F468464

General Info

Members Datasets Scaffolds Average Seq Length
605 270 1210 111

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_11403825|Ga0105247_114038252
Length 125
Sequence MFKPPTTTTLSRHFVTVRAQTDALRGSLDLLVLKTLSLVPMHGWGIGQRIQQTSKGILEVNQGSLYPALQRLEKDGLIVSDWGATDNNRRARYYRLTPSGRRALGQELESWKRFSSGLDAVLRST

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
250 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
256 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 1.65
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 15.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_11403825 3300009101 Bacteria 565
2 Ga0065714_10334836 3300005288 Bacteria 652
3 Ga0065712_10150657 3300005290 Unclassified 1372
4 Ga0070658_10507288 3300005327 Unclassified 1042
5 Ga0070676_10986139 3300005328 Unclassified 632
6 Ga0070683_100000397 3300005329 Bacteria 30109
7 Ga0070683_100118677 3300005329 Bacteria 2498
8 Ga0070683_100128940 3300005329 Bacteria 2393
9 Ga0070683_100186309 3300005329 Bacteria 1970
10 Ga0070683_100491843 3300005329 Unclassified 1172
11 Ga0070683_100550580 3300005329 Bacteria 1103
12 Ga0070683_100784860 3300005329 Bacteria 913
13 Ga0070690_100011574 3300005330 Bacteria 5164
14 Ga0070690_100022311 3300005330 Bacteria 3872
15 Ga0070690_100030192 3300005330 Bacteria 3366
16 Ga0070670_100008704 3300005331 Bacteria 8662
17 Ga0070670_100054671 3300005331 Unclassified 3427
18 Ga0070670_100443381 3300005331 Bacteria 1150
19 Ga0070670_101210081 3300005331 Bacteria 690
20 Ga0070670_101229458 3300005331 Bacteria 685
21 Ga0070677_10742518 3300005333 Unclassified 556
22 Ga0068869_100012820 3300005334 Bacteria 5548
23 Ga0068869_100084552 3300005334 Bacteria 2375
24 Ga0068869_101885675 3300005334 Unclassified 535
25 Ga0070666_10332604 3300005335 Bacteria 1085
26 Ga0070666_10563851 3300005335 Bacteria 829
27 Ga0070666_10642669 3300005335 Unclassified 776
28 Ga0070666_10695871 3300005335 Unclassified 745
29 Ga0070680_100145278 3300005336 Bacteria 1990
30 Ga0070680_100182186 3300005336 Unclassified 1769
31 Ga0070680_100365025 3300005336 Bacteria 1228
32 Ga0070682_100002879 3300005337 Bacteria 9543
33 Ga0070682_100133844 3300005337 Unclassified 1681
34 Ga0070682_100192666 3300005337 Bacteria 1432
35 Ga0068868_100376293 3300005338 Bacteria 1221
36 Ga0068868_101251479 3300005338 Bacteria 688
37 Ga0070660_100071410 3300005339 Unclassified 2711
38 Ga0070660_100105209 3300005339 Bacteria 2239
39 Ga0070689_100014037 3300005340 Bacteria 5812
40 Ga0070689_100043089 3300005340 Unclassified 3467
41 Ga0070689_100301854 3300005340 Bacteria 1333
42 Ga0070691_10939351 3300005341 Bacteria 536
43 Ga0070687_100031001 3300005343 Bacteria 2619
44 Ga0070687_100258414 3300005343 Unclassified 1085
45 Ga0070661_100003510 3300005344 Bacteria 10799
46 Ga0070661_100032444 3300005344 Bacteria 3781
47 Ga0070661_101136032 3300005344 Bacteria 652
48 Ga0070692_10146398 3300005345 Bacteria 1342
49 Ga0070692_10281849 3300005345 Unclassified 1007
50 Ga0070668_100196206 3300005347 Bacteria 1655
51 Ga0070668_101073635 3300005347 Bacteria 726
52 Ga0070669_100345512 3300005353 Bacteria 1207
53 Ga0070669_100890319 3300005353 Bacteria 760
54 Ga0070669_101982180 3300005353 Unclassified 509
55 Ga0070675_100019195 3300005354 Bacteria 5446
56 Ga0070675_100156897 3300005354 Bacteria 1954
57 Ga0070675_100174951 3300005354 Bacteria 1853
58 Ga0070675_100282922 3300005354 Bacteria 1458
59 Ga0070675_100370794 3300005354 Bacteria 1273
60 Ga0070675_100457091 3300005354 Bacteria 1146
61 Ga0070675_100569405 3300005354 Bacteria 1025
62 Ga0070675_102094061 3300005354 Bacteria 521
63 Ga0070671_100403031 3300005355 Bacteria 1170
64 Ga0070671_101436784 3300005355 Bacteria 610
65 Ga0070674_101668657 3300005356 Bacteria 576
66 Ga0070673_100045583 3300005364 Bacteria 3401
67 Ga0070673_100128225 3300005364 Unclassified 2125
68 Ga0070673_100361329 3300005364 Bacteria 1291
69 Ga0070673_100599368 3300005364 Bacteria 1005
70 Ga0070688_100156501 3300005365 Bacteria 1562
71 Ga0070688_100208587 3300005365 Bacteria 1371
72 Ga0070688_101334432 3300005365 Bacteria 580
73 Ga0070659_100021345 3300005366 Bacteria 4931
74 Ga0070659_100032698 3300005366 Bacteria 4036
75 Ga0070659_100054972 3300005366 Bacteria 3136
76 Ga0070667_100052574 3300005367 Bacteria 3438
77 Ga0070667_100393735 3300005367 Bacteria 1260
78 Ga0070667_100517931 3300005367 Unclassified 1094
79 Ga0070667_101400693 3300005367 Bacteria 656
80 Ga0070703_10289507 3300005406 Bacteria 679
81 Ga0070714_102510790 3300005435 Bacteria 500
82 Ga0070710_10827708 3300005437 Unclassified 663
83 Ga0070701_10147152 3300005438 Bacteria 1353
84 Ga0070711_100742921 3300005439 Bacteria 829
85 Ga0070700_100805666 3300005441 Bacteria 757
86 Ga0070694_100672240 3300005444 Bacteria 840
87 Ga0070663_102142797 3300005455 Unclassified 504
88 Ga0070678_100357791 3300005456 Bacteria 1257
89 Ga0070678_101207024 3300005456 Bacteria 701
90 Ga0070662_100039730 3300005457 Bacteria 3347
91 Ga0070662_100146976 3300005457 Bacteria 1832
92 Ga0070681_10005421 3300005458 Bacteria 12324
93 Ga0070681_10014161 3300005458 Bacteria 7938
94 Ga0070681_10023567 3300005458 Bacteria 6191
95 Ga0070681_10035575 3300005458 Bacteria 5003
96 Ga0070681_10053917 3300005458 Bacteria 4006
97 Ga0070681_10062326 3300005458 Bacteria 3702
98 Ga0070681_10124064 3300005458 Bacteria 2515
99 Ga0070681_10718209 3300005458 Bacteria 915
100 Ga0068867_100872029 3300005459 Bacteria 808
101 Ga0068867_100920778 3300005459 Bacteria 788
102 Ga0068867_101365879 3300005459 Unclassified 656
103 Ga0070685_10094419 3300005466 Bacteria 1816
104 Ga0070685_10113558 3300005466 Bacteria 1672
105 Ga0070685_10732072 3300005466 Bacteria 724
106 Ga0070707_100600347 3300005468 Bacteria 1063
107 Ga0070698_100238685 3300005471 Bacteria 1751
108 Ga0070679_100027827 3300005530 Bacteria 5569
109 Ga0070679_100135487 3300005530 Bacteria 2444
110 Ga0070679_100196255 3300005530 Bacteria 1986
111 Ga0070679_100302910 3300005530 Bacteria 1549
112 Ga0070679_100608202 3300005530 Bacteria 1036
113 Ga0070679_100762621 3300005530 Bacteria 910
114 Ga0070679_100956427 3300005530 Bacteria 800
115 Ga0070684_100002124 3300005535 Bacteria 14621
116 Ga0070684_100009702 3300005535 Bacteria 7596
117 Ga0070684_100021443 3300005535 Bacteria 5377
118 Ga0070684_100069824 3300005535 Bacteria 3090
119 Ga0070684_100073445 3300005535 Unclassified 3014
120 Ga0070684_100163363 3300005535 Bacteria 2021
121 Ga0070672_100080941 3300005543 Bacteria 2603
122 Ga0070672_100123371 3300005543 Bacteria 2123
123 Ga0070672_100412728 3300005543 Bacteria 1159
124 Ga0070672_100757868 3300005543 Bacteria 852
125 Ga0070672_100819076 3300005543 Bacteria 820
126 Ga0070686_100373998 3300005544 Bacteria 1077
127 Ga0070686_100860422 3300005544 Bacteria 735
128 Ga0070696_100000091 3300005546 Bacteria 44490
129 Ga0070693_100005288 3300005547 Bacteria 6185
130 Ga0070693_100054905 3300005547 Bacteria 2293
131 Ga0070693_100094296 3300005547 Bacteria 1811
132 Ga0070693_100189337 3300005547 Bacteria 1330
133 Ga0070665_100480897 3300005548 Bacteria 1253
134 Ga0070665_101783690 3300005548 Unclassified 622
135 Ga0068855_102541746 3300005563 Bacteria 509
136 Ga0070664_100040858 3300005564 Bacteria 3912
137 Ga0070664_100044326 3300005564 Bacteria 3756
138 Ga0070664_100084312 3300005564 Bacteria 2743
139 Ga0070664_100113459 3300005564 Bacteria 2367
140 Ga0070664_100117072 3300005564 Bacteria 2331
141 Ga0068857_100012441 3300005577 Bacteria 7408
142 Ga0068857_100050063 3300005577 Unclassified 3706
143 Ga0068857_100081828 3300005577 Bacteria 2883
144 Ga0068857_100284974 3300005577 Bacteria 1520
145 Ga0068857_100694042 3300005577 Bacteria 967
146 Ga0068857_102528520 3300005577 Unclassified 504
147 Ga0068854_102045710 3300005578 Bacteria 528
148 Ga0068856_100098099 3300005614 Bacteria 2920
149 Ga0068856_100889628 3300005614 Unclassified 909
150 Ga0070702_101056571 3300005615 Bacteria 646
151 Ga0068852_100057164 3300005616 Bacteria 3375
152 Ga0068852_100896706 3300005616 Bacteria 904
153 Ga0068852_102099570 3300005616 Bacteria 587
154 Ga0068859_100012899 3300005617 Bacteria 8395
155 Ga0068859_100068612 3300005617 Bacteria 3580
156 Ga0068859_100544055 3300005617 Bacteria 1256
157 Ga0068859_101103483 3300005617 Bacteria 873
158 Ga0068859_101209848 3300005617 Bacteria 832
159 Ga0068864_100145945 3300005618 Unclassified 2139
160 Ga0068864_100274761 3300005618 Bacteria 1571
161 Ga0068864_100642562 3300005618 Unclassified 1033
162 Ga0068864_101923877 3300005618 Bacteria 597
163 Ga0068864_102499530 3300005618 Bacteria 523
164 Ga0068866_10169061 3300005718 Unclassified 1282
165 Ga0068861_100209594 3300005719 Bacteria 1641
166 Ga0068861_101418634 3300005719 Bacteria 679
167 Ga0068861_102018286 3300005719 Bacteria 576
168 Ga0068851_10027563 3300005834 Unclassified 2800
169 Ga0068851_10389920 3300005834 Bacteria 818
170 Ga0068870_10023943 3300005840 Bacteria 3017
171 Ga0068870_10067451 3300005840 Bacteria 1941
172 Ga0068870_10095415 3300005840 Bacteria 1671
173 Ga0068870_10326050 3300005840 Bacteria 977
174 Ga0068870_10390273 3300005840 Bacteria 903
175 Ga0068870_10490680 3300005840 Bacteria 817
176 Ga0068863_100085116 3300005841 Bacteria 2996
177 Ga0068863_100580198 3300005841 Bacteria 1109
178 Ga0068863_100839653 3300005841 Bacteria 917
179 Ga0068858_100013502 3300005842 Bacteria 7707
180 Ga0068858_100142831 3300005842 Bacteria 2248
181 Ga0068858_101691433 3300005842 Bacteria 625
182 Ga0068860_100161200 3300005843 Bacteria 2162
183 Ga0068860_101028858 3300005843 Unclassified 842
184 Ga0068860_102052268 3300005843 Unclassified 593
185 Ga0068862_100022773 3300005844 Bacteria 5242
186 Ga0068862_100055358 3300005844 Bacteria 3398
187 Ga0081455_10155791 3300005937 Bacteria 1756
188 Ga0075367_10017173 3300006178 Bacteria 3967
189 Ga0097621_100070749 3300006237 Bacteria 2881
190 Ga0097621_100715762 3300006237 Bacteria 923
191 Ga0097621_100903686 3300006237 Bacteria 823
192 Ga0068871_100027068 3300006358 Bacteria 4481
193 Ga0068871_100981580 3300006358 Bacteria 786
194 Ga0075428_100022057 3300006844 Bacteria 7049
195 Ga0075428_100052361 3300006844 Bacteria 4475
196 Ga0075428_100200113 3300006844 Bacteria 2160
197 Ga0075428_102468747 3300006844 Bacteria 533
198 Ga0075430_100376347 3300006846 Unclassified 1172
199 Ga0075431_100038235 3300006847 Bacteria 4941
200 Ga0075431_100105725 3300006847 Bacteria 2904
201 Ga0075433_10747488 3300006852 Bacteria 855
202 Ga0075434_100013484 3300006871 Bacteria 7781
203 Ga0075434_100335165 3300006871 Unclassified 1533
204 Ga0075434_100499355 3300006871 Bacteria 1237
205 Ga0075434_100618975 3300006871 Unclassified 1101
206 Ga0075429_100004287 3300006880 Bacteria 12246
207 Ga0075429_100022694 3300006880 Bacteria 5441
208 Ga0075429_101597988 3300006880 Bacteria 567
209 Ga0068865_100190954 3300006881 Bacteria 1584
210 Ga0068865_100434577 3300006881 Bacteria 1082
211 Ga0068865_100592729 3300006881 Bacteria 936
212 Ga0068865_100598421 3300006881 Bacteria 932
213 Ga0068865_100931579 3300006881 Bacteria 757
214 Ga0097620_100012901 3300006931 Bacteria 8395
215 Ga0097620_100068610 3300006931 Bacteria 3580
216 Ga0097620_100544096 3300006931 Bacteria 1256
217 Ga0097620_101103529 3300006931 Bacteria 873
218 Ga0097620_101127150 3300006931 Bacteria 863
219 Ga0097620_101209893 3300006931 Bacteria 832
220 Ga0075435_100812627 3300007076 Bacteria 814
221 Ga0111539_10115559 3300009094 Bacteria 3147
222 Ga0111539_10392128 3300009094 Bacteria 1617
223 Ga0111539_10795929 3300009094 Bacteria 1100
224 Ga0111539_11345017 3300009094 Bacteria 829
225 Ga0105245_10006625 3300009098 Bacteria 10170
226 Ga0105245_10175458 3300009098 Bacteria 2044
227 Ga0105245_10211751 3300009098 Unclassified 1866
228 Ga0105245_10294318 3300009098 Bacteria 1591
229 Ga0105245_10964767 3300009098 Bacteria 896
230 Ga0105245_11904924 3300009098 Bacteria 648
231 Ga0105247_10446550 3300009101 Unclassified 931
232 Ga0105247_10715659 3300009101 Bacteria 755
233 Ga0114129_10085612 3300009147 Bacteria 4373
234 Ga0114129_10310051 3300009147 Bacteria 2101
235 Ga0114129_11877327 3300009147 Bacteria 727
236 Ga0114129_12294165 3300009147 Unclassified 648
237 Ga0105243_10082332 3300009148 Bacteria 2630
238 Ga0105243_10584989 3300009148 Bacteria 1072
239 Ga0105243_11069245 3300009148 Bacteria 813
240 Ga0105243_12484387 3300009148 Bacteria 557
241 Ga0105241_10003972 3300009174 Bacteria 10936
242 Ga0105241_10609190 3300009174 Bacteria 987
243 Ga0105242_10085925 3300009176 Bacteria 2639
244 Ga0105242_10243769 3300009176 Unclassified 1617
245 Ga0105242_10716290 3300009176 Unclassified 981
246 Ga0105242_11369293 3300009176 Bacteria 734
247 Ga0105242_11463834 3300009176 Bacteria 712
248 Ga0105248_10197420 3300009177 Bacteria 2267
249 Ga0105248_10844042 3300009177 Bacteria 1034
250 Ga0105248_10900805 3300009177 Bacteria 999
251 Ga0105248_11036632 3300009177 Bacteria 927
252 Ga0105248_11552022 3300009177 Bacteria 750
253 Ga0105248_12054343 3300009177 Unclassified 649
254 Ga0105237_10213937 3300009545 Bacteria 1927
255 Ga0105237_10504184 3300009545 Bacteria 1217
256 Ga0105238_10155484 3300009551 Bacteria 2262
257 Ga0105238_10304346 3300009551 Unclassified 1578
258 Ga0105238_10477572 3300009551 Bacteria 1246
259 Ga0105249_10031359 3300009553 Bacteria 4807
260 Ga0105249_10131720 3300009553 Unclassified 2388
261 Ga0105249_10714102 3300009553 Unclassified 1063
262 Ga0105239_11704893 3300010375 Bacteria 729
263 Ga0105246_10047589 3300011119 Bacteria 2929
264 Ga0105246_10293128 3300011119 Bacteria 1310
265 Ga0157371_10007749 3300013102 Bacteria 8634
266 Ga0157371_10047491 3300013102 Bacteria 3053
267 Ga0157369_10358966 3300013105 Unclassified 1513
268 Ga0157369_10760826 3300013105 Unclassified 996
269 Ga0157369_12471710 3300013105 Bacteria 526
270 Ga0157374_10721347 3300013296 Unclassified 1011
271 Ga0157374_10990862 3300013296 Bacteria 859
272 Ga0157378_10391768 3300013297 Bacteria 1367
273 Ga0163162_10286087 3300013306 Bacteria 1780
274 Ga0163162_10767207 3300013306 Bacteria 1083
275 Ga0157372_10096471 3300013307 Bacteria 3370
276 Ga0157372_10439388 3300013307 Bacteria 1521
277 Ga0157372_10491108 3300013307 Bacteria 1432
278 Ga0157372_10847238 3300013307 Bacteria 1061
279 Ga0157372_10919230 3300013307 Unclassified 1015
280 Ga0157372_12599545 3300013307 Bacteria 581
281 Ga0157375_10010663 3300013308 Bacteria 8094
282 Ga0157375_10064241 3300013308 Bacteria 3654
283 Ga0157375_10245359 3300013308 Bacteria 1951
284 Ga0157375_10266493 3300013308 Unclassified 1875
285 Ga0157375_10876025 3300013308 Bacteria 1043
286 Ga0157375_11214131 3300013308 Unclassified 885
287 Ga0157375_12504930 3300013308 Bacteria 616
288 Ga0163163_10005137 3300014325 Bacteria 11282
289 Ga0163163_10376362 3300014325 Bacteria 1477
290 Ga0163163_10685658 3300014325 Bacteria 1088
291 Ga0163163_11391365 3300014325 Bacteria 763
292 Ga0163163_12939761 3300014325 Unclassified 532
293 Ga0157380_10024401 3300014326 Bacteria 4577
294 Ga0157380_10081761 3300014326 Bacteria 2643
295 Ga0157377_10000839 3300014745 Bacteria 12728
296 Ga0157377_10402085 3300014745 Unclassified 933
297 Ga0157377_10749997 3300014745 Bacteria 714
298 Ga0157379_12042109 3300014968 Bacteria 567
299 Ga0157376_10011794 3300014969 Bacteria 6458
300 Ga0157376_10828504 3300014969 Bacteria 939
301 Ga0157376_10859051 3300014969 Bacteria 923
302 Ga0163161_10083452 3300017792 Bacteria 2355
303 Ga0163161_10290839 3300017792 Bacteria 1284
304 Ga0213875_10461425 3300021388 Bacteria 608
305 Ga0207656_10075212 3300025321 Bacteria 1508
306 Ga0207656_10247428 3300025321 Bacteria 873
307 Ga0207682_10344654 3300025893 Unclassified 701
308 Ga0207642_10732565 3300025899 Bacteria 625
309 Ga0207710_10146760 3300025900 Bacteria 1142
310 Ga0207688_10387038 3300025901 Bacteria 866
311 Ga0207680_10427392 3300025903 Bacteria 938
312 Ga0207680_10497401 3300025903 Unclassified 868
313 Ga0207699_10136911 3300025906 Bacteria 1605
314 Ga0207645_10145098 3300025907 Bacteria 1547
315 Ga0207645_10321884 3300025907 Bacteria 1031
316 Ga0207645_10462387 3300025907 Bacteria 857
317 Ga0207643_10086015 3300025908 Bacteria 1826
318 Ga0207643_10292498 3300025908 Bacteria 1012
319 Ga0207643_10611106 3300025908 Bacteria 702
320 Ga0207654_10199473 3300025911 Bacteria 1317
321 Ga0207707_10010391 3300025912 Bacteria 8078
322 Ga0207707_10043961 3300025912 Bacteria 3895
323 Ga0207707_10073652 3300025912 Bacteria 2978
324 Ga0207707_10147988 3300025912 Bacteria 2053
325 Ga0207707_10273185 3300025912 Bacteria 1465
326 Ga0207707_10367697 3300025912 Unclassified 1238
327 Ga0207707_10452911 3300025912 Bacteria 1098
328 Ga0207693_11183891 3300025915 Bacteria 577
329 Ga0207663_10270529 3300025916 Bacteria 1258
330 Ga0207660_10023251 3300025917 Bacteria 4185
331 Ga0207660_10037631 3300025917 Bacteria 3373
332 Ga0207660_10711198 3300025917 Bacteria 819
333 Ga0207662_10001842 3300025918 Bacteria 10423
334 Ga0207662_10027054 3300025918 Bacteria 3311
335 Ga0207662_10056810 3300025918 Bacteria 2338
336 Ga0207662_10960650 3300025918 Bacteria 606
337 Ga0207657_10020891 3300025919 Bacteria 6179
338 Ga0207657_10073934 3300025919 Unclassified 2879
339 Ga0207657_10422436 3300025919 Bacteria 1048
340 Ga0207649_10009278 3300025920 Bacteria 5381
341 Ga0207649_10033247 3300025920 Bacteria 3080
342 Ga0207649_10582031 3300025920 Bacteria 859
343 Ga0207649_10593421 3300025920 Bacteria 851
344 Ga0207652_10010249 3300025921 Bacteria 7543
345 Ga0207652_10020647 3300025921 Bacteria 5427
346 Ga0207652_10063107 3300025921 Bacteria 3203
347 Ga0207652_10314145 3300025921 Unclassified 1414
348 Ga0207652_10316543 3300025921 Bacteria 1409
349 Ga0207652_10321733 3300025921 Bacteria 1396
350 Ga0207652_10333269 3300025921 Bacteria 1370
351 Ga0207681_10717816 3300025923 Bacteria 832
352 Ga0207681_11797131 3300025923 Unclassified 511
353 Ga0207694_10104348 3300025924 Bacteria 2249
354 Ga0207694_10318769 3300025924 Bacteria 1283
355 Ga0207650_10002232 3300025925 Bacteria 13528
356 Ga0207650_10374887 3300025925 Bacteria 1174
357 Ga0207650_11471734 3300025925 Bacteria 579
358 Ga0207659_10005701 3300025926 Bacteria 7580
359 Ga0207659_10017807 3300025926 Bacteria 4647
360 Ga0207659_10181960 3300025926 Bacteria 1666
361 Ga0207659_10624629 3300025926 Bacteria 919
362 Ga0207687_10425343 3300025927 Bacteria 1097
363 Ga0207644_10333311 3300025931 Bacteria 1229
364 Ga0207690_10094585 3300025932 Bacteria 2120
365 Ga0207706_10091782 3300025933 Bacteria 2670
366 Ga0207706_10141402 3300025933 Bacteria 2117
367 Ga0207686_10079643 3300025934 Bacteria 2134
368 Ga0207686_10378199 3300025934 Bacteria 1073
369 Ga0207686_10473680 3300025934 Bacteria 967
370 Ga0207686_10556807 3300025934 Bacteria 897
371 Ga0207686_10799882 3300025934 Bacteria 756
372 Ga0207686_11179664 3300025934 Bacteria 626
373 Ga0207709_10407761 3300025935 Bacteria 1041
374 Ga0207670_10043069 3300025936 Bacteria 2979
375 Ga0207670_10086725 3300025936 Bacteria 2203
376 Ga0207670_10109331 3300025936 Bacteria 1989
377 Ga0207669_10135574 3300025937 Bacteria 1700
378 Ga0207704_10085135 3300025938 Bacteria 2057
379 Ga0207704_10094086 3300025938 Bacteria 1978
380 Ga0207704_10697792 3300025938 Bacteria 840
381 Ga0207704_11207977 3300025938 Bacteria 645
382 Ga0207691_10168942 3300025940 Bacteria 1916
383 Ga0207691_10438309 3300025940 Bacteria 1112
384 Ga0207691_10785357 3300025940 Bacteria 801
385 Ga0207691_11039575 3300025940 Unclassified 683
386 Ga0207691_11191170 3300025940 Bacteria 632
387 Ga0207711_10084797 3300025941 Bacteria 2774
388 Ga0207711_10086359 3300025941 Bacteria 2751
389 Ga0207711_10090672 3300025941 Bacteria 2687
390 Ga0207711_10403847 3300025941 Bacteria 1270
391 Ga0207711_11001379 3300025941 Bacteria 775
392 Ga0207689_10001224 3300025942 Bacteria 24670
393 Ga0207689_10038589 3300025942 Bacteria 3955
394 Ga0207689_11128317 3300025942 Bacteria 661
395 Ga0207661_10011105 3300025944 Bacteria 6510
396 Ga0207661_10148239 3300025944 Unclassified 2026
397 Ga0207661_10162694 3300025944 Bacteria 1937
398 Ga0207661_10183441 3300025944 Bacteria 1830
399 Ga0207661_10580333 3300025944 Bacteria 1028
400 Ga0207661_11151179 3300025944 Bacteria 714
401 Ga0207679_10003985 3300025945 Bacteria 9172
402 Ga0207679_10019893 3300025945 Bacteria 4522
403 Ga0207679_10023391 3300025945 Bacteria 4225
404 Ga0207679_10241310 3300025945 Unclassified 1531
405 Ga0207679_10286011 3300025945 Bacteria 1416
406 Ga0207679_10315835 3300025945 Bacteria 1351
407 Ga0207679_10442011 3300025945 Bacteria 1152
408 Ga0207679_10578223 3300025945 Bacteria 1010
409 Ga0207667_10687893 3300025949 Bacteria 1026
410 Ga0207712_10057052 3300025961 Bacteria 2753
411 Ga0207668_10811404 3300025972 Bacteria 829
412 Ga0207668_11000273 3300025972 Bacteria 747
413 Ga0207640_11125962 3300025981 Bacteria 695
414 Ga0207658_10061439 3300025986 Bacteria 2808
415 Ga0207658_10421764 3300025986 Bacteria 1177
416 Ga0207658_10475092 3300025986 Bacteria 1110
417 Ga0207658_11327189 3300025986 Bacteria 658
418 Ga0207658_12171896 3300025986 Bacteria 504
419 Ga0207677_10209732 3300026023 Bacteria 1555
420 Ga0207677_10863916 3300026023 Bacteria 814
421 Ga0207677_11189549 3300026023 Bacteria 697
422 Ga0207677_11395706 3300026023 Bacteria 645
423 Ga0207677_11928496 3300026023 Unclassified 549
424 Ga0207703_10256341 3300026035 Bacteria 1579
425 Ga0207703_10468496 3300026035 Bacteria 1179
426 Ga0207678_11817707 3300026067 Bacteria 533
427 Ga0207708_10077774 3300026075 Bacteria 2547
428 Ga0207708_10766770 3300026075 Bacteria 829
429 Ga0207702_10448078 3300026078 Bacteria 1252
430 Ga0207702_10587349 3300026078 Unclassified 1092
431 Ga0207641_10616640 3300026088 Bacteria 1063
432 Ga0207641_11079440 3300026088 Bacteria 801
433 Ga0207641_11454805 3300026088 Bacteria 687
434 Ga0207648_10028818 3300026089 Bacteria 4922
435 Ga0207648_10459543 3300026089 Bacteria 1160
436 Ga0207676_10003636 3300026095 Bacteria 10909
437 Ga0207676_10497953 3300026095 Bacteria 1157
438 Ga0207676_10906070 3300026095 Bacteria 865
439 Ga0207676_10969997 3300026095 Bacteria 836
440 Ga0207676_11773220 3300026095 Bacteria 616
441 Ga0207674_10000394 3300026116 Bacteria 56421
442 Ga0207674_10006676 3300026116 Bacteria 13554
443 Ga0207674_10130684 3300026116 Bacteria 2474
444 Ga0207674_10168694 3300026116 Bacteria 2142
445 Ga0207674_10305111 3300026116 Bacteria 1541
446 Ga0207674_10960990 3300026116 Unclassified 823
447 Ga0207674_11673789 3300026116 Bacteria 604
448 Ga0207675_100242376 3300026118 Bacteria 1742
449 Ga0207683_10061770 3300026121 Bacteria 3298
450 Ga0207683_10444693 3300026121 Bacteria 1195
451 Ga0207683_11345413 3300026121 Bacteria 661
452 Ga0207698_10837596 3300026142 Bacteria 924
453 Ga0207698_11312745 3300026142 Bacteria 738
454 Ga0207428_10132381 3300027907 Bacteria 1907
455 Ga0207428_11253714 3300027907 Bacteria 515
456 Ga0268266_10531015 3300028379 Bacteria 1126
457 Ga0268266_10533721 3300028379 Bacteria 1123
458 Ga0268265_10010077 3300028380 Bacteria 6380
459 Ga0268265_10206517 3300028380 Unclassified 1708
460 Ga0268265_11799124 3300028380 Unclassified 619
461 Ga0316182_1306717 3300030745 Bacteria 617
462 Ga0307408_101022114 3300031548 Bacteria 763
463 Ga0307405_10099939 3300031731 Bacteria 1943
464 Ga0307405_10716918 3300031731 Bacteria 830
465 Ga0307405_11260476 3300031731 Bacteria 642
466 Ga0307413_10538400 3300031824 Bacteria 945
467 Ga0307413_10970167 3300031824 Bacteria 726
468 Ga0307410_10419777 3300031852 Bacteria 1085
469 Ga0307410_11078754 3300031852 Bacteria 695
470 Ga0307410_11436386 3300031852 Bacteria 606
471 Ga0307410_11461286 3300031852 Unclassified 601
472 Ga0307407_10376002 3300031903 Bacteria 1013
473 Ga0307412_11073909 3300031911 Bacteria 715
474 Ga0307409_100347926 3300031995 Bacteria 1397
475 Ga0307409_100382375 3300031995 Unclassified 1339
476 Ga0307409_100545095 3300031995 Unclassified 1138
477 Ga0307416_100565957 3300032002 Bacteria 1212
478 Ga0307414_10540329 3300032004 Bacteria 1037
479 Ga0307414_10611656 3300032004 Bacteria 978
480 Ga0307411_11620321 3300032005 Bacteria 597
481 Ga0307415_100345439 3300032126 Bacteria 1250
482 Ga0307415_100989275 3300032126 Bacteria 781
483 Ga0373926_0006506 3300035083 Unclassified 3878
484 Ga0373944_0011683 3300035089 Bacteria 2409
485 Ga0373923_0245776 3300035111 Bacteria 837
486 Ga0373936_0078687 3300035113 Bacteria 1369
487 Ga0373945_0019274 3300035116 Bacteria 2328
488 Ga0373954_0093755 3300035118 Bacteria 1444
489 Ga0373956_0035157 3300035119 Bacteria 2209
490 Ga0373957_0123287 3300035120 Bacteria 1050
491 Ga0373960_0380476 3300035121 Unclassified 541
492 Ga0373943_0019920 3300035170 Bacteria 3090
493 Ga0373946_0054015 3300035171 Bacteria 1689
494 Ga0373955_0153702 3300035172 Bacteria 1355
495 Ga0373955_0774620 3300035172 Unclassified 589
496 Ga0373931_0056360 3300035691 Bacteria 2105
497 Ga0373931_0910652 3300035691 Bacteria 591
498 Ga0373935_0383147 3300035692 Bacteria 1007
499 Ga0373927_0037180 3300035695 Bacteria 3165
500 Ga0373933_0016869 3300035724 Bacteria 4092
501 Ga0373937_0003144 3300036401 Bacteria 13817
502 Ga0373937_0946075 3300036401 Bacteria 810
503 Ga0373925_0075295 3300037068 Bacteria 2557
504 Ga0395899_0883901 3300037312 Bacteria 546
505 Ga0395898_0855404 3300037466 Bacteria 849
506 Ga0395905_0014873 3300037471 Bacteria 7424
507 Ga0436364_1326811 3300037853 Unclassified 822
508 Ga0436364_1538124 3300037853 Bacteria 620
509 Ga0436365_0332039 3300039437 Bacteria 813
510 Ga0436365_0903494 3300039437 Bacteria 4671
511 Ga0436365_1658826 3300039437 Bacteria 2638
512 Ga0436365_1712124 3300039437 Bacteria 505
513 Ga0439439_0078607 3300041406 Bacteria 890
514 Ga0439433_0038658 3300041999 Bacteria 1107
515 Ga0466957_0627944 3300044842 Bacteria 754
516 Ga0451576_0265703 3300045051 Unclassified 1794
517 Ga0451576_0568451 3300045051 Bacteria 1191
518 Ga0466967_0202025 3300045976 Bacteria 1883
519 Ga0466967_1046235 3300045976 Bacteria 813
520 Ga0466967_1613402 3300045976 Unclassified 646
521 Ga0495629_0003877 3300046459 Bacteria 11273
522 Ga0495629_0026059 3300046459 Bacteria 4155
523 Ga0495638_0140170 3300046460 Bacteria 1412
524 Ga0495580_0129139 3300046472 Bacteria 1753
525 Ga0495582_0002255 3300046473 Bacteria 10786
526 Ga0495582_0006491 3300046473 Bacteria 6491
527 Ga0495639_0004673 3300046475 Bacteria 5881
528 Ga0495630_0001254 3300046517 Bacteria 17515
529 Ga0495652_0026933 3300046529 Bacteria 5071
530 Ga0495652_0196209 3300046529 Bacteria 1536
531 Ga0495665_0002999 3300046531 Bacteria 9120
532 Ga0495665_0148023 3300046531 Bacteria 1226
533 Ga0495587_0010185 3300046536 Bacteria 5994
534 Ga0495587_0146951 3300046536 Bacteria 1344
535 Ga0495598_0071128 3300046537 Unclassified 1096
536 Ga0495645_0023787 3300046543 Bacteria 4440
537 Ga0495667_0013948 3300046559 Bacteria 5426
538 Ga0495634_0601640 3300046642 Bacteria 638
539 Ga0495588_0140397 3300046674 Bacteria 1276
540 Ga0495588_0370394 3300046674 Bacteria 752
541 Ga0495599_0014419 3300046678 Bacteria 4894
542 Ga0495623_0014399 3300046679 Bacteria 5119
543 Ga0495658_0001632 3300046683 Bacteria 11659
544 Ga0495658_0935058 3300046683 Bacteria 554
545 Ga0495669_0197726 3300046684 Bacteria 960
546 Ga0495613_0009300 3300046689 Bacteria 7291
547 Ga0495670_0080203 3300046691 Bacteria 1662
548 Ga0495600_0090673 3300046809 Bacteria 1994
549 Ga0495581_0001399 3300047315 Bacteria 13344
550 Ga0495581_0497897 3300047315 Bacteria 708
551 Ga0495675_0047806 3300047444 Bacteria 2722
552 Ga0495684_0637605 3300047471 Bacteria 714
553 Ga0495593_0001390 3300047673 Bacteria 14168
554 Ga0495614_0000448 3300048089 Bacteria 16899
555 Ga0496104_0120976 3300048907 Bacteria 2514
556 Ga0496105_1127983 3300048908 Bacteria 581
557 Ga0496106_0491328 3300048909 Bacteria 986
558 Ga0496108_0031264 3300048911 Bacteria 4416
559 Ga0496108_0788912 3300048911 Bacteria 820
560 Ga0496109_1376888 3300048912 Bacteria 641
561 Ga0496111_0224052 3300048914 Unclassified 1397
562 Ga0496112_0002500 3300048915 Bacteria 14829
563 Ga0496112_0685557 3300048915 Bacteria 953
564 Ga0496113_0509129 3300048916 Bacteria 966
565 Ga0501297_056842 3300049520 Bacteria 589
566 Ga0501039_0218488 3300049575 Unclassified 1499
567 Ga0501040_0071152 3300049576 Unclassified 2401
568 Ga0501041_0065335 3300049577 Unclassified 2229
569 Ga0501042_0026256 3300049578 Bacteria 4094
570 Ga0501048_0068596 3300049582 Unclassified 2505
571 Ga0501071_0652538 3300049587 Bacteria 810
572 Ga0501072_1521465 3300049588 Unclassified 516
573 Ga0501073_1287659 3300049589 Unclassified 501
574 Ga0501075_0052923 3300049591 Unclassified 3053
575 Ga0501077_0436791 3300049593 Unclassified 838
576 Ga0501242_072049 3300049674 Bacteria 543
577 Ga0501259_130539 3300049688 Bacteria 606
578 Ga0501079_0039644 3300049741 Unclassified 3633
579 Ga0501079_0412289 3300049741 Bacteria 1060
580 Ga0501080_0790075 3300049742 Bacteria 833
581 Ga0501081_0030883 3300049743 Unclassified 3630
582 Ga0501081_0045593 3300049743 Bacteria 3011
583 Ga0501083_0551757 3300049744 Unclassified 750
584 Ga0501268_030357 3300049765 Bacteria 975
585 Ga0501269_037489 3300049766 Bacteria 638
586 Ga0501045_0041609 3300049824 Bacteria 3343
587 nmdc:mga06z11_105101_c1 3300050494 Unclassified 1555
588 nmdc:mga05p37_103157_c1 3300050507 Bacteria 3511
589 nmdc:mga05p37_181581_c1 3300050507 Bacteria 2559
590 nmdc:mga05p37_344200_c1 3300050507 Bacteria 1757
591 nmdc:mga09592_131205_c1 3300050508 Bacteria 2156
592 nmdc:mga09592_25009_c1 3300050508 Bacteria 4940
593 nmdc:mga0qj67_287285_c1 3300050509 Unclassified 1333
594 nmdc:mga0qj67_828125_c1 3300050509 Bacteria 732
595 nmdc:mga06r32_394734_c1 3300050510 Bacteria 1366
596 nmdc:mga08y16_55486_c1 3300050511 Bacteria 4139
597 nmdc:mga0n895_330717_c1 3300050512 Unclassified 1544
598 nmdc:mga0n895_557866_c1 3300050512 Bacteria 1151
599 Ga0495595_0642300 3300053084 Bacteria 543
600 Ga0500596_080974 3300053735 Bacteria 565
601 Ga0501084_0414800 3300054114 Bacteria 1138
602 Ga0501084_1427637 3300054114 Bacteria 580
603 Ga0590071_119630 3300059421 Bacteria 672
604 Ga0501082_0103629 3300060353 Unclassified 2461
605 Ga0530510_0083132 3300061734 Bacteria 2332
606 Ga0105247_11403825
607 Ga0065714_10334836
608 Ga0065712_10150657
609 Ga0070658_10507288
610 Ga0070676_10986139
611 Ga0070683_100000397
612 Ga0070683_100118677
613 Ga0070683_100128940
614 Ga0070683_100186309
615 Ga0070683_100491843
616 Ga0070683_100550580
617 Ga0070683_100784860
618 Ga0070690_100011574
619 Ga0070690_100022311
620 Ga0070690_100030192
621 Ga0070670_100008704
622 Ga0070670_100054671
623 Ga0070670_100443381
624 Ga0070670_101210081
625 Ga0070670_101229458
626 Ga0070677_10742518
627 Ga0068869_100012820
628 Ga0068869_100084552
629 Ga0068869_101885675
630 Ga0070666_10332604
631 Ga0070666_10563851
632 Ga0070666_10642669
633 Ga0070666_10695871
634 Ga0070680_100145278
635 Ga0070680_100182186
636 Ga0070680_100365025
637 Ga0070682_100002879
638 Ga0070682_100133844
639 Ga0070682_100192666
640 Ga0068868_100376293
641 Ga0068868_101251479
642 Ga0070660_100071410
643 Ga0070660_100105209
644 Ga0070689_100014037
645 Ga0070689_100043089
646 Ga0070689_100301854
647 Ga0070691_10939351
648 Ga0070687_100031001
649 Ga0070687_100258414
650 Ga0070661_100003510
651 Ga0070661_100032444
652 Ga0070661_101136032
653 Ga0070692_10146398
654 Ga0070692_10281849
655 Ga0070668_100196206
656 Ga0070668_101073635
657 Ga0070669_100345512
658 Ga0070669_100890319
659 Ga0070669_101982180
660 Ga0070675_100019195
661 Ga0070675_100156897
662 Ga0070675_100174951
663 Ga0070675_100282922
664 Ga0070675_100370794
665 Ga0070675_100457091
666 Ga0070675_100569405
667 Ga0070675_102094061
668 Ga0070671_100403031
669 Ga0070671_101436784
670 Ga0070674_101668657
671 Ga0070673_100045583
672 Ga0070673_100128225
673 Ga0070673_100361329
674 Ga0070673_100599368
675 Ga0070688_100156501
676 Ga0070688_100208587
677 Ga0070688_101334432
678 Ga0070659_100021345
679 Ga0070659_100032698
680 Ga0070659_100054972
681 Ga0070667_100052574
682 Ga0070667_100393735
683 Ga0070667_100517931
684 Ga0070667_101400693
685 Ga0070703_10289507
686 Ga0070714_102510790
687 Ga0070710_10827708
688 Ga0070701_10147152
689 Ga0070711_100742921
690 Ga0070700_100805666
691 Ga0070694_100672240
692 Ga0070663_102142797
693 Ga0070678_100357791
694 Ga0070678_101207024
695 Ga0070662_100039730
696 Ga0070662_100146976
697 Ga0070681_10005421
698 Ga0070681_10014161
699 Ga0070681_10023567
700 Ga0070681_10035575
701 Ga0070681_10053917
702 Ga0070681_10062326
703 Ga0070681_10124064
704 Ga0070681_10718209
705 Ga0068867_100872029
706 Ga0068867_100920778
707 Ga0068867_101365879
708 Ga0070685_10094419
709 Ga0070685_10113558
710 Ga0070685_10732072
711 Ga0070707_100600347
712 Ga0070698_100238685
713 Ga0070679_100027827
714 Ga0070679_100135487
715 Ga0070679_100196255
716 Ga0070679_100302910
717 Ga0070679_100608202
718 Ga0070679_100762621
719 Ga0070679_100956427
720 Ga0070684_100002124
721 Ga0070684_100009702
722 Ga0070684_100021443
723 Ga0070684_100069824
724 Ga0070684_100073445
725 Ga0070684_100163363
726 Ga0070672_100080941
727 Ga0070672_100123371
728 Ga0070672_100412728
729 Ga0070672_100757868
730 Ga0070672_100819076
731 Ga0070686_100373998
732 Ga0070686_100860422
733 Ga0070696_100000091
734 Ga0070693_100005288
735 Ga0070693_100054905
736 Ga0070693_100094296
737 Ga0070693_100189337
738 Ga0070665_100480897
739 Ga0070665_101783690
740 Ga0068855_102541746
741 Ga0070664_100040858
742 Ga0070664_100044326
743 Ga0070664_100084312
744 Ga0070664_100113459
745 Ga0070664_100117072
746 Ga0068857_100012441
747 Ga0068857_100050063
748 Ga0068857_100081828
749 Ga0068857_100284974
750 Ga0068857_100694042
751 Ga0068857_102528520
752 Ga0068854_102045710
753 Ga0068856_100098099
754 Ga0068856_100889628
755 Ga0070702_101056571
756 Ga0068852_100057164
757 Ga0068852_100896706
758 Ga0068852_102099570
759 Ga0068859_100012899
760 Ga0068859_100068612
761 Ga0068859_100544055
762 Ga0068859_101103483
763 Ga0068859_101209848
764 Ga0068864_100145945
765 Ga0068864_100274761
766 Ga0068864_100642562
767 Ga0068864_101923877
768 Ga0068864_102499530
769 Ga0068866_10169061
770 Ga0068861_100209594
771 Ga0068861_101418634
772 Ga0068861_102018286
773 Ga0068851_10027563
774 Ga0068851_10389920
775 Ga0068870_10023943
776 Ga0068870_10067451
777 Ga0068870_10095415
778 Ga0068870_10326050
779 Ga0068870_10390273
780 Ga0068870_10490680
781 Ga0068863_100085116
782 Ga0068863_100580198
783 Ga0068863_100839653
784 Ga0068858_100013502
785 Ga0068858_100142831
786 Ga0068858_101691433
787 Ga0068860_100161200
788 Ga0068860_101028858
789 Ga0068860_102052268
790 Ga0068862_100022773
791 Ga0068862_100055358
792 Ga0081455_10155791
793 Ga0075367_10017173
794 Ga0097621_100070749
795 Ga0097621_100715762
796 Ga0097621_100903686
797 Ga0068871_100027068
798 Ga0068871_100981580
799 Ga0075428_100022057
800 Ga0075428_100052361
801 Ga0075428_100200113
802 Ga0075428_102468747
803 Ga0075430_100376347
804 Ga0075431_100038235
805 Ga0075431_100105725
806 Ga0075433_10747488
807 Ga0075434_100013484
808 Ga0075434_100335165
809 Ga0075434_100499355
810 Ga0075434_100618975
811 Ga0075429_100004287
812 Ga0075429_100022694
813 Ga0075429_101597988
814 Ga0068865_100190954
815 Ga0068865_100434577
816 Ga0068865_100592729
817 Ga0068865_100598421
818 Ga0068865_100931579
819 Ga0097620_100012901
820 Ga0097620_100068610
821 Ga0097620_100544096
822 Ga0097620_101103529
823 Ga0097620_101127150
824 Ga0097620_101209893
825 Ga0075435_100812627
826 Ga0111539_10115559
827 Ga0111539_10392128
828 Ga0111539_10795929
829 Ga0111539_11345017
830 Ga0105245_10006625
831 Ga0105245_10175458
832 Ga0105245_10211751
833 Ga0105245_10294318
834 Ga0105245_10964767
835 Ga0105245_11904924
836 Ga0105247_10446550
837 Ga0105247_10715659
838 Ga0114129_10085612
839 Ga0114129_10310051
840 Ga0114129_11877327
841 Ga0114129_12294165
842 Ga0105243_10082332
843 Ga0105243_10584989
844 Ga0105243_11069245
845 Ga0105243_12484387
846 Ga0105241_10003972
847 Ga0105241_10609190
848 Ga0105242_10085925
849 Ga0105242_10243769
850 Ga0105242_10716290
851 Ga0105242_11369293
852 Ga0105242_11463834
853 Ga0105248_10197420
854 Ga0105248_10844042
855 Ga0105248_10900805
856 Ga0105248_11036632
857 Ga0105248_11552022
858 Ga0105248_12054343
859 Ga0105237_10213937
860 Ga0105237_10504184
861 Ga0105238_10155484
862 Ga0105238_10304346
863 Ga0105238_10477572
864 Ga0105249_10031359
865 Ga0105249_10131720
866 Ga0105249_10714102
867 Ga0105239_11704893
868 Ga0105246_10047589
869 Ga0105246_10293128
870 Ga0157371_10007749
871 Ga0157371_10047491
872 Ga0157369_10358966
873 Ga0157369_10760826
874 Ga0157369_12471710
875 Ga0157374_10721347
876 Ga0157374_10990862
877 Ga0157378_10391768
878 Ga0163162_10286087
879 Ga0163162_10767207
880 Ga0157372_10096471
881 Ga0157372_10439388
882 Ga0157372_10491108
883 Ga0157372_10847238
884 Ga0157372_10919230
885 Ga0157372_12599545
886 Ga0157375_10010663
887 Ga0157375_10064241
888 Ga0157375_10245359
889 Ga0157375_10266493
890 Ga0157375_10876025
891 Ga0157375_11214131
892 Ga0157375_12504930
893 Ga0163163_10005137
894 Ga0163163_10376362
895 Ga0163163_10685658
896 Ga0163163_11391365
897 Ga0163163_12939761
898 Ga0157380_10024401
899 Ga0157380_10081761
900 Ga0157377_10000839
901 Ga0157377_10402085
902 Ga0157377_10749997
903 Ga0157379_12042109
904 Ga0157376_10011794
905 Ga0157376_10828504
906 Ga0157376_10859051
907 Ga0163161_10083452
908 Ga0163161_10290839
909 Ga0213875_10461425
910 Ga0207656_10075212
911 Ga0207656_10247428
912 Ga0207682_10344654
913 Ga0207642_10732565
914 Ga0207710_10146760
915 Ga0207688_10387038
916 Ga0207680_10427392
917 Ga0207680_10497401
918 Ga0207699_10136911
919 Ga0207645_10145098
920 Ga0207645_10321884
921 Ga0207645_10462387
922 Ga0207643_10086015
923 Ga0207643_10292498
924 Ga0207643_10611106
925 Ga0207654_10199473
926 Ga0207707_10010391
927 Ga0207707_10043961
928 Ga0207707_10073652
929 Ga0207707_10147988
930 Ga0207707_10273185
931 Ga0207707_10367697
932 Ga0207707_10452911
933 Ga0207693_11183891
934 Ga0207663_10270529
935 Ga0207660_10023251
936 Ga0207660_10037631
937 Ga0207660_10711198
938 Ga0207662_10001842
939 Ga0207662_10027054
940 Ga0207662_10056810
941 Ga0207662_10960650
942 Ga0207657_10020891
943 Ga0207657_10073934
944 Ga0207657_10422436
945 Ga0207649_10009278
946 Ga0207649_10033247
947 Ga0207649_10582031
948 Ga0207649_10593421
949 Ga0207652_10010249
950 Ga0207652_10020647
951 Ga0207652_10063107
952 Ga0207652_10314145
953 Ga0207652_10316543
954 Ga0207652_10321733
955 Ga0207652_10333269
956 Ga0207681_10717816
957 Ga0207681_11797131
958 Ga0207694_10104348
959 Ga0207694_10318769
960 Ga0207650_10002232
961 Ga0207650_10374887
962 Ga0207650_11471734
963 Ga0207659_10005701
964 Ga0207659_10017807
965 Ga0207659_10181960
966 Ga0207659_10624629
967 Ga0207687_10425343
968 Ga0207644_10333311
969 Ga0207690_10094585
970 Ga0207706_10091782
971 Ga0207706_10141402
972 Ga0207686_10079643
973 Ga0207686_10378199
974 Ga0207686_10473680
975 Ga0207686_10556807
976 Ga0207686_10799882
977 Ga0207686_11179664
978 Ga0207709_10407761
979 Ga0207670_10043069
980 Ga0207670_10086725
981 Ga0207670_10109331
982 Ga0207669_10135574
983 Ga0207704_10085135
984 Ga0207704_10094086
985 Ga0207704_10697792
986 Ga0207704_11207977
987 Ga0207691_10168942
988 Ga0207691_10438309
989 Ga0207691_10785357
990 Ga0207691_11039575
991 Ga0207691_11191170
992 Ga0207711_10084797
993 Ga0207711_10086359
994 Ga0207711_10090672
995 Ga0207711_10403847
996 Ga0207711_11001379
997 Ga0207689_10001224
998 Ga0207689_10038589
999 Ga0207689_11128317
1000 Ga0207661_10011105
1001 Ga0207661_10148239
1002 Ga0207661_10162694
1003 Ga0207661_10183441
1004 Ga0207661_10580333
1005 Ga0207661_11151179
1006 Ga0207679_10003985
1007 Ga0207679_10019893
1008 Ga0207679_10023391
1009 Ga0207679_10241310
1010 Ga0207679_10286011
1011 Ga0207679_10315835
1012 Ga0207679_10442011
1013 Ga0207679_10578223
1014 Ga0207667_10687893
1015 Ga0207712_10057052
1016 Ga0207668_10811404
1017 Ga0207668_11000273
1018 Ga0207640_11125962
1019 Ga0207658_10061439
1020 Ga0207658_10421764
1021 Ga0207658_10475092
1022 Ga0207658_11327189
1023 Ga0207658_12171896
1024 Ga0207677_10209732
1025 Ga0207677_10863916
1026 Ga0207677_11189549
1027 Ga0207677_11395706
1028 Ga0207677_11928496
1029 Ga0207703_10256341
1030 Ga0207703_10468496
1031 Ga0207678_11817707
1032 Ga0207708_10077774
1033 Ga0207708_10766770
1034 Ga0207702_10448078
1035 Ga0207702_10587349
1036 Ga0207641_10616640
1037 Ga0207641_11079440
1038 Ga0207641_11454805
1039 Ga0207648_10028818
1040 Ga0207648_10459543
1041 Ga0207676_10003636
1042 Ga0207676_10497953
1043 Ga0207676_10906070
1044 Ga0207676_10969997
1045 Ga0207676_11773220
1046 Ga0207674_10000394
1047 Ga0207674_10006676
1048 Ga0207674_10130684
1049 Ga0207674_10168694
1050 Ga0207674_10305111
1051 Ga0207674_10960990
1052 Ga0207674_11673789
1053 Ga0207675_100242376
1054 Ga0207683_10061770
1055 Ga0207683_10444693
1056 Ga0207683_11345413
1057 Ga0207698_10837596
1058 Ga0207698_11312745
1059 Ga0207428_10132381
1060 Ga0207428_11253714
1061 Ga0268266_10531015
1062 Ga0268266_10533721
1063 Ga0268265_10010077
1064 Ga0268265_10206517
1065 Ga0268265_11799124
1066 Ga0316182_1306717
1067 Ga0307408_101022114
1068 Ga0307405_10099939
1069 Ga0307405_10716918
1070 Ga0307405_11260476
1071 Ga0307413_10538400
1072 Ga0307413_10970167
1073 Ga0307410_10419777
1074 Ga0307410_11078754
1075 Ga0307410_11436386
1076 Ga0307410_11461286
1077 Ga0307407_10376002
1078 Ga0307412_11073909
1079 Ga0307409_100347926
1080 Ga0307409_100382375
1081 Ga0307409_100545095
1082 Ga0307416_100565957
1083 Ga0307414_10540329
1084 Ga0307414_10611656
1085 Ga0307411_11620321
1086 Ga0307415_100345439
1087 Ga0307415_100989275
1088 Ga0373926_0006506
1089 Ga0373944_0011683
1090 Ga0373923_0245776
1091 Ga0373936_0078687
1092 Ga0373945_0019274
1093 Ga0373954_0093755
1094 Ga0373956_0035157
1095 Ga0373957_0123287
1096 Ga0373960_0380476
1097 Ga0373943_0019920
1098 Ga0373946_0054015
1099 Ga0373955_0153702
1100 Ga0373955_0774620
1101 Ga0373931_0056360
1102 Ga0373931_0910652
1103 Ga0373935_0383147
1104 Ga0373927_0037180
1105 Ga0373933_0016869
1106 Ga0373937_0003144
1107 Ga0373937_0946075
1108 Ga0373925_0075295
1109 Ga0395899_0883901
1110 Ga0395898_0855404
1111 Ga0395905_0014873
1112 Ga0436364_1326811
1113 Ga0436364_1538124
1114 Ga0436365_0332039
1115 Ga0436365_0903494
1116 Ga0436365_1658826
1117 Ga0436365_1712124
1118 Ga0439439_0078607
1119 Ga0439433_0038658
1120 Ga0466957_0627944
1121 Ga0451576_0265703
1122 Ga0451576_0568451
1123 Ga0466967_0202025
1124 Ga0466967_1046235
1125 Ga0466967_1613402
1126 Ga0495629_0003877
1127 Ga0495629_0026059
1128 Ga0495638_0140170
1129 Ga0495580_0129139
1130 Ga0495582_0002255
1131 Ga0495582_0006491
1132 Ga0495639_0004673
1133 Ga0495630_0001254
1134 Ga0495652_0026933
1135 Ga0495652_0196209
1136 Ga0495665_0002999
1137 Ga0495665_0148023
1138 Ga0495587_0010185
1139 Ga0495587_0146951
1140 Ga0495598_0071128
1141 Ga0495645_0023787
1142 Ga0495667_0013948
1143 Ga0495634_0601640
1144 Ga0495588_0140397
1145 Ga0495588_0370394
1146 Ga0495599_0014419
1147 Ga0495623_0014399
1148 Ga0495658_0001632
1149 Ga0495658_0935058
1150 Ga0495669_0197726
1151 Ga0495613_0009300
1152 Ga0495670_0080203
1153 Ga0495600_0090673
1154 Ga0495581_0001399
1155 Ga0495581_0497897
1156 Ga0495675_0047806
1157 Ga0495684_0637605
1158 Ga0495593_0001390
1159 Ga0495614_0000448
1160 Ga0496104_0120976
1161 Ga0496105_1127983
1162 Ga0496106_0491328
1163 Ga0496108_0031264
1164 Ga0496108_0788912
1165 Ga0496109_1376888
1166 Ga0496111_0224052
1167 Ga0496112_0002500
1168 Ga0496112_0685557
1169 Ga0496113_0509129
1170 Ga0501297_056842
1171 Ga0501039_0218488
1172 Ga0501040_0071152
1173 Ga0501041_0065335
1174 Ga0501042_0026256
1175 Ga0501048_0068596
1176 Ga0501071_0652538
1177 Ga0501072_1521465
1178 Ga0501073_1287659
1179 Ga0501075_0052923
1180 Ga0501077_0436791
1181 Ga0501242_072049
1182 Ga0501259_130539
1183 Ga0501079_0039644
1184 Ga0501079_0412289
1185 Ga0501080_0790075
1186 Ga0501081_0030883
1187 Ga0501081_0045593
1188 Ga0501083_0551757
1189 Ga0501268_030357
1190 Ga0501269_037489
1191 Ga0501045_0041609
1192 nmdc:mga06z11_105101_c1
1193 nmdc:mga05p37_103157_c1
1194 nmdc:mga05p37_181581_c1
1195 nmdc:mga05p37_344200_c1
1196 nmdc:mga09592_131205_c1
1197 nmdc:mga09592_25009_c1
1198 nmdc:mga0qj67_287285_c1
1199 nmdc:mga0qj67_828125_c1
1200 nmdc:mga06r32_394734_c1
1201 nmdc:mga08y16_55486_c1
1202 nmdc:mga0n895_330717_c1
1203 nmdc:mga0n895_557866_c1
1204 Ga0495595_0642300
1205 Ga0500596_080974
1206 Ga0501084_0414800
1207 Ga0501084_1427637
1208 Ga0590071_119630
1209 Ga0501082_0103629
1210 Ga0530510_0083132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

106

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9249 8 105
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9246 6 109
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9195 8 105
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9143 6 109
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9133 7 107
ID Description Score Start End Superfamily
af_Q9SU39_105_239_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9588 66 81 3.40.50.1000
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9195 8 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9194 11 109 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.894 9 109 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8935 14 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9ELH6-F1-model_v4 PadR family transcriptional regulator 0.9968 11 109
AF-A0A2V9Y9M6-F1-model_v4 PadR family transcriptional regulator 0.9964 12 108
AF-A0A7V0Y414-F1-model_v4 PadR family transcriptional regulator 0.9964 12 110
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9954 7 89
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.9953 11 109

Map