| 95 | 3300028800 | Ga0265338_10070748 | Ga0265338_100707483 | 227 |
| 96 | 3300031247 | Ga0265340_10076615 | Ga0265340_100766152 | 227 |
| 97 | 3300031595 | Ga0265313_10107135 | Ga0265313_101071351 | 227 |
| 98 | 3300035118 | Ga0373954_0053157 | Ga0373954_0053157_967_1683 | 227 |
| 99 | 3300048903 | Ga0496100_0083321 | Ga0496100_0083321_797_1480 | 227 |
| 100 | 3300048904 | Ga0496101_0116460 | Ga0496101_0116460_653_1336 | 227 |
| 101 | 3300048905 | Ga0496102_0262912 | Ga0496102_0262912_231_914 | 227 |
| 102 | 3300048909 | Ga0496106_0067900 | Ga0496106_0067900_753_1436 | 227 |
| 103 | 3300048911 | Ga0496108_0024449 | Ga0496108_0024449_174_857 | 227 |
| 104 | 3300048915 | Ga0496112_0414650 | Ga0496112_0414650_244_927 | 227 |
| 105 | 3300005366 | Ga0070659_100376391 | Ga0070659_1003763911 | 228 |
| 106 | 3300006847 | Ga0075431_100713536 | Ga0075431_1007135361 | 228 |
| 107 | 3300006852 | Ga0075433_10924960 | Ga0075433_109249601 | 228 |
| 108 | 3300009147 | Ga0114129_11421874 | Ga0114129_114218741 | 228 |
| 109 | 3300009147 | Ga0114129_11518467 | Ga0114129_115184671 | 228 |
| 110 | 3300025941 | Ga0207711_10543187 | Ga0207711_105431872 | 228 |
| 111 | 3300031548 | Ga0307408_100223764 | Ga0307408_1002237642 | 228 |
| 112 | 3300031731 | Ga0307405_10388174 | Ga0307405_103881741 | 228 |
| 113 | 3300031852 | Ga0307410_10543068 | Ga0307410_105430681 | 228 |
| 114 | 3300031903 | Ga0307407_10095402 | Ga0307407_100954023 | 228 |
| 115 | 3300031995 | Ga0307409_100060552 | Ga0307409_1000605522 | 228 |
| 116 | 3300037418 | Ga0395900_0219544 | Ga0395900_0219544_429_1148 | 228 |
| 117 | 3300038443 | Ga0395901_0790099 | Ga0395901_0790099_46_765 | 228 |
| 118 | 3300048909 | Ga0496106_0236419 | Ga0496106_0236419_581_1267 | 228 |
| 119 | 3300048910 | Ga0496107_0241251 | Ga0496107_0241251_462_1148 | 228 |
| 120 | 3300050510 | nmdc:mga06r32_655197_c1 | nmdc:mga06r32_655197_c1_264_959 | 228 |
| 121 | 3300050515 | nmdc:mga0a205_840628_c1 | nmdc:mga0a205_840628_c1_33_728 | 228 |
| 122 | 3300005331 | Ga0070670_100293172 | Ga0070670_1002931721 | 229 |
| 123 | 3300005337 | Ga0070682_100454119 | Ga0070682_1004541192 | 229 |
| 124 | 3300005456 | Ga0070678_100261374 | Ga0070678_1002613743 | 229 |
| 125 | 3300013308 | Ga0157375_10654906 | Ga0157375_106549062 | 229 |
| 126 | 3300014326 | Ga0157380_10573076 | Ga0157380_105730762 | 229 |
| 127 | 3300014969 | Ga0157376_10211245 | Ga0157376_102112451 | 229 |
| 128 | 3300025938 | Ga0207704_10710805 | Ga0207704_107108051 | 229 |
| 129 | 3300025944 | Ga0207661_10259337 | Ga0207661_102593371 | 229 |
| 130 | 3300026089 | Ga0207648_10592160 | Ga0207648_105921601 | 229 |
| 131 | 3300026121 | Ga0207683_10346410 | Ga0207683_103464102 | 229 |
| 132 | 3300046455 | Ga0495603_0030234 | Ga0495603_0030234_2069_2758 | 229 |
| 133 | 3300046461 | Ga0495641_0090870 | Ga0495641_0090870_490_1179 | 229 |
| 134 | 3300046642 | Ga0495634_0188294 | Ga0495634_0188294_204_893 | 229 |
| 135 | 3300046664 | Ga0495659_0175426 | Ga0495659_0175426_52_747 | 229 |
| 136 | 3300048908 | Ga0496105_0465631 | Ga0496105_0465631_45_734 | 229 |
| 137 | 3300048917 | Ga0496114_0079772 | Ga0496114_0079772_1899_2588 | 229 |
| 138 | 3300048917 | Ga0496114_0418944 | Ga0496114_0418944_429_1118 | 229 |
| 139 | 3300049583 | Ga0501067_0000374 | Ga0501067_0000374_12811_13506 | 229 |
| 140 | 3300049587 | Ga0501071_0233063 | Ga0501071_0233063_373_1068 | 229 |
| 141 | 3300053078 | Ga0495612_0157588 | Ga0495612_0157588_73_762 | 229 |
| 142 | 3300053084 | Ga0495595_0075665 | Ga0495595_0075665_57_746 | 229 |
| 143 | 3300053085 | Ga0495619_0179126 | Ga0495619_0179126_219_908 | 229 |
| 144 | 3300009147 | Ga0114129_10131500 | Ga0114129_101315005 | 230 |
| 145 | 3300020081 | Ga0206354_11183149 | Ga0206354_111831492 | 230 |
| 146 | 3300049569 | Ga0501032_0180072 | Ga0501032_0180072_134_832 | 230 |
| 147 | 3300049572 | Ga0501036_0007924 | Ga0501036_0007924_6665_7363 | 230 |
| 148 | 3300049574 | Ga0501038_0099779 | Ga0501038_0099779_1407_2105 | 230 |
| 149 | 3300049575 | Ga0501039_0052617 | Ga0501039_0052617_2003_2701 | 230 |
| 150 | 3300049577 | Ga0501041_0014045 | Ga0501041_0014045_3329_4027 | 230 |
| 151 | 3300049582 | Ga0501048_0038176 | Ga0501048_0038176_2395_3093 | 230 |
| 152 | 3300049586 | Ga0501070_0231463 | Ga0501070_0231463_723_1421 | 230 |
| 153 | 3300049587 | Ga0501071_0096896 | Ga0501071_0096896_798_1496 | 230 |
| 154 | 3300049588 | Ga0501072_0007152 | Ga0501072_0007152_3664_4362 | 230 |
| 155 | 3300049590 | Ga0501074_0049329 | Ga0501074_0049329_1831_2529 | 230 |
| 156 | 3300049591 | Ga0501075_0182154 | Ga0501075_0182154_579_1277 | 230 |
| 157 | 3300049592 | Ga0501076_0083280 | Ga0501076_0083280_1266_1964 | 230 |
| 158 | 3300049593 | Ga0501077_0011255 | Ga0501077_0011255_2349_3047 | 230 |
| 159 | 3300049741 | Ga0501079_0040682 | Ga0501079_0040682_235_933 | 230 |
| 160 | 3300049744 | Ga0501083_0092390 | Ga0501083_0092390_681_1379 | 230 |
| 161 | 3300049822 | Ga0501035_0062526 | Ga0501035_0062526_1505_2203 | 230 |
| 162 | 3300049824 | Ga0501045_0079071 | Ga0501045_0079071_455_1153 | 230 |
| 163 | 3300054114 | Ga0501084_0013735 | Ga0501084_0013735_159_857 | 230 |
| 164 | 3300060353 | Ga0501082_0003992 | Ga0501082_0003992_2931_3629 | 230 |
| 165 | 3300060353 | Ga0501082_0658213 | Ga0501082_0658213_115_813 | 230 |
| 166 | 3300005981 | Ga0081538_10031464 | Ga0081538_100314642 | 231 |
| 167 | 3300026121 | Ga0207683_10205089 | Ga0207683_102050892 | 231 |
| 168 | 3300049580 | Ga0501046_0184611 | Ga0501046_0184611_774_1472 | 232 |
| 169 | 3300049586 | Ga0501070_0481720 | Ga0501070_0481720_259_957 | 232 |
| 170 | 3300049591 | Ga0501075_0199524 | Ga0501075_0199524_764_1462 | 232 |
| 171 | 3300049592 | Ga0501076_0260446 | Ga0501076_0260446_27_725 | 232 |
| 172 | 3300049743 | Ga0501081_0207884 | Ga0501081_0207884_581_1279 | 232 |
| 173 | 3300005471 | Ga0070698_100102616 | Ga0070698_1001026164 | 233 |
| 174 | 3300005518 | Ga0070699_100070877 | Ga0070699_1000708773 | 233 |
| 175 | 3300005530 | Ga0070679_100351783 | Ga0070679_1003517833 | 233 |
| 176 | 3300026075 | Ga0207708_10210356 | Ga0207708_102103563 | 233 |
| 177 | 3300042004 | Ga0439445_0062318 | Ga0439445_0062318_280_984 | 233 |
| 178 | 3300042006 | Ga0439432_104426 | Ga0439432_104426_82_786 | 233 |
| 179 | 3300042007 | Ga0439449_0079620 | Ga0439449_0079620_308_1012 | 233 |
| 180 | 3300042015 | Ga0439462_0007795 | Ga0439462_0007795_1653_2357 | 233 |
| 181 | 3300042156 | Ga0439446_0001483 | Ga0439446_0001483_4311_5015 | 233 |
| 182 | 3300049568 | Ga0501031_0026848 | Ga0501031_0026848_2088_2789 | 233 |
| 183 | 3300049570 | Ga0501033_0022921 | Ga0501033_0022921_3893_4594 | 233 |
| 184 | 3300049571 | Ga0501034_0186625 | Ga0501034_0186625_213_914 | 233 |
| 185 | 3300049574 | Ga0501038_0037681 | Ga0501038_0037681_1328_2029 | 233 |
| 186 | 3300049575 | Ga0501039_0077813 | Ga0501039_0077813_1596_2297 | 233 |
| 187 | 3300049577 | Ga0501041_0073589 | Ga0501041_0073589_1250_1951 | 233 |
| 188 | 3300049578 | Ga0501042_0091668 | Ga0501042_0091668_1468_2169 | 233 |
| 189 | 3300049580 | Ga0501046_0089731 | Ga0501046_0089731_78_779 | 233 |
| 190 | 3300049584 | Ga0501068_0007668 | Ga0501068_0007668_3307_4008 | 233 |
| 191 | 3300049585 | Ga0501069_0053764 | Ga0501069_0053764_555_1256 | 233 |
| 192 | 3300049586 | Ga0501070_0019174 | Ga0501070_0019174_3425_4126 | 233 |
| 193 | 3300049587 | Ga0501071_0117140 | Ga0501071_0117140_560_1261 | 233 |
| 194 | 3300049588 | Ga0501072_0033001 | Ga0501072_0033001_1753_2454 | 233 |
| 195 | 3300049589 | Ga0501073_0311730 | Ga0501073_0311730_109_810 | 233 |
| 196 | 3300049590 | Ga0501074_0095028 | Ga0501074_0095028_470_1171 | 233 |
| 197 | 3300049591 | Ga0501075_0176841 | Ga0501075_0176841_106_807 | 233 |
| 198 | 3300049592 | Ga0501076_0263385 | Ga0501076_0263385_23_724 | 233 |
| 199 | 3300049593 | Ga0501077_0067603 | Ga0501077_0067603_946_1647 | 233 |
| 200 | 3300049741 | Ga0501079_0197744 | Ga0501079_0197744_688_1389 | 233 |
| 201 | 3300049743 | Ga0501081_0199537 | Ga0501081_0199537_302_1003 | 233 |
| 202 | 3300049744 | Ga0501083_0124860 | Ga0501083_0124860_687_1388 | 233 |
| 203 | 3300049822 | Ga0501035_0037353 | Ga0501035_0037353_510_1211 | 233 |
| 204 | 3300049823 | Ga0501044_0067505 | Ga0501044_0067505_1446_2147 | 233 |
| 205 | 3300049824 | Ga0501045_0187667 | Ga0501045_0187667_316_1017 | 233 |
| 206 | 3300054114 | Ga0501084_0287079 | Ga0501084_0287079_387_1088 | 233 |
| 207 | 3300060353 | Ga0501082_0160346 | Ga0501082_0160346_302_1003 | 233 |
| 208 | 3300003203 | JGI25406J46586_10040463 | JGI25406J46586_100404633 | 234 |
| 209 | 3300005329 | Ga0070683_100133958 | Ga0070683_1001339582 | 234 |
| 210 | 3300005331 | Ga0070670_100683416 | Ga0070670_1006834161 | 234 |
| 211 | 3300005337 | Ga0070682_100455509 | Ga0070682_1004555092 | 234 |
| 212 | 3300005340 | Ga0070689_100334267 | Ga0070689_1003342672 | 234 |
| 213 | 3300005356 | Ga0070674_100071031 | Ga0070674_1000710313 | 234 |
| 214 | 3300005367 | Ga0070667_100298941 | Ga0070667_1002989412 | 234 |
| 215 | 3300005456 | Ga0070678_100015082 | Ga0070678_1000150823 | 234 |
| 216 | 3300005466 | Ga0070685_10062379 | Ga0070685_100623792 | 234 |
| 217 | 3300005543 | Ga0070672_100158549 | Ga0070672_1001585493 | 234 |
| 218 | 3300005544 | Ga0070686_100146896 | Ga0070686_1001468961 | 234 |
| 219 | 3300005546 | Ga0070696_100152127 | Ga0070696_1001521272 | 234 |
| 220 | 3300005549 | Ga0070704_100296643 | Ga0070704_1002966432 | 234 |
| 221 | 3300005615 | Ga0070702_100105698 | Ga0070702_1001056981 | 234 |
| 222 | 3300005616 | Ga0068852_100558112 | Ga0068852_1005581122 | 234 |
| 223 | 3300005617 | Ga0068859_100094205 | Ga0068859_1000942054 | 234 |
| 224 | 3300005718 | Ga0068866_10157838 | Ga0068866_101578382 | 234 |
| 225 | 3300005840 | Ga0068870_10059327 | Ga0068870_100593272 | 234 |
| 226 | 3300005842 | Ga0068858_100230765 | Ga0068858_1002307652 | 234 |
| 227 | 3300005985 | Ga0081539_10000200 | Ga0081539_1000020061 | 234 |
| 228 | 3300006358 | Ga0068871_100506477 | Ga0068871_1005064772 | 234 |
| 229 | 3300006844 | Ga0075428_100469626 | Ga0075428_1004696262 | 234 |
| 230 | 3300006881 | Ga0068865_100008991 | Ga0068865_1000089912 | 234 |
| 231 | 3300006931 | Ga0097620_100094200 | Ga0097620_1000942002 | 234 |
| 232 | 3300009098 | Ga0105245_10046418 | Ga0105245_100464185 | 234 |
| 233 | 3300009148 | Ga0105243_10009015 | Ga0105243_100090157 | 234 |
| 234 | 3300009148 | Ga0105243_10416626 | Ga0105243_104166262 | 234 |
| 235 | 3300009176 | Ga0105242_11187675 | Ga0105242_111876751 | 234 |
| 236 | 3300009177 | Ga0105248_10024950 | Ga0105248_100249504 | 234 |
| 237 | 3300009551 | Ga0105238_10252584 | Ga0105238_102525843 | 234 |
| 238 | 3300009553 | Ga0105249_10085675 | Ga0105249_100856753 | 234 |
| 239 | 3300011119 | Ga0105246_10008656 | Ga0105246_100086563 | 234 |
| 240 | 3300013308 | Ga0157375_10072916 | Ga0157375_100729163 | 234 |
| 241 | 3300014325 | Ga0163163_10245031 | Ga0163163_102450313 | 234 |
| 242 | 3300014326 | Ga0157380_10000820 | Ga0157380_1000082025 | 234 |
| 243 | 3300014745 | Ga0157377_10406336 | Ga0157377_104063362 | 234 |
| 244 | 3300014968 | Ga0157379_10094192 | Ga0157379_100941922 | 234 |
| 245 | 3300014969 | Ga0157376_10036180 | Ga0157376_100361803 | 234 |
| 246 | 3300025903 | Ga0207680_10288812 | Ga0207680_102888122 | 234 |
| 247 | 3300025908 | Ga0207643_10033044 | Ga0207643_100330443 | 234 |
| 248 | 3300025919 | Ga0207657_10265952 | Ga0207657_102659522 | 234 |
| 249 | 3300025934 | Ga0207686_10316933 | Ga0207686_103169331 | 234 |
| 250 | 3300025935 | Ga0207709_10023219 | Ga0207709_100232194 | 234 |
| 251 | 3300025940 | Ga0207691_10096134 | Ga0207691_100961342 | 234 |
| 252 | 3300025941 | Ga0207711_10123290 | Ga0207711_101232902 | 234 |
| 253 | 3300025961 | Ga0207712_10049006 | Ga0207712_100490063 | 234 |
| 254 | 3300026035 | Ga0207703_10742213 | Ga0207703_107422132 | 234 |
| 255 | 3300026041 | Ga0207639_10568360 | Ga0207639_105683601 | 234 |
| 256 | 3300026089 | Ga0207648_10043885 | Ga0207648_100438853 | 234 |
| 257 | 3300026089 | Ga0207648_10082064 | Ga0207648_100820642 | 234 |
| 258 | 3300026121 | Ga0207683_10003610 | Ga0207683_100036105 | 234 |
| 259 | 3300026142 | Ga0207698_10629085 | Ga0207698_106290852 | 234 |
| 260 | 3300027907 | Ga0207428_10149851 | Ga0207428_101498513 | 234 |
| 261 | 3300046455 | Ga0495603_0006748 | Ga0495603_0006748_5168_5872 | 234 |
| 262 | 3300046473 | Ga0495582_0122111 | Ga0495582_0122111_727_1431 | 234 |
| 263 | 3300046500 | Ga0495596_0144180 | Ga0495596_0144180_79_783 | 234 |
| 264 | 3300046520 | Ga0495637_0093037 | Ga0495637_0093037_453_1157 | 234 |
| 265 | 3300046523 | Ga0495644_0091114 | Ga0495644_0091114_77_781 | 234 |
| 266 | 3300046615 | Ga0495656_0013806 | Ga0495656_0013806_1625_2329 | 234 |
| 267 | 3300048907 | Ga0496104_0075582 | Ga0496104_0075582_1238_1942 | 234 |
| 268 | 3300048912 | Ga0496109_0128506 | Ga0496109_0128506_759_1463 | 234 |
| 269 | 3300048917 | Ga0496114_0138237 | Ga0496114_0138237_899_1603 | 234 |
| 270 | 3300049575 | Ga0501039_0173222 | Ga0501039_0173222_556_1260 | 234 |
| 271 | 3300049576 | Ga0501040_0510060 | Ga0501040_0510060_82_786 | 234 |
| 272 | 3300049591 | Ga0501075_0004047 | Ga0501075_0004047_8272_8976 | 234 |
| 273 | 3300049741 | Ga0501079_0069672 | Ga0501079_0069672_766_1470 | 234 |
| 274 | 3300049742 | Ga0501080_0301272 | Ga0501080_0301272_10_714 | 234 |
| 275 | 3300049743 | Ga0501081_0062703 | Ga0501081_0062703_1392_2096 | 234 |
| 276 | 3300050507 | nmdc:mga05p37_465308_c1 | nmdc:mga05p37_465308_c1_351_1055 | 234 |
| 277 | 3300053083 | Ga0495655_0044135 | Ga0495655_0044135_249_953 | 234 |
| 278 | 3300000044 | ARSoilOldRDRAFT_c009932 | ARSoilOldRDRAFT_0099321 | 235 |
| 279 | 3300001989 | JGI24739J22299_10035832 | JGI24739J22299_100358322 | 235 |
| 280 | 3300001991 | JGI24743J22301_10005203 | JGI24743J22301_100052033 | 235 |
| 281 | 3300002075 | JGI24738J21930_10005569 | JGI24738J21930_100055693 | 235 |
| 282 | 3300005327 | Ga0070658_10119662 | Ga0070658_101196623 | 235 |
| 283 | 3300005329 | Ga0070683_100031599 | Ga0070683_1000315993 | 235 |
| 284 | 3300005329 | Ga0070683_100044042 | Ga0070683_1000440424 | 235 |
| 285 | 3300005329 | Ga0070683_100045947 | Ga0070683_1000459474 | 235 |
| 286 | 3300005329 | Ga0070683_100225107 | Ga0070683_1002251072 | 235 |
| 287 | 3300005329 | Ga0070683_100752793 | Ga0070683_1007527931 | 235 |
| 288 | 3300005331 | Ga0070670_100098812 | Ga0070670_1000988123 | 235 |
| 289 | 3300005334 | Ga0068869_100144702 | Ga0068869_1001447023 | 235 |
| 290 | 3300005336 | Ga0070680_100006280 | Ga0070680_1000062809 | 235 |
| 291 | 3300005336 | Ga0070680_100062689 | Ga0070680_1000626892 | 235 |
| 292 | 3300005337 | Ga0070682_100030833 | Ga0070682_1000308333 | 235 |
| 293 | 3300005337 | Ga0070682_100059146 | Ga0070682_1000591464 | 235 |
| 294 | 3300005337 | Ga0070682_100095936 | Ga0070682_1000959362 | 235 |
| 295 | 3300005338 | Ga0068868_100157542 | Ga0068868_1001575422 | 235 |
| 296 | 3300005338 | Ga0068868_100281276 | Ga0068868_1002812762 | 235 |
| 297 | 3300005339 | Ga0070660_100135498 | Ga0070660_1001354982 | 235 |
| 298 | 3300005341 | Ga0070691_10032236 | Ga0070691_100322364 | 235 |
| 299 | 3300005341 | Ga0070691_10088808 | Ga0070691_100888082 | 235 |
| 300 | 3300005344 | Ga0070661_100017514 | Ga0070661_1000175145 | 235 |
| 301 | 3300005344 | Ga0070661_100168985 | Ga0070661_1001689853 | 235 |
| 302 | 3300005347 | Ga0070668_100091866 | Ga0070668_1000918662 | 235 |
| 303 | 3300005347 | Ga0070668_100103335 | Ga0070668_1001033352 | 235 |
| 304 | 3300005354 | Ga0070675_100027707 | Ga0070675_1000277075 | 235 |
| 305 | 3300005354 | Ga0070675_100069322 | Ga0070675_1000693223 | 235 |
| 306 | 3300005356 | Ga0070674_100138997 | Ga0070674_1001389973 | 235 |
| 307 | 3300005364 | Ga0070673_100005153 | Ga0070673_1000051538 | 235 |
| 308 | 3300005366 | Ga0070659_100009185 | Ga0070659_1000091858 | 235 |
| 309 | 3300005366 | Ga0070659_100010513 | Ga0070659_1000105136 | 235 |
| 310 | 3300005366 | Ga0070659_100031388 | Ga0070659_1000313885 | 235 |
| 311 | 3300005366 | Ga0070659_100064759 | Ga0070659_1000647592 | 235 |
| 312 | 3300005438 | Ga0070701_10006182 | Ga0070701_100061824 | 235 |
| 313 | 3300005438 | Ga0070701_10121580 | Ga0070701_101215802 | 235 |
| 314 | 3300005440 | Ga0070705_100001459 | Ga0070705_1000014598 | 235 |
| 315 | 3300005441 | Ga0070700_100057241 | Ga0070700_1000572412 | 235 |
| 316 | 3300005441 | Ga0070700_100417384 | Ga0070700_1004173841 | 235 |
| 317 | 3300005444 | Ga0070694_100330198 | Ga0070694_1003301981 | 235 |
| 318 | 3300005444 | Ga0070694_100512866 | Ga0070694_1005128661 | 235 |
| 319 | 3300005455 | Ga0070663_100011865 | Ga0070663_1000118656 | 235 |
| 320 | 3300005457 | Ga0070662_100036282 | Ga0070662_1000362825 | 235 |
| 321 | 3300005457 | Ga0070662_100060621 | Ga0070662_1000606213 | 235 |
| 322 | 3300005458 | Ga0070681_10161743 | Ga0070681_101617432 | 235 |
| 323 | 3300005459 | Ga0068867_100554733 | Ga0068867_1005547332 | 235 |
| 324 | 3300005466 | Ga0070685_10007843 | Ga0070685_100078433 | 235 |
| 325 | 3300005466 | Ga0070685_10283100 | Ga0070685_102831002 | 235 |
| 326 | 3300005530 | Ga0070679_100063253 | Ga0070679_1000632533 | 235 |
| 327 | 3300005530 | Ga0070679_100071314 | Ga0070679_1000713142 | 235 |
| 328 | 3300005530 | Ga0070679_100142937 | Ga0070679_1001429373 | 235 |
| 329 | 3300005530 | Ga0070679_100208506 | Ga0070679_1002085062 | 235 |
| 330 | 3300005535 | Ga0070684_100009821 | Ga0070684_1000098215 | 235 |
| 331 | 3300005535 | Ga0070684_100030081 | Ga0070684_1000300813 | 235 |
| 332 | 3300005535 | Ga0070684_100105826 | Ga0070684_1001058263 | 235 |
| 333 | 3300005535 | Ga0070684_100147719 | Ga0070684_1001477193 | 235 |
| 334 | 3300005535 | Ga0070684_100173337 | Ga0070684_1001733372 | 235 |
| 335 | 3300005535 | Ga0070684_100213617 | Ga0070684_1002136173 | 235 |
| 336 | 3300005535 | Ga0070684_100399143 | Ga0070684_1003991433 | 235 |
| 337 | 3300005539 | Ga0068853_100012719 | Ga0068853_1000127198 | 235 |
| 338 | 3300005539 | Ga0068853_100067239 | Ga0068853_1000672392 | 235 |
| 339 | 3300005539 | Ga0068853_100088341 | Ga0068853_1000883414 | 235 |
| 340 | 3300005543 | Ga0070672_100103175 | Ga0070672_1001031752 | 235 |
| 341 | 3300005544 | Ga0070686_100232857 | Ga0070686_1002328571 | 235 |
| 342 | 3300005547 | Ga0070693_100009212 | Ga0070693_1000092126 | 235 |
| 343 | 3300005547 | Ga0070693_100016326 | Ga0070693_1000163265 | 235 |
| 344 | 3300005547 | Ga0070693_100164333 | Ga0070693_1001643333 | 235 |
| 345 | 3300005548 | Ga0070665_100046359 | Ga0070665_1000463594 | 235 |
| 346 | 3300005549 | Ga0070704_100023046 | Ga0070704_1000230463 | 235 |
| 347 | 3300005549 | Ga0070704_100390061 | Ga0070704_1003900612 | 235 |
| 348 | 3300005563 | Ga0068855_100033474 | Ga0068855_1000334746 | 235 |
| 349 | 3300005564 | Ga0070664_100061110 | Ga0070664_1000611102 | 235 |
| 350 | 3300005564 | Ga0070664_100071615 | Ga0070664_1000716154 | 235 |
| 351 | 3300005564 | Ga0070664_100096048 | Ga0070664_1000960483 | 235 |
| 352 | 3300005564 | Ga0070664_100603663 | Ga0070664_1006036631 | 235 |
| 353 | 3300005577 | Ga0068857_100030114 | Ga0068857_1000301144 | 235 |
| 354 | 3300005577 | Ga0068857_100156668 | Ga0068857_1001566682 | 235 |
| 355 | 3300005578 | Ga0068854_100066826 | Ga0068854_1000668262 | 235 |
| 356 | 3300005578 | Ga0068854_100137398 | Ga0068854_1001373983 | 235 |
| 357 | 3300005614 | Ga0068856_100032298 | Ga0068856_1000322983 | 235 |
| 358 | 3300005614 | Ga0068856_100094815 | Ga0068856_1000948153 | 235 |
| 359 | 3300005615 | Ga0070702_100052912 | Ga0070702_1000529123 | 235 |
| 360 | 3300005615 | Ga0070702_100058184 | Ga0070702_1000581842 | 235 |
| 361 | 3300005615 | Ga0070702_100223072 | Ga0070702_1002230722 | 235 |
| 362 | 3300005618 | Ga0068864_100019754 | Ga0068864_1000197545 | 235 |
| 363 | 3300005718 | Ga0068866_10076202 | Ga0068866_100762023 | 235 |
| 364 | 3300005718 | Ga0068866_10357162 | Ga0068866_103571621 | 235 |
| 365 | 3300005719 | Ga0068861_100028780 | Ga0068861_1000287801 | 235 |
| 366 | 3300005834 | Ga0068851_10009084 | Ga0068851_100090846 | 235 |
| 367 | 3300005840 | Ga0068870_10016192 | Ga0068870_100161923 | 235 |
| 368 | 3300005841 | Ga0068863_100110603 | Ga0068863_1001106033 | 235 |
| 369 | 3300005842 | Ga0068858_100047996 | Ga0068858_1000479962 | 235 |
| 370 | 3300005843 | Ga0068860_100446760 | Ga0068860_1004467602 | 235 |
| 371 | 3300005844 | Ga0068862_100131730 | Ga0068862_1001317302 | 235 |
| 372 | 3300005937 | Ga0081455_10013098 | Ga0081455_1001309810 | 235 |
| 373 | 3300005937 | Ga0081455_10411539 | Ga0081455_104115392 | 235 |
| 374 | 3300006051 | Ga0075364_10020761 | Ga0075364_100207616 | 235 |
| 375 | 3300006051 | Ga0075364_10149290 | Ga0075364_101492902 | 235 |
| 376 | 3300006058 | Ga0075432_10018362 | Ga0075432_100183622 | 235 |
| 377 | 3300006358 | Ga0068871_100314221 | Ga0068871_1003142212 | 235 |
| 378 | 3300006844 | Ga0075428_100260262 | Ga0075428_1002602622 | 235 |
| 379 | 3300006852 | Ga0075433_10118193 | Ga0075433_101181934 | 235 |
| 380 | 3300006881 | Ga0068865_100031732 | Ga0068865_1000317325 | 235 |
| 381 | 3300009094 | Ga0111539_10157964 | Ga0111539_101579643 | 235 |
| 382 | 3300009094 | Ga0111539_10833348 | Ga0111539_108333482 | 235 |
| 383 | 3300009098 | Ga0105245_10023597 | Ga0105245_100235976 | 235 |
| 384 | 3300009098 | Ga0105245_10070046 | Ga0105245_100700463 | 235 |
| 385 | 3300009098 | Ga0105245_10143776 | Ga0105245_101437763 | 235 |
| 386 | 3300009147 | Ga0114129_10038780 | Ga0114129_100387808 | 235 |
| 387 | 3300009148 | Ga0105243_10023935 | Ga0105243_100239355 | 235 |
| 388 | 3300009148 | Ga0105243_10097084 | Ga0105243_100970842 | 235 |
| 389 | 3300009148 | Ga0105243_10164351 | Ga0105243_101643511 | 235 |
| 390 | 3300009174 | Ga0105241_10100207 | Ga0105241_101002072 | 235 |
| 391 | 3300009174 | Ga0105241_10159922 | Ga0105241_101599222 | 235 |
| 392 | 3300009176 | Ga0105242_10557308 | Ga0105242_105573082 | 235 |
| 393 | 3300009177 | Ga0105248_10045330 | Ga0105248_100453304 | 235 |
| 394 | 3300009177 | Ga0105248_11043442 | Ga0105248_110434421 | 235 |
| 395 | 3300009553 | Ga0105249_10641698 | Ga0105249_106416982 | 235 |
| 396 | 3300009553 | Ga0105249_10687761 | Ga0105249_106877611 | 235 |
| 397 | 3300010375 | Ga0105239_10031030 | Ga0105239_100310303 | 235 |
| 398 | 3300010375 | Ga0105239_10250057 | Ga0105239_102500573 | 235 |
| 399 | 3300011119 | Ga0105246_10111951 | Ga0105246_101119512 | 235 |
| 400 | 3300013102 | Ga0157371_10029676 | Ga0157371_100296763 | 235 |
| 401 | 3300013102 | Ga0157371_10137294 | Ga0157371_101372942 | 235 |
| 402 | 3300013105 | Ga0157369_10102394 | Ga0157369_101023943 | 235 |
| 403 | 3300013306 | Ga0163162_10259427 | Ga0163162_102594273 | 235 |
| 404 | 3300013307 | Ga0157372_10049404 | Ga0157372_100494044 | 235 |
| 405 | 3300013307 | Ga0157372_10124270 | Ga0157372_101242703 | 235 |
| 406 | 3300013308 | Ga0157375_10064949 | Ga0157375_100649492 | 235 |
| 407 | 3300013308 | Ga0157375_10080233 | Ga0157375_100802332 | 235 |
| 408 | 3300014745 | Ga0157377_10005680 | Ga0157377_100056801 | 235 |
| 409 | 3300014745 | Ga0157377_10009457 | Ga0157377_100094576 | 235 |
| 410 | 3300014745 | Ga0157377_10015087 | Ga0157377_100150873 | 235 |
| 411 | 3300014745 | Ga0157377_10111314 | Ga0157377_101113142 | 235 |
| 412 | 3300014968 | Ga0157379_10059591 | Ga0157379_100595913 | 235 |
| 413 | 3300017792 | Ga0163161_10053935 | Ga0163161_100539354 | 235 |
| 414 | 3300025885 | Ga0207653_10066552 | Ga0207653_100665523 | 235 |
| 415 | 3300025901 | Ga0207688_10001403 | Ga0207688_100014039 | 235 |
| 416 | 3300025901 | Ga0207688_10006162 | Ga0207688_100061624 | 235 |
| 417 | 3300025908 | Ga0207643_10114507 | Ga0207643_101145073 | 235 |
| 418 | 3300025909 | Ga0207705_10065729 | Ga0207705_100657291 | 235 |
| 419 | 3300025912 | Ga0207707_10238996 | Ga0207707_102389961 | 235 |
| 420 | 3300025912 | Ga0207707_10253793 | Ga0207707_102537932 | 235 |
| 421 | 3300025917 | Ga0207660_10049258 | Ga0207660_100492582 | 235 |
| 422 | 3300025918 | Ga0207662_10107962 | Ga0207662_101079622 | 235 |
| 423 | 3300025919 | Ga0207657_10001010 | Ga0207657_1000101034 | 235 |
| 424 | 3300025919 | Ga0207657_10059901 | Ga0207657_100599012 | 235 |
| 425 | 3300025919 | Ga0207657_10186079 | Ga0207657_101860792 | 235 |
| 426 | 3300025920 | Ga0207649_10034246 | Ga0207649_100342463 | 235 |
| 427 | 3300025920 | Ga0207649_10035028 | Ga0207649_100350283 | 235 |
| 428 | 3300025920 | Ga0207649_10166286 | Ga0207649_101662862 | 235 |
| 429 | 3300025921 | Ga0207652_10064630 | Ga0207652_100646303 | 235 |
| 430 | 3300025924 | Ga0207694_10155637 | Ga0207694_101556372 | 235 |
| 431 | 3300025924 | Ga0207694_10297908 | Ga0207694_102979081 | 235 |
| 432 | 3300025925 | Ga0207650_10096434 | Ga0207650_100964344 | 235 |
| 433 | 3300025925 | Ga0207650_10112424 | Ga0207650_101124243 | 235 |
| 434 | 3300025927 | Ga0207687_10008752 | Ga0207687_100087522 | 235 |
| 435 | 3300025927 | Ga0207687_10102095 | Ga0207687_101020951 | 235 |
| 436 | 3300025927 | Ga0207687_10136027 | Ga0207687_101360271 | 235 |
| 437 | 3300025932 | Ga0207690_10069688 | Ga0207690_100696882 | 235 |
| 438 | 3300025933 | Ga0207706_10023980 | Ga0207706_100239805 | 235 |
| 439 | 3300025933 | Ga0207706_10033910 | Ga0207706_100339106 | 235 |
| 440 | 3300025933 | Ga0207706_10051168 | Ga0207706_100511684 | 235 |
| 441 | 3300025934 | Ga0207686_10074483 | Ga0207686_100744832 | 235 |
| 442 | 3300025934 | Ga0207686_10159028 | Ga0207686_101590282 | 235 |
| 443 | 3300025934 | Ga0207686_10178591 | Ga0207686_101785911 | 235 |
| 444 | 3300025935 | Ga0207709_10022156 | Ga0207709_100221564 | 235 |
| 445 | 3300025935 | Ga0207709_10022551 | Ga0207709_100225512 | 235 |
| 446 | 3300025935 | Ga0207709_10274812 | Ga0207709_102748122 | 235 |
| 447 | 3300025937 | Ga0207669_10019183 | Ga0207669_100191834 | 235 |
| 448 | 3300025937 | Ga0207669_10198467 | Ga0207669_101984672 | 235 |
| 449 | 3300025940 | Ga0207691_10010456 | Ga0207691_1001045610 | 235 |
| 450 | 3300025940 | Ga0207691_10026609 | Ga0207691_100266096 | 235 |
| 451 | 3300025940 | Ga0207691_10513083 | Ga0207691_105130832 | 235 |
| 452 | 3300025941 | Ga0207711_10222058 | Ga0207711_102220582 | 235 |
| 453 | 3300025944 | Ga0207661_10002116 | Ga0207661_100021169 | 235 |
| 454 | 3300025944 | Ga0207661_10102126 | Ga0207661_101021262 | 235 |
| 455 | 3300025944 | Ga0207661_10117674 | Ga0207661_101176743 | 235 |
| 456 | 3300025944 | Ga0207661_10391893 | Ga0207661_103918932 | 235 |
| 457 | 3300025945 | Ga0207679_10135944 | Ga0207679_101359442 | 235 |
| 458 | 3300025945 | Ga0207679_10240673 | Ga0207679_102406731 | 235 |
| 459 | 3300025945 | Ga0207679_10303011 | Ga0207679_103030113 | 235 |
| 460 | 3300025945 | Ga0207679_10356303 | Ga0207679_103563032 | 235 |
| 461 | 3300025949 | Ga0207667_10285817 | Ga0207667_102858172 | 235 |
| 462 | 3300025949 | Ga0207667_10649629 | Ga0207667_106496291 | 235 |
| 463 | 3300025960 | Ga0207651_10042627 | Ga0207651_100426273 | 235 |
| 464 | 3300025961 | Ga0207712_10336470 | Ga0207712_103364702 | 235 |
| 465 | 3300025972 | Ga0207668_10082938 | Ga0207668_100829382 | 235 |
| 466 | 3300025981 | Ga0207640_10076045 | Ga0207640_100760452 | 235 |
| 467 | 3300025986 | Ga0207658_10059380 | Ga0207658_100593803 | 235 |
| 468 | 3300026023 | Ga0207677_10233022 | Ga0207677_102330222 | 235 |
| 469 | 3300026023 | Ga0207677_10438266 | Ga0207677_104382661 | 235 |
| 470 | 3300026023 | Ga0207677_10571710 | Ga0207677_105717101 | 235 |
| 471 | 3300026035 | Ga0207703_10108622 | Ga0207703_101086223 | 235 |
| 472 | 3300026041 | Ga0207639_10066505 | Ga0207639_100665053 | 235 |
| 473 | 3300026041 | Ga0207639_10070000 | Ga0207639_100700005 | 235 |
| 474 | 3300026041 | Ga0207639_10204830 | Ga0207639_102048302 | 235 |
| 475 | 3300026067 | Ga0207678_10482932 | Ga0207678_104829322 | 235 |
| 476 | 3300026075 | Ga0207708_10026938 | Ga0207708_100269383 | 235 |
| 477 | 3300026075 | Ga0207708_10029313 | Ga0207708_100293135 | 235 |
| 478 | 3300026075 | Ga0207708_10405516 | Ga0207708_104055162 | 235 |
| 479 | 3300026078 | Ga0207702_10094097 | Ga0207702_100940971 | 235 |
| 480 | 3300026078 | Ga0207702_10115772 | Ga0207702_101157721 | 235 |
| 481 | 3300026088 | Ga0207641_10324022 | Ga0207641_103240222 | 235 |
| 482 | 3300026089 | Ga0207648_10023616 | Ga0207648_100236162 | 235 |
| 483 | 3300026089 | Ga0207648_10523448 | Ga0207648_105234482 | 235 |
| 484 | 3300026116 | Ga0207674_10017040 | Ga0207674_100170405 | 235 |
| 485 | 3300026116 | Ga0207674_10027394 | Ga0207674_100273942 | 235 |
| 486 | 3300026116 | Ga0207674_10248810 | Ga0207674_102488102 | 235 |
| 487 | 3300026116 | Ga0207674_10332750 | Ga0207674_103327503 | 235 |
| 488 | 3300026116 | Ga0207674_10653180 | Ga0207674_106531801 | 235 |
| 489 | 3300026118 | Ga0207675_100014934 | Ga0207675_1000149347 | 235 |
| 490 | 3300026118 | Ga0207675_100129978 | Ga0207675_1001299782 | 235 |
| 491 | 3300026121 | Ga0207683_10016673 | Ga0207683_100166737 | 235 |
| 492 | 3300026142 | Ga0207698_10073734 | Ga0207698_100737343 | 235 |
| 493 | 3300026142 | Ga0207698_10559089 | Ga0207698_105590892 | 235 |
| 494 | 3300027907 | Ga0207428_10000244 | Ga0207428_1000024414 | 235 |
| 495 | 3300027907 | Ga0207428_10050859 | Ga0207428_100508593 | 235 |
| 496 | 3300028379 | Ga0268266_10067580 | Ga0268266_100675804 | 235 |
| 497 | 3300028380 | Ga0268265_10132980 | Ga0268265_101329802 | 235 |
| 498 | 3300028380 | Ga0268265_10615168 | Ga0268265_106151681 | 235 |
| 499 | 3300031901 | Ga0307406_10818474 | Ga0307406_108184741 | 235 |
| 500 | 3300034957 | Ga0373938_0035511 | Ga0373938_0035511_121_828 | 235 |
| 501 | 3300035121 | Ga0373960_0002607 | Ga0373960_0002607_1427_2134 | 235 |
| 502 | 3300035691 | Ga0373931_0101830 | Ga0373931_0101830_342_1049 | 235 |
| 503 | 3300041486 | Ga0451807_1742402 | Ga0451807_1742402_147_854 | 235 |
| 504 | 3300042005 | Ga0439448_0113386 | Ga0439448_0113386_160_867 | 235 |
| 505 | 3300042118 | Ga0450914_000276 | Ga0450914_000276_482_1189 | 235 |
| 506 | 3300042145 | Ga0450906_012059 | Ga0450906_012059_419_1126 | 235 |
| 507 | 3300042438 | Ga0439459_0020854 | Ga0439459_0020854_239_946 | 235 |
| 508 | 3300048908 | Ga0496105_0110301 | Ga0496105_0110301_483_1190 | 235 |
| 509 | 3300048911 | Ga0496108_0009092 | Ga0496108_0009092_1602_2309 | 235 |
| 510 | 3300048911 | Ga0496108_0063926 | Ga0496108_0063926_1314_2021 | 235 |
| 511 | 3300048912 | Ga0496109_0008352 | Ga0496109_0008352_6617_7324 | 235 |
| 512 | 3300048912 | Ga0496109_0293917 | Ga0496109_0293917_546_1253 | 235 |
| 513 | 3300048913 | Ga0496110_0013159 | Ga0496110_0013159_5391_6098 | 235 |
| 514 | 3300048913 | Ga0496110_0060184 | Ga0496110_0060184_1165_1872 | 235 |
| 515 | 3300048913 | Ga0496110_0074971 | Ga0496110_0074971_2188_2895 | 235 |
| 516 | 3300048913 | Ga0496110_0084249 | Ga0496110_0084249_1277_1984 | 235 |
| 517 | 3300048914 | Ga0496111_0002857 | Ga0496111_0002857_8084_8791 | 235 |
| 518 | 3300048914 | Ga0496111_0023990 | Ga0496111_0023990_2035_2742 | 235 |
| 519 | 3300048914 | Ga0496111_0122453 | Ga0496111_0122453_773_1480 | 235 |
| 520 | 3300048915 | Ga0496112_0020518 | Ga0496112_0020518_4902_5609 | 235 |
| 521 | 3300048916 | Ga0496113_0053237 | Ga0496113_0053237_648_1355 | 235 |
| 522 | 3300048917 | Ga0496114_0411360 | Ga0496114_0411360_464_1171 | 235 |
| 523 | 3300049568 | Ga0501031_0015535 | Ga0501031_0015535_723_1430 | 235 |
| 524 | 3300049568 | Ga0501031_0052869 | Ga0501031_0052869_1022_1729 | 235 |
| 525 | 3300049569 | Ga0501032_0031634 | Ga0501032_0031634_2066_2773 | 235 |
| 526 | 3300049569 | Ga0501032_0063572 | Ga0501032_0063572_1644_2351 | 235 |
| 527 | 3300049570 | Ga0501033_0050721 | Ga0501033_0050721_1518_2225 | 235 |
| 528 | 3300049570 | Ga0501033_0152906 | Ga0501033_0152906_516_1223 | 235 |
| 529 | 3300049572 | Ga0501036_0002878 | Ga0501036_0002878_8558_9265 | 235 |
| 530 | 3300049572 | Ga0501036_0024789 | Ga0501036_0024789_30_737 | 235 |
| 531 | 3300049572 | Ga0501036_0176644 | Ga0501036_0176644_341_1048 | 235 |
| 532 | 3300049573 | Ga0501037_0071846 | Ga0501037_0071846_1254_1961 | 235 |
| 533 | 3300049573 | Ga0501037_0141275 | Ga0501037_0141275_997_1704 | 235 |
| 534 | 3300049574 | Ga0501038_0022126 | Ga0501038_0022126_1328_2035 | 235 |
| 535 | 3300049574 | Ga0501038_0271444 | Ga0501038_0271444_114_821 | 235 |
| 536 | 3300049575 | Ga0501039_0003065 | Ga0501039_0003065_6099_6806 | 235 |
| 537 | 3300049575 | Ga0501039_0008700 | Ga0501039_0008700_5529_6236 | 235 |
| 538 | 3300049575 | Ga0501039_0011656 | Ga0501039_0011656_1023_1730 | 235 |
| 539 | 3300049575 | Ga0501039_0165130 | Ga0501039_0165130_574_1281 | 235 |
| 540 | 3300049576 | Ga0501040_0006377 | Ga0501040_0006377_4224_4931 | 235 |
| 541 | 3300049576 | Ga0501040_0015305 | Ga0501040_0015305_3511_4218 | 235 |
| 542 | 3300049577 | Ga0501041_0009685 | Ga0501041_0009685_4147_4854 | 235 |
| 543 | 3300049577 | Ga0501041_0032310 | Ga0501041_0032310_2240_2947 | 235 |
| 544 | 3300049577 | Ga0501041_0196945 | Ga0501041_0196945_237_944 | 235 |
| 545 | 3300049578 | Ga0501042_0005099 | Ga0501042_0005099_4363_5070 | 235 |
| 546 | 3300049578 | Ga0501042_0022473 | Ga0501042_0022473_1895_2602 | 235 |
| 547 | 3300049578 | Ga0501042_0046879 | Ga0501042_0046879_901_1608 | 235 |
| 548 | 3300049579 | Ga0501043_0194724 | Ga0501043_0194724_124_831 | 235 |
| 549 | 3300049579 | Ga0501043_0203376 | Ga0501043_0203376_177_884 | 235 |
| 550 | 3300049580 | Ga0501046_0017152 | Ga0501046_0017152_5310_6017 | 235 |
| 551 | 3300049580 | Ga0501046_0019020 | Ga0501046_0019020_3233_3940 | 235 |
| 552 | 3300049580 | Ga0501046_0020889 | Ga0501046_0020889_3763_4470 | 235 |
| 553 | 3300049582 | Ga0501048_0120565 | Ga0501048_0120565_122_829 | 235 |
| 554 | 3300049584 | Ga0501068_0012680 | Ga0501068_0012680_1359_2066 | 235 |
| 555 | 3300049584 | Ga0501068_0038057 | Ga0501068_0038057_967_1674 | 235 |
| 556 | 3300049585 | Ga0501069_0012844 | Ga0501069_0012844_755_1462 | 235 |
| 557 | 3300049587 | Ga0501071_0005923 | Ga0501071_0005923_1942_2649 | 235 |
| 558 | 3300049588 | Ga0501072_0002327 | Ga0501072_0002327_1193_1900 | 235 |
| 559 | 3300049588 | Ga0501072_0003758 | Ga0501072_0003758_5134_5841 | 235 |
| 560 | 3300049589 | Ga0501073_0046682 | Ga0501073_0046682_1521_2228 | 235 |
| 561 | 3300049589 | Ga0501073_0085238 | Ga0501073_0085238_1382_2089 | 235 |
| 562 | 3300049589 | Ga0501073_0097732 | Ga0501073_0097732_454_1161 | 235 |
| 563 | 3300049590 | Ga0501074_0019343 | Ga0501074_0019343_90_797 | 235 |
| 564 | 3300049590 | Ga0501074_0031823 | Ga0501074_0031823_1368_2075 | 235 |
| 565 | 3300049590 | Ga0501074_0160941 | Ga0501074_0160941_258_965 | 235 |
| 566 | 3300049591 | Ga0501075_0011797 | Ga0501075_0011797_5363_6070 | 235 |
| 567 | 3300049591 | Ga0501075_0019900 | Ga0501075_0019900_2746_3453 | 235 |
| 568 | 3300049591 | Ga0501075_0033917 | Ga0501075_0033917_2772_3479 | 235 |
| 569 | 3300049592 | Ga0501076_0002568 | Ga0501076_0002568_5793_6500 | 235 |
| 570 | 3300049592 | Ga0501076_0003503 | Ga0501076_0003503_4830_5537 | 235 |
| 571 | 3300049592 | Ga0501076_0016358 | Ga0501076_0016358_3266_3973 | 235 |
| 572 | 3300049593 | Ga0501077_0001034 | Ga0501077_0001034_4875_5582 | 235 |
| 573 | 3300049593 | Ga0501077_0002923 | Ga0501077_0002923_5407_6114 | 235 |
| 574 | 3300049593 | Ga0501077_0125267 | Ga0501077_0125267_854_1561 | 235 |
| 575 | 3300049741 | Ga0501079_0012125 | Ga0501079_0012125_5461_6168 | 235 |
| 576 | 3300049741 | Ga0501079_0012179 | Ga0501079_0012179_4260_4967 | 235 |
| 577 | 3300049741 | Ga0501079_0020392 | Ga0501079_0020392_2119_2826 | 235 |
| 578 | 3300049741 | Ga0501079_0132643 | Ga0501079_0132643_108_815 | 235 |
| 579 | 3300049742 | Ga0501080_0006433 | Ga0501080_0006433_3890_4597 | 235 |
| 580 | 3300049742 | Ga0501080_0013557 | Ga0501080_0013557_5827_6534 | 235 |
| 581 | 3300049742 | Ga0501080_0087670 | Ga0501080_0087670_987_1694 | 235 |
| 582 | 3300049743 | Ga0501081_0006444 | Ga0501081_0006444_6033_6740 | 235 |
| 583 | 3300049743 | Ga0501081_0008703 | Ga0501081_0008703_1469_2176 | 235 |
| 584 | 3300049743 | Ga0501081_0017081 | Ga0501081_0017081_1895_2602 | 235 |
| 585 | 3300049744 | Ga0501083_0017700 | Ga0501083_0017700_372_1079 | 235 |
| 586 | 3300049822 | Ga0501035_0009648 | Ga0501035_0009648_1054_1761 | 235 |
| 587 | 3300049822 | Ga0501035_0104046 | Ga0501035_0104046_1448_2155 | 235 |
| 588 | 3300049824 | Ga0501045_0014465 | Ga0501045_0014465_4319_5026 | 235 |
| 589 | 3300049824 | Ga0501045_0145399 | Ga0501045_0145399_790_1497 | 235 |
| 590 | 3300050491 | nmdc:mga00v17_406073_c1 | nmdc:mga00v17_406073_c1_124_831 | 235 |
| 591 | 3300050492 | nmdc:mga0yw44_4853_c2 | nmdc:mga0yw44_4853_c2_2763_3470 | 235 |
| 592 | 3300050507 | nmdc:mga05p37_5841_c2 | nmdc:mga05p37_5841_c2_5051_5758 | 235 |
| 593 | 3300050511 | nmdc:mga08y16_157665_c1 | nmdc:mga08y16_157665_c1_291_998 | 235 |
| 594 | 3300050511 | nmdc:mga08y16_578951_c1 | nmdc:mga08y16_578951_c1_210_917 | 235 |
| 595 | 3300050515 | nmdc:mga0a205_8363_c1 | nmdc:mga0a205_8363_c1_5244_5951 | 235 |
| 596 | 3300054114 | Ga0501084_0006463 | Ga0501084_0006463_5967_6674 | 235 |
| 597 | 3300054114 | Ga0501084_0010024 | Ga0501084_0010024_1163_1870 | 235 |
| 598 | 3300054114 | Ga0501084_0037042 | Ga0501084_0037042_23_730 | 235 |
| 599 | 3300060353 | Ga0501082_0004592 | Ga0501082_0004592_5918_6625 | 235 |
| 600 | 3300060353 | Ga0501082_0007538 | Ga0501082_0007538_5021_5728 | 235 |
| 601 | 3300060353 | Ga0501082_0046153 | Ga0501082_0046153_1113_1820 | 235 |
| 602 | 3300061734 | Ga0530510_0012356 | Ga0530510_0012356_973_1680 | 235 |
| 603 | 3300061734 | Ga0530510_0052261 | Ga0530510_0052261_978_1685 | 235 |
| 604 | 3300061734 | Ga0530510_0083757 | Ga0530510_0083757_1299_2006 | 235 |
| 605 | 3300061734 | Ga0530510_0102895 | Ga0530510_0102895_1186_1893 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3x30-assembly1.cif.gz_A | crystal structure of metallo-beta-lactamase from thermotoga maritima | 0.9522 | 3 | 235 |
| 3x2x-assembly1.cif.gz_C | crystal structure of metallo-beta-lactamase h48a from thermotoga maritima | 0.9467 | 3 | 235 |
| 3x30-assembly1.cif.gz_A | crystal structure of metallo-beta-lactamase from thermotoga maritima | 0.944 | 3 | 235 |
| 3x2x-assembly1.cif.gz_C | crystal structure of metallo-beta-lactamase h48a from thermotoga maritima | 0.9387 | 3 | 235 |
| 7e3w-assembly1.cif.gz_C | metallo beta-lactamase fold protein (camp bound) | 0.9376 | 3 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM0_1_229_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9473 | 4 | 235 | 3.60.15.10 |
| af_Q2FXM0_1_229_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9393 | 4 | 235 | 3.60.15.10 |
| 3x30A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9178 | 4 | 235 | 3.60.15.10 |
| 3x30A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9098 | 4 | 235 | 3.60.15.10 |
| af_Q58563_1_217_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8981 | 5 | 235 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0TCX9-F1-model_v4 | UPF0173 metal-dependent hydrolase H0U05_09140 | 0.9921 | 1 | 235 |
GO:0016787
|
| AF-A0A7W0TCX9-F1-model_v4 | UPF0173 metal-dependent hydrolase H0U05_09140 | 0.9879 | 1 | 235 |
GO:0016787
|
| AF-A0A538GAP3-F1-model_v4 | Metal-dependent hydrolase | 0.9834 | 158 | 235 |
|
| AF-A0A351B0Z3-F1-model_v4 | deleted | 0.9826 | 158 | 233 |
|
| AF-A0A7J9YQF1-F1-model_v4 | UPF0173 metal-dependent hydrolase GEU88_00955 | 0.981 | 2 | 234 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar