F468436

General Info

Members Datasets Scaffolds Average Seq Length
605 281 1211 250

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100002914|Ga0070670_1000029142
Length 299
Sequence VTAVDNYDALRFNRIRFASSIDLLSRLPGFRFPRNTGLPGKRPFLPHSMAGHSKWSKVKRIKGALDVKRGTLFSKFSKEISVAARIGGGDPAGNARLRSVIEMARAQSMPNDNIQRAIKRGTGEGVDAQQFEEIVYEGYGPGGVAVIVETTTDNKNRTAAEIRRIFTKNNGNLATSGSVSYMFHKKGQITVPRDTIEEERLFELALESGAEELTTEEEQYVILTSHDQLYAVAEALKQESVTIDGQKFTFIPDTTVQVVDEATALQVLRLCDSLDDDDDVQNVYSNLDIPEELLTKLPA

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
229 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 5.79
Rhizosphere 92.73
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100002914 3300005331 Bacteria 14167
2 JGI24736J21556_1001061 3300001904 Bacteria 5020
3 JGI24752J21851_1014843 3300001976 Bacteria 1015
4 JGI24746J21847_1002635 3300001977 Bacteria 2835
5 JGI24749J21850_1007788 3300002076 Bacteria 1492
6 JGI24744J21845_10004339 3300002077 Bacteria 2929
7 JGI24035J26624_1005467 3300002126 Bacteria 1217
8 rootH2_10022153 3300003320 Bacteria 4790
9 rootH1_10025939 3300003316 Bacteria 4484
10 rootH1_10025939 3300003323 Bacteria 6872
11 JGI25404J52841_10033996 3300003659 Bacteria 1086
12 Ga0065704_10011755 3300005289 Bacteria 2221
13 Ga0065712_10130068 3300005290 Bacteria 1560
14 Ga0065712_10168888 3300005290 Bacteria 1255
15 Ga0065715_10312442 3300005293 Bacteria 1018
16 Ga0070658_10000128 3300005327 Bacteria 67412
17 Ga0070658_10064314 3300005327 Bacteria 2992
18 Ga0070676_10000245 3300005328 Bacteria 23499
19 Ga0070676_10004420 3300005328 Bacteria 7394
20 Ga0070676_10005741 3300005328 Bacteria 6616
21 Ga0070676_10043663 3300005328 Bacteria 2606
22 Ga0070676_10064503 3300005328 Bacteria 2184
23 Ga0070683_100052548 3300005329 Bacteria 3775
24 Ga0070683_100829206 3300005329 Bacteria 887
25 Ga0070690_100000066 3300005330 Bacteria 52671
26 Ga0070670_100000228 3300005331 Bacteria 51572
27 Ga0070670_100001729 3300005331 Bacteria 17790
28 Ga0070670_100411814 3300005331 Bacteria 1194
29 Ga0070677_10000139 3300005333 Bacteria 24395
30 Ga0068869_100000265 3300005334 Bacteria 27453
31 Ga0068869_100050895 3300005334 Bacteria 3004
32 Ga0070666_10000240 3300005335 Bacteria 37284
33 Ga0070666_10000289 3300005335 Bacteria 33109
34 Ga0070666_10011630 3300005335 Bacteria 5530
35 Ga0070666_10021704 3300005335 Bacteria 4161
36 Ga0070666_10026120 3300005335 Bacteria 3812
37 Ga0070680_100140878 3300005336 Bacteria 2022
38 Ga0068868_100058561 3300005338 Bacteria 3045
39 Ga0068868_100063448 3300005338 Unclassified 2930
40 Ga0068868_100205849 3300005338 Bacteria 1642
41 Ga0070660_100001560 3300005339 Bacteria 15751
42 Ga0070660_100313769 3300005339 Bacteria 1287
43 Ga0070689_100000552 3300005340 Bacteria 22395
44 Ga0070689_100054309 3300005340 Bacteria 3101
45 Ga0070689_100267398 3300005340 Bacteria 1415
46 Ga0070689_100288550 3300005340 Bacteria 1363
47 Ga0070687_100000036 3300005343 Bacteria 42699
48 Ga0070687_100075714 3300005343 Unclassified 1820
49 Ga0070661_100000180 3300005344 Bacteria 52260
50 Ga0070661_100001405 3300005344 Bacteria 16821
51 Ga0070692_10015473 3300005345 Bacteria 3609
52 Ga0070668_100000083 3300005347 Bacteria 59166
53 Ga0070668_100005517 3300005347 Bacteria 9381
54 Ga0070668_100011063 3300005347 Bacteria 6716
55 Ga0070668_100073859 3300005347 Bacteria 2659
56 Ga0070668_100102140 3300005347 Unclassified 2273
57 Ga0070668_100119711 3300005347 Bacteria 2103
58 Ga0070669_100000371 3300005353 Bacteria 34751
59 Ga0070669_100028020 3300005353 Bacteria 4055
60 Ga0070669_100053912 3300005353 Bacteria 2944
61 Ga0070669_100086017 3300005353 Bacteria 2348
62 Ga0070669_100197232 3300005353 Bacteria 1582
63 Ga0070675_100000191 3300005354 Bacteria 38464
64 Ga0070675_100004919 3300005354 Bacteria 10188
65 Ga0070675_100012759 3300005354 Bacteria 6591
66 Ga0070675_100015433 3300005354 Bacteria 6039
67 Ga0070675_100090983 3300005354 Bacteria 2555
68 Ga0070671_100000141 3300005355 Bacteria 46712
69 Ga0070671_100004950 3300005355 Bacteria 10599
70 Ga0070671_100005350 3300005355 Bacteria 10234
71 Ga0070671_100011676 3300005355 Bacteria 7065
72 Ga0070671_100015632 3300005355 Bacteria 6133
73 Ga0070671_100043643 3300005355 Bacteria 3726
74 Ga0070671_100152599 3300005355 Bacteria 1951
75 Ga0070671_100494542 3300005355 Bacteria 1052
76 Ga0070674_100000390 3300005356 Bacteria 22013
77 Ga0070674_100013391 3300005356 Bacteria 5069
78 Ga0070674_100048710 3300005356 Bacteria 2909
79 Ga0070674_100221369 3300005356 Bacteria 1472
80 Ga0070673_100000056 3300005364 Bacteria 46040
81 Ga0070673_100005761 3300005364 Bacteria 7972
82 Ga0070673_100017986 3300005364 Bacteria 5040
83 Ga0070673_100111971 3300005364 Bacteria 2265
84 Ga0070688_100000021 3300005365 Bacteria 71317
85 Ga0070688_100004134 3300005365 Bacteria 7530
86 Ga0070659_100003801 3300005366 Bacteria 10774
87 Ga0070659_100020745 3300005366 Bacteria 4996
88 Ga0070659_100280351 3300005366 Bacteria 1386
89 Ga0070659_100328210 3300005366 Bacteria 1280
90 Ga0070667_100000824 3300005367 Bacteria 28849
91 Ga0070667_100007668 3300005367 Bacteria 8950
92 Ga0070667_100011318 3300005367 Bacteria 7378
93 Ga0070667_100047598 3300005367 Bacteria 3608
94 Ga0070667_100517786 3300005367 Bacteria 1094
95 Ga0070703_10002956 3300005406 Bacteria 4855
96 Ga0070703_10006086 3300005406 Bacteria 3377
97 Ga0070714_100073392 3300005435 Bacteria 2965
98 Ga0070713_100065139 3300005436 Bacteria 3060
99 Ga0070710_10058676 3300005437 Bacteria 2183
100 Ga0070711_100022385 3300005439 Bacteria 4096
101 Ga0070705_100000674 3300005440 Bacteria 19551
102 Ga0070705_100030592 3300005440 Bacteria 2974
103 Ga0070705_100203106 3300005440 Unclassified 1360
104 Ga0070700_100002048 3300005441 Bacteria 10241
105 Ga0070708_100003072 3300005445 Bacteria 12975
106 Ga0070708_100009361 3300005445 Bacteria 7896
107 Ga0070708_100027237 3300005445 Bacteria 4902
108 Ga0070708_100121546 3300005445 Bacteria 2409
109 Ga0070708_100168865 3300005445 Bacteria 2041
110 Ga0070708_100474532 3300005445 Bacteria 1180
111 Ga0070708_100855186 3300005445 Unclassified 854
112 Ga0070678_100002065 3300005456 Bacteria 10887
113 Ga0070678_100065075 3300005456 Bacteria 2705
114 Ga0070678_100227341 3300005456 Bacteria 1554
115 Ga0070678_100319587 3300005456 Bacteria 1325
116 Ga0070662_100001048 3300005457 Bacteria 16898
117 Ga0070662_100003495 3300005457 Bacteria 9800
118 Ga0070662_100074318 3300005457 Bacteria 2514
119 Ga0068867_100000015 3300005459 Bacteria 108965
120 Ga0068867_100000140 3300005459 Bacteria 46602
121 Ga0068867_100004727 3300005459 Bacteria 9583
122 Ga0070685_10000033 3300005466 Bacteria 82828
123 Ga0070706_100000049 3300005467 Bacteria 141287
124 Ga0070706_100018905 3300005467 Bacteria 6355
125 Ga0070706_100047108 3300005467 Bacteria 3978
126 Ga0070706_100054887 3300005467 Bacteria 3677
127 Ga0070706_100077075 3300005467 Bacteria 3085
128 Ga0070706_100162353 3300005467 Bacteria 2086
129 Ga0070707_100009296 3300005468 Bacteria 9123
130 Ga0070707_100010575 3300005468 Bacteria 8593
131 Ga0070707_100020991 3300005468 Bacteria 6167
132 Ga0070707_100024846 3300005468 Bacteria 5679
133 Ga0070707_100032908 3300005468 Bacteria 4940
134 Ga0070707_100171483 3300005468 Bacteria 2114
135 Ga0070707_100366001 3300005468 Unclassified 1401
136 Ga0070698_100005083 3300005471 Bacteria 14401
137 Ga0070698_100236101 3300005471 Bacteria 1761
138 Ga0070699_100053721 3300005518 Bacteria 3486
139 Ga0070699_100116182 3300005518 Bacteria 2351
140 Ga0070699_100136358 3300005518 Bacteria 2165
141 Ga0070699_100140812 3300005518 Bacteria 2130
142 Ga0070699_100346366 3300005518 Bacteria 1338
143 Ga0070679_100037041 3300005530 Bacteria 4843
144 Ga0070679_100481598 3300005530 Bacteria 1185
145 Ga0070679_100561899 3300005530 Bacteria 1085
146 Ga0070684_100003583 3300005535 Bacteria 11682
147 Ga0070697_100013743 3300005536 Bacteria 6351
148 Ga0070697_100022777 3300005536 Bacteria 4978
149 Ga0070697_100029711 3300005536 Bacteria 4384
150 Ga0070697_100054352 3300005536 Bacteria 3255
151 Ga0070697_100067686 3300005536 Bacteria 2922
152 Ga0070697_100763862 3300005536 Unclassified 854
153 Ga0068853_100000297 3300005539 Bacteria 34839
154 Ga0070672_100000085 3300005543 Bacteria 44782
155 Ga0070672_100004670 3300005543 Bacteria 8982
156 Ga0070672_100025998 3300005543 Bacteria 4349
157 Ga0070672_100043282 3300005543 Bacteria 3471
158 Ga0070672_100206155 3300005543 Bacteria 1645
159 Ga0070686_100000271 3300005544 Bacteria 35400
160 Ga0070695_100000781 3300005545 Bacteria 17107
161 Ga0070695_100039913 3300005545 Bacteria 2969
162 Ga0070696_100018796 3300005546 Bacteria 4677
163 Ga0070696_100038215 3300005546 Bacteria 3313
164 Ga0070693_100004853 3300005547 Bacteria 6417
165 Ga0070665_100007343 3300005548 Bacteria 11209
166 Ga0070665_100064838 3300005548 Bacteria 3664
167 Ga0070665_100077287 3300005548 Bacteria 3335
168 Ga0070665_100211830 3300005548 Bacteria 1938
169 Ga0070704_100020844 3300005549 Bacteria 4237
170 Ga0070704_100052287 3300005549 Bacteria 2881
171 Ga0070704_100543472 3300005549 Bacteria 1014
172 Ga0068855_100000438 3300005563 Bacteria 51444
173 Ga0070664_100004883 3300005564 Bacteria 10741
174 Ga0070664_100009219 3300005564 Bacteria 8012
175 Ga0070664_100060778 3300005564 Bacteria 3219
176 Ga0068857_100000076 3300005577 Bacteria 56999
177 Ga0068857_100015258 3300005577 Bacteria 6706
178 Ga0068857_100454329 3300005577 Bacteria 1198
179 Ga0068854_100000120 3300005578 Bacteria 54150
180 Ga0068856_100005499 3300005614 Bacteria 12479
181 Ga0068856_100099822 3300005614 Bacteria 2894
182 Ga0070702_100025622 3300005615 Bacteria 3162
183 Ga0068852_100000100 3300005616 Bacteria 58017
184 Ga0068852_100020384 3300005616 Bacteria 5273
185 Ga0068859_100000653 3300005617 Bacteria 34751
186 Ga0068864_100000296 3300005618 Bacteria 44143
187 Ga0068866_10000044 3300005718 Bacteria 48553
188 Ga0068861_100000006 3300005719 Bacteria 87995
189 Ga0068861_100217397 3300005719 Bacteria 1613
190 Ga0068851_10000073 3300005834 Bacteria 57135
191 Ga0068870_10001687 3300005840 Bacteria 9018
192 Ga0068863_100001171 3300005841 Bacteria 26176
193 Ga0068863_100158177 3300005841 Bacteria 2170
194 Ga0068863_100457000 3300005841 Bacteria 1254
195 Ga0068858_100001562 3300005842 Bacteria 23469
196 Ga0068858_100079263 3300005842 Bacteria 3052
197 Ga0068860_100000998 3300005843 Bacteria 31349
198 Ga0068860_100007845 3300005843 Bacteria 10654
199 Ga0068860_100009491 3300005843 Bacteria 9662
200 Ga0068860_100101367 3300005843 Bacteria 2747
201 Ga0068860_100210295 3300005843 Bacteria 1887
202 Ga0068860_100223973 3300005843 Bacteria 1827
203 Ga0068860_100243609 3300005843 Bacteria 1749
204 Ga0068860_100267426 3300005843 Bacteria 1668
205 Ga0068862_100003041 3300005844 Bacteria 14608
206 Ga0068862_100112887 3300005844 Unclassified 2387
207 Ga0068862_100608675 3300005844 Bacteria 1050
208 Ga0081455_10086136 3300005937 Unclassified 2559
209 Ga0081540_1000013 3300005983 Bacteria 186009
210 Ga0081540_1000135 3300005983 Bacteria 79068
211 Ga0081540_1000203 3300005983 Bacteria 62232
212 Ga0081540_1031586 3300005983 Bacteria 2908
213 Ga0070717_10226840 3300006028 Bacteria 1644
214 Ga0070715_10020912 3300006163 Bacteria 2530
215 Ga0070716_100017659 3300006173 Bacteria 3703
216 Ga0070712_100003966 3300006175 Bacteria 9102
217 Ga0070712_100032092 3300006175 Bacteria 3544
218 Ga0070712_100196954 3300006175 Bacteria 1580
219 Ga0070712_100300546 3300006175 Bacteria 1299
220 Ga0097621_100001139 3300006237 Bacteria 18438
221 Ga0097621_100008354 3300006237 Bacteria 7452
222 Ga0097621_100017948 3300006237 Bacteria 5390
223 Ga0097621_100140473 3300006237 Unclassified 2063
224 Ga0068871_100007380 3300006358 Bacteria 7847
225 Ga0068871_100053555 3300006358 Unclassified 3271
226 Ga0068871_100156680 3300006358 Bacteria 1945
227 Ga0075428_100159216 3300006844 Bacteria 2451
228 Ga0075430_100277137 3300006846 Bacteria 1388
229 Ga0075431_100034212 3300006847 Bacteria 5235
230 Ga0075433_10128184 3300006852 Bacteria 2254
231 Ga0075434_100202460 3300006871 Bacteria 2005
232 Ga0068865_100000053 3300006881 Bacteria 63121
233 Ga0068865_100023693 3300006881 Bacteria 4023
234 Ga0068865_100133705 3300006881 Bacteria 1861
235 Ga0075436_100029492 3300006914 Bacteria 3773
236 Ga0075436_100047103 3300006914 Bacteria 2973
237 Ga0075436_100080318 3300006914 Bacteria 2259
238 Ga0075436_100083947 3300006914 Bacteria 2211
239 Ga0075436_100205101 3300006914 Bacteria 1397
240 Ga0097620_100000653 3300006931 Bacteria 34751
241 Ga0075435_100129499 3300007076 Bacteria 2111
242 Ga0075435_100220771 3300007076 Bacteria 1609
243 Ga0075435_100432673 3300007076 Bacteria 1134
244 Ga0099794_10017089 3300007265 Bacteria 3229
245 Ga0105240_10018509 3300009093 Bacteria 9350
246 Ga0105240_10107233 3300009093 Bacteria 3387
247 Ga0111539_10185686 3300009094 Bacteria 2428
248 Ga0111539_10228611 3300009094 Bacteria 2166
249 Ga0105245_10000401 3300009098 Bacteria 40176
250 Ga0105245_10013103 3300009098 Bacteria 7224
251 Ga0105245_10064207 3300009098 Bacteria 3318
252 Ga0105245_10080763 3300009098 Bacteria 2971
253 Ga0105245_10155328 3300009098 Unclassified 2167
254 Ga0105245_10228630 3300009098 Bacteria 1798
255 Ga0105245_11062526 3300009098 Bacteria 855
256 Ga0105247_10004420 3300009101 Bacteria 8972
257 Ga0105247_10252684 3300009101 Unclassified 1206
258 Ga0114129_10251898 3300009147 Bacteria 2370
259 Ga0114129_10564555 3300009147 Bacteria 1478
260 Ga0105243_10000014 3300009148 Bacteria 264650
261 Ga0105241_10000689 3300009174 Bacteria 25455
262 Ga0105242_10010135 3300009176 Bacteria 7219
263 Ga0105242_10055075 3300009176 Bacteria 3254
264 Ga0105248_10000322 3300009177 Bacteria 56617
265 Ga0105237_10000280 3300009545 Bacteria 71017
266 Ga0105237_10431210 3300009545 Unclassified 1324
267 Ga0105238_10000506 3300009551 Bacteria 41061
268 Ga0105249_10000197 3300009553 Bacteria 69045
269 Ga0105249_10001542 3300009553 Bacteria 20224
270 Ga0099796_10037676 3300010159 Unclassified 1618
271 Ga0105239_10000349 3300010375 Bacteria 67704
272 Ga0105239_10024798 3300010375 Bacteria 6606
273 Ga0105246_10149022 3300011119 Bacteria 1769
274 Ga0157373_10000432 3300013100 Bacteria 33295
275 Ga0157371_10000236 3300013102 Bacteria 79052
276 Ga0157369_10000132 3300013105 Bacteria 107100
277 Ga0157374_10000617 3300013296 Bacteria 31416
278 Ga0157374_10018528 3300013296 Bacteria 6145
279 Ga0157374_10026346 3300013296 Bacteria 5231
280 Ga0157374_10035067 3300013296 Bacteria 4588
281 Ga0157374_10093539 3300013296 Bacteria 2870
282 Ga0157378_10001088 3300013297 Bacteria 24821
283 Ga0157378_10005615 3300013297 Bacteria 10989
284 Ga0157378_10060747 3300013297 Bacteria 3372
285 Ga0157378_10103446 3300013297 Bacteria 2602
286 Ga0163162_10000129 3300013306 Bacteria 68197
287 Ga0163162_10015503 3300013306 Bacteria 7448
288 Ga0163162_10056453 3300013306 Unclassified 3955
289 Ga0163162_10127169 3300013306 Bacteria 2655
290 Ga0157372_10002052 3300013307 Bacteria 21904
291 Ga0157375_10000264 3300013308 Bacteria 47642
292 Ga0157375_10004339 3300013308 Bacteria 12313
293 Ga0157375_10005881 3300013308 Bacteria 10684
294 Ga0157375_10024965 3300013308 Bacteria 5542
295 Ga0182008_10114094 3300014497 Bacteria 1340
296 Ga0157377_10008556 3300014745 Bacteria 4994
297 Ga0157377_10018112 3300014745 Bacteria 3656
298 Ga0157379_10000064 3300014968 Bacteria 67607
299 Ga0157376_10003477 3300014969 Bacteria 10857
300 Ga0157376_10008164 3300014969 Bacteria 7532
301 Ga0157376_10128282 3300014969 Bacteria 2259
302 Ga0157376_10170292 3300014969 Bacteria 1982
303 Ga0163161_10009483 3300017792 Bacteria 6737
304 Ga0163161_10035997 3300017792 Bacteria 3544
305 Ga0163161_10090930 3300017792 Bacteria 2258
306 Ga0213874_10050084 3300021377 Bacteria 1279
307 Ga0213876_10061452 3300021384 Bacteria 1982
308 Ga0224572_1006755 3300024225 Bacteria 2082
309 Ga0207666_1008638 3300025271 Bacteria 1364
310 Ga0207697_10000012 3300025315 Bacteria 62443
311 Ga0207697_10000475 3300025315 Bacteria 22686
312 Ga0207697_10009116 3300025315 Bacteria 4300
313 Ga0207697_10009414 3300025315 Bacteria 4222
314 Ga0207697_10017443 3300025315 Bacteria 2951
315 Ga0207656_10001393 3300025321 Bacteria 7985
316 Ga0207653_10007661 3300025885 Bacteria 3369
317 Ga0207653_10014908 3300025885 Bacteria 2440
318 Ga0207682_10000197 3300025893 Bacteria 27367
319 Ga0207682_10042454 3300025893 Bacteria 1858
320 Ga0207642_10000072 3300025899 Bacteria 27926
321 Ga0207710_10002040 3300025900 Bacteria 9595
322 Ga0207688_10003368 3300025901 Bacteria 8725
323 Ga0207688_10042237 3300025901 Bacteria 2538
324 Ga0207688_10045381 3300025901 Bacteria 2452
325 Ga0207688_10106164 3300025901 Bacteria 1626
326 Ga0207680_10000095 3300025903 Bacteria 41261
327 Ga0207680_10004325 3300025903 Bacteria 6730
328 Ga0207680_10009297 3300025903 Bacteria 4870
329 Ga0207680_10018338 3300025903 Bacteria 3718
330 Ga0207647_10000004 3300025904 Bacteria 307217
331 Ga0207647_10011391 3300025904 Bacteria 6237
332 Ga0207699_10106666 3300025906 Unclassified 1788
333 Ga0207645_10000068 3300025907 Bacteria 75234
334 Ga0207645_10000363 3300025907 Bacteria 37541
335 Ga0207645_10009833 3300025907 Bacteria 6593
336 Ga0207645_10035410 3300025907 Bacteria 3205
337 Ga0207645_10048334 3300025907 Bacteria 2716
338 Ga0207645_10072780 3300025907 Bacteria 2200
339 Ga0207643_10000029 3300025908 Bacteria 97842
340 Ga0207705_10044488 3300025909 Bacteria 3191
341 Ga0207705_10297954 3300025909 Bacteria 1236
342 Ga0207684_10000011 3300025910 Bacteria 502991
343 Ga0207684_10000740 3300025910 Bacteria 38281
344 Ga0207684_10005068 3300025910 Bacteria 12279
345 Ga0207684_10017396 3300025910 Bacteria 6168
346 Ga0207684_10040472 3300025910 Unclassified 3950
347 Ga0207684_10062238 3300025910 Bacteria 3169
348 Ga0207684_10140656 3300025910 Bacteria 2074
349 Ga0207684_10146491 3300025910 Bacteria 2031
350 Ga0207684_10588078 3300025910 Bacteria 951
351 Ga0207654_10001066 3300025911 Bacteria 14918
352 Ga0207695_10043568 3300025913 Bacteria 4782
353 Ga0207671_10000775 3300025914 Bacteria 40518
354 Ga0207671_10288667 3300025914 Bacteria 1295
355 Ga0207693_10005451 3300025915 Bacteria 10610
356 Ga0207693_10011372 3300025915 Bacteria 7207
357 Ga0207693_10014184 3300025915 Bacteria 6415
358 Ga0207663_10061557 3300025916 Bacteria 2382
359 Ga0207663_10280943 3300025916 Bacteria 1236
360 Ga0207660_10522782 3300025917 Bacteria 964
361 Ga0207662_10000016 3300025918 Bacteria 78145
362 Ga0207662_10000175 3300025918 Bacteria 30539
363 Ga0207662_10106081 3300025918 Unclassified 1747
364 Ga0207657_10000134 3300025919 Bacteria 75248
365 Ga0207649_10000459 3300025920 Bacteria 29320
366 Ga0207649_10010679 3300025920 Bacteria 5048
367 Ga0207652_10109793 3300025921 Bacteria 2446
368 Ga0207646_10002202 3300025922 Bacteria 23220
369 Ga0207646_10003084 3300025922 Bacteria 19160
370 Ga0207646_10030909 3300025922 Bacteria 4851
371 Ga0207646_10038684 3300025922 Bacteria 4295
372 Ga0207646_10082473 3300025922 Unclassified 2875
373 Ga0207646_10093577 3300025922 Bacteria 2691
374 Ga0207646_10120433 3300025922 Bacteria 2358
375 Ga0207646_10126286 3300025922 Bacteria 2300
376 Ga0207681_10000072 3300025923 Bacteria 90778
377 Ga0207681_10004440 3300025923 Bacteria 8635
378 Ga0207681_10018334 3300025923 Bacteria 4410
379 Ga0207681_10147116 3300025923 Unclassified 1761
380 Ga0207681_10397498 3300025923 Bacteria 1112
381 Ga0207694_10002261 3300025924 Bacteria 15766
382 Ga0207650_10000127 3300025925 Bacteria 95301
383 Ga0207650_10047593 3300025925 Bacteria 3160
384 Ga0207650_10275549 3300025925 Bacteria 1368
385 Ga0207650_10489605 3300025925 Bacteria 1027
386 Ga0207659_10000185 3300025926 Bacteria 37143
387 Ga0207659_10039802 3300025926 Bacteria 3282
388 Ga0207659_10424818 3300025926 Bacteria 1115
389 Ga0207687_10000203 3300025927 Bacteria 40245
390 Ga0207687_10027435 3300025927 Bacteria 3820
391 Ga0207687_10054195 3300025927 Bacteria 2804
392 Ga0207700_10352480 3300025928 Bacteria 1282
393 Ga0207664_10050837 3300025929 Bacteria 3270
394 Ga0207644_10000081 3300025931 Bacteria 70214
395 Ga0207644_10006795 3300025931 Bacteria 7455
396 Ga0207644_10099113 3300025931 Bacteria 2186
397 Ga0207690_10000181 3300025932 Bacteria 48663
398 Ga0207690_10279025 3300025932 Bacteria 1301
399 Ga0207706_10000084 3300025933 Bacteria 97762
400 Ga0207706_10000319 3300025933 Bacteria 52048
401 Ga0207686_10006007 3300025934 Bacteria 6519
402 Ga0207709_10000046 3300025935 Bacteria 240294
403 Ga0207709_10159079 3300025935 Unclassified 1573
404 Ga0207670_10000274 3300025936 Bacteria 32092
405 Ga0207670_10078055 3300025936 Bacteria 2308
406 Ga0207670_10346511 3300025936 Bacteria 1175
407 Ga0207669_10000134 3300025937 Bacteria 35234
408 Ga0207669_10011701 3300025937 Bacteria 4282
409 Ga0207669_10178882 3300025937 Bacteria 1518
410 Ga0207669_10192485 3300025937 Bacteria 1472
411 Ga0207704_10000111 3300025938 Bacteria 45108
412 Ga0207704_10050182 3300025938 Unclassified 2515
413 Ga0207704_10358171 3300025938 Bacteria 1138
414 Ga0207665_10008854 3300025939 Bacteria 6608
415 Ga0207691_10000203 3300025940 Bacteria 57250
416 Ga0207691_10001923 3300025940 Bacteria 20269
417 Ga0207691_10011875 3300025940 Bacteria 8357
418 Ga0207691_10033548 3300025940 Bacteria 4779
419 Ga0207691_10151723 3300025940 Bacteria 2037
420 Ga0207711_10000179 3300025941 Bacteria 68351
421 Ga0207689_10000111 3300025942 Bacteria 67341
422 Ga0207689_10060223 3300025942 Bacteria 3122
423 Ga0207661_10021274 3300025944 Bacteria 4859
424 Ga0207661_10034009 3300025944 Bacteria 3960
425 Ga0207679_10000062 3300025945 Bacteria 98526
426 Ga0207679_10000455 3300025945 Bacteria 28851
427 Ga0207679_10019151 3300025945 Bacteria 4595
428 Ga0207679_10246245 3300025945 Bacteria 1517
429 Ga0207667_10015376 3300025949 Bacteria 8698
430 Ga0207651_10000019 3300025960 Bacteria 90776
431 Ga0207651_10006055 3300025960 Bacteria 6282
432 Ga0207651_10016890 3300025960 Bacteria 4293
433 Ga0207651_10061257 3300025960 Unclassified 2617
434 Ga0207651_10096607 3300025960 Bacteria 2179
435 Ga0207651_10477993 3300025960 Bacteria 1073
436 Ga0207712_10000160 3300025961 Bacteria 69507
437 Ga0207712_10061961 3300025961 Unclassified 2657
438 Ga0207668_10000590 3300025972 Bacteria 22549
439 Ga0207668_10004551 3300025972 Bacteria 8156
440 Ga0207668_10147820 3300025972 Bacteria 1815
441 Ga0207640_10000265 3300025981 Bacteria 35233
442 Ga0207658_10000503 3300025986 Bacteria 35822
443 Ga0207658_10028310 3300025986 Bacteria 3945
444 Ga0207658_10068583 3300025986 Bacteria 2676
445 Ga0207658_10103212 3300025986 Bacteria 2238
446 Ga0207658_10475540 3300025986 Bacteria 1109
447 Ga0207658_10566775 3300025986 Bacteria 1017
448 Ga0207677_10000026 3300026023 Bacteria 126495
449 Ga0207677_10032840 3300026023 Bacteria 3341
450 Ga0207677_10071134 3300026023 Bacteria 2454
451 Ga0207677_10124936 3300026023 Bacteria 1943
452 Ga0207677_10319941 3300026023 Bacteria 1289
453 Ga0207703_10000298 3300026035 Bacteria 54614
454 Ga0207703_10086631 3300026035 Bacteria 2624
455 Ga0207639_10000921 3300026041 Bacteria 19921
456 Ga0207708_10025528 3300026075 Bacteria 4471
457 Ga0207702_10001140 3300026078 Bacteria 27155
458 Ga0207641_10001019 3300026088 Bacteria 28480
459 Ga0207641_10246508 3300026088 Bacteria 1667
460 Ga0207648_10000033 3300026089 Bacteria 126264
461 Ga0207648_10000249 3300026089 Bacteria 58227
462 Ga0207648_10037976 3300026089 Bacteria 4239
463 Ga0207648_10183204 3300026089 Bacteria 1854
464 Ga0207648_10327766 3300026089 Bacteria 1377
465 Ga0207676_10000106 3300026095 Bacteria 74628
466 Ga0207674_10001123 3300026116 Bacteria 34695
467 Ga0207674_10008450 3300026116 Bacteria 11890
468 Ga0207674_10030104 3300026116 Bacteria 5710
469 Ga0207675_100000112 3300026118 Bacteria 65958
470 Ga0207683_10000269 3300026121 Bacteria 46409
471 Ga0207683_10008354 3300026121 Bacteria 8854
472 Ga0207698_10000420 3300026142 Bacteria 24424
473 Ga0207698_10011568 3300026142 Bacteria 5728
474 Ga0209974_10009910 3300027876 Bacteria 3223
475 Ga0268266_10000308 3300028379 Bacteria 77542
476 Ga0268266_10008448 3300028379 Bacteria 9155
477 Ga0268266_10044225 3300028379 Bacteria 3807
478 Ga0268266_10069216 3300028379 Bacteria 3057
479 Ga0268266_10662010 3300028379 Bacteria 1005
480 Ga0268265_10000133 3300028380 Bacteria 95300
481 Ga0268265_10059388 3300028380 Bacteria 2925
482 Ga0268264_10000186 3300028381 Bacteria 130335
483 Ga0268264_10011871 3300028381 Bacteria 7177
484 Ga0268264_10414290 3300028381 Bacteria 1298
485 Ga0265324_10000938 3300029957 Bacteria 18264
486 Ga0265332_10000925 3300031238 Bacteria 17551
487 Ga0265339_10098794 3300031249 Bacteria 1522
488 Ga0265331_10038328 3300031250 Bacteria 2343
489 Ga0265327_10001535 3300031251 Bacteria 28497
490 Ga0307408_100000061 3300031548 Bacteria 128129
491 Ga0316576_10258445 3300031727 Bacteria 1307
492 Ga0307407_10000391 3300031903 Bacteria 13286
493 Ga0307412_10000013 3300031911 Bacteria 365239
494 Ga0307409_100532285 3300031995 Bacteria 1150
495 Ga0307411_10040268 3300032005 Bacteria 2963
496 Ga0373959_0040070 3300034820 Bacteria 980
497 Ga0373944_0079193 3300035089 Bacteria 1083
498 Ga0373923_0063430 3300035111 Bacteria 1574
499 Ga0373939_0045694 3300035114 Bacteria 1338
500 Ga0373939_0047011 3300035114 Bacteria 1324
501 Ga0373945_0041576 3300035116 Bacteria 1662
502 Ga0373955_0010277 3300035172 Bacteria 4415
503 Ga0373961_0016827 3300035241 Bacteria 1888
504 Ga0373931_0129595 3300035691 Bacteria 1450
505 Ga0373931_0303308 3300035691 Bacteria 987
506 Ga0373927_0103331 3300035695 Bacteria 1854
507 Ga0373925_0318295 3300037068 Bacteria 1258
508 Ga0395900_0166546 3300037418 Bacteria 2246
509 Ga0395905_0569514 3300037471 Bacteria 1034
510 Ga0436365_0850701 3300039437 Bacteria 4447
511 Ga0436365_0871657 3300039437 Bacteria 14199
512 Ga0436360_1103239 3300039438 Bacteria 3388
513 Ga0436361_0789733 3300039447 Unclassified 1069
514 Ga0436363_1534662 3300039450 Bacteria 2526
515 Ga0439453_0004649 3300041408 Bacteria 2050
516 Ga0439448_0004102 3300042005 Bacteria 4100
517 Ga0439450_044583 3300042008 Bacteria 1039
518 Ga0450892_002299 3300042130 Bacteria 1646
519 Ga0451577_0052535 3300042876 Bacteria 3638
520 Ga0453683_0003075 3300044673 Bacteria 12491
521 Ga0453683_0038793 3300044673 Bacteria 2995
522 Ga0453683_0073962 3300044673 Bacteria 2133
523 Ga0453683_0135152 3300044673 Bacteria 1555
524 Ga0453684_0003078 3300044712 Bacteria 38552
525 Ga0453684_0046091 3300044712 Bacteria 5804
526 Ga0495651_0209766 3300046462 Bacteria 1357
527 Ga0495580_0133545 3300046472 Bacteria 1721
528 Ga0495584_0069186 3300046491 Bacteria 1774
529 Ga0495630_0297798 3300046517 Bacteria 1233
530 Ga0495652_0061238 3300046529 Bacteria 3178
531 Ga0495598_0005900 3300046537 Bacteria 2739
532 Ga0495645_0097310 3300046543 Bacteria 2096
533 Ga0495667_0097957 3300046559 Bacteria 1899
534 Ga0495659_0026883 3300046664 Bacteria 1981
535 Ga0495657_0068190 3300046675 Bacteria 2332
536 Ga0495623_0256149 3300046679 Bacteria 982
537 Ga0495646_0214097 3300046680 Bacteria 1044
538 Ga0495647_0096234 3300046681 Bacteria 1220
539 Ga0495647_0124200 3300046681 Bacteria 1088
540 Ga0495658_0010529 3300046683 Unclassified 4628
541 Ga0495658_0020291 3300046683 Bacteria 3485
542 Ga0495658_0056661 3300046683 Bacteria 2236
543 Ga0495613_0140028 3300046689 Bacteria 1729
544 Ga0495604_0110252 3300047317 Bacteria 2008
545 Ga0495675_0017966 3300047444 Bacteria 4484
546 Ga0496100_0003946 3300048903 Bacteria 7795
547 Ga0496101_0004160 3300048904 Bacteria 9065
548 Ga0496102_0003038 3300048905 Bacteria 14214
549 Ga0496102_0021990 3300048905 Bacteria 5648
550 Ga0496103_0012489 3300048906 Bacteria 5036
551 Ga0496103_0033888 3300048906 Bacteria 3121
552 Ga0496104_0150037 3300048907 Bacteria 2238
553 Ga0496104_0179464 3300048907 Bacteria 2028
554 Ga0496104_0217415 3300048907 Bacteria 1823
555 Ga0496104_0372631 3300048907 Bacteria 1340
556 Ga0496104_0766992 3300048907 Bacteria 871
557 Ga0496105_0345220 3300048908 Bacteria 1190
558 Ga0496105_0568301 3300048908 Bacteria 883
559 Ga0496106_0002617 3300048909 Bacteria 13396
560 Ga0496106_0006028 3300048909 Bacteria 8969
561 Ga0496107_0001755 3300048910 Bacteria 13655
562 Ga0496107_0146845 3300048910 Bacteria 1744
563 Ga0496108_0018486 3300048911 Bacteria 5707
564 Ga0496108_0196049 3300048911 Bacteria 1751
565 Ga0496109_0008644 3300048912 Bacteria 8668
566 Ga0496109_0364020 3300048912 Bacteria 1366
567 Ga0496110_0385364 3300048913 Bacteria 1277
568 Ga0496110_0464779 3300048913 Bacteria 1153
569 Ga0496111_0220027 3300048914 Bacteria 1411
570 Ga0496112_0004167 3300048915 Bacteria 12181
571 Ga0496112_0030505 3300048915 Bacteria 5219
572 Ga0496112_0031628 3300048915 Bacteria 5134
573 Ga0496112_0057531 3300048915 Bacteria 3828
574 Ga0496112_0072943 3300048915 Bacteria 3394
575 Ga0496112_0477569 3300048915 Bacteria 1183
576 Ga0496113_0022910 3300048916 Bacteria 4425
577 Ga0496113_0023079 3300048916 Bacteria 4409
578 Ga0496113_0097905 3300048916 Bacteria 2270
579 Ga0496115_0003495 3300048918 Bacteria 11296
580 Ga0496115_0004420 3300048918 Bacteria 10185
581 Ga0496121_0041941 3300048924 Bacteria 3990
582 Ga0501079_0042434 3300049741 Bacteria 3513
583 Ga0501081_0574708 3300049743 Bacteria 843
584 Ga0501035_0000464 3300049822 Bacteria 45410
585 nmdc:mga05p37_225898_c1 3300050507 Bacteria 2258
586 nmdc:mga0qj67_138414_c1 3300050509 Bacteria 1973
587 nmdc:mga06r32_45458_c1 3300050510 Bacteria 4185
588 nmdc:mga08y16_591419_c1 3300050511 Bacteria 1119
589 nmdc:mga0n895_125741_c1 3300050512 Bacteria 2588
590 nmdc:mga0n895_35803_c1 3300050512 Bacteria 4789
591 nmdc:mga0n895_3922_c1 3300050512 Bacteria 12088
592 nmdc:mga0n895_4145_c1 3300050512 Bacteria 11825
593 nmdc:mga0rr50_184137_c1 3300050513 Bacteria 1708
594 nmdc:mga08x19_155861_c1 3300050514 Bacteria 1549
595 nmdc:mga08x19_221919_c1 3300050514 Bacteria 1299
596 nmdc:mga08x19_34829_c1 3300050514 Bacteria 3184
597 nmdc:mga08x19_4268_c1 3300050514 Bacteria 8473
598 nmdc:mga08x19_87743_c1 3300050514 Bacteria 2050
599 nmdc:mga0a205_518284_c1 3300050515 Bacteria 1049
600 nmdc:mga0a205_6989_c1 3300050515 Bacteria 10201
601 nmdc:mga0a205_9118_c1 3300050515 Bacteria 6484
602 Ga0495601_0087954 3300053077 Bacteria 1998
603 Ga0495595_0175312 3300053084 Bacteria 1062
604 Ga0500568_0026735 3300053139 Bacteria 2419
605 Ga0501082_0386593 3300060353 Bacteria 1221
606 Ga0530510_0063131 3300061734 Bacteria 2682
607 Ga0070670_100002914
608 JGI24736J21556_1001061
609 JGI24752J21851_1014843
610 JGI24746J21847_1002635
611 JGI24749J21850_1007788
612 JGI24744J21845_10004339
613 JGI24035J26624_1005467
614 rootH2_10022153
615 rootH1_10025939
616 JGI25404J52841_10033996
617 Ga0065704_10011755
618 Ga0065712_10130068
619 Ga0065712_10168888
620 Ga0065715_10312442
621 Ga0070658_10000128
622 Ga0070658_10064314
623 Ga0070676_10000245
624 Ga0070676_10004420
625 Ga0070676_10005741
626 Ga0070676_10043663
627 Ga0070676_10064503
628 Ga0070683_100052548
629 Ga0070683_100829206
630 Ga0070690_100000066
631 Ga0070670_100000228
632 Ga0070670_100001729
633 Ga0070670_100411814
634 Ga0070677_10000139
635 Ga0068869_100000265
636 Ga0068869_100050895
637 Ga0070666_10000240
638 Ga0070666_10000289
639 Ga0070666_10011630
640 Ga0070666_10021704
641 Ga0070666_10026120
642 Ga0070680_100140878
643 Ga0068868_100058561
644 Ga0068868_100063448
645 Ga0068868_100205849
646 Ga0070660_100001560
647 Ga0070660_100313769
648 Ga0070689_100000552
649 Ga0070689_100054309
650 Ga0070689_100267398
651 Ga0070689_100288550
652 Ga0070687_100000036
653 Ga0070687_100075714
654 Ga0070661_100000180
655 Ga0070661_100001405
656 Ga0070692_10015473
657 Ga0070668_100000083
658 Ga0070668_100005517
659 Ga0070668_100011063
660 Ga0070668_100073859
661 Ga0070668_100102140
662 Ga0070668_100119711
663 Ga0070669_100000371
664 Ga0070669_100028020
665 Ga0070669_100053912
666 Ga0070669_100086017
667 Ga0070669_100197232
668 Ga0070675_100000191
669 Ga0070675_100004919
670 Ga0070675_100012759
671 Ga0070675_100015433
672 Ga0070675_100090983
673 Ga0070671_100000141
674 Ga0070671_100004950
675 Ga0070671_100005350
676 Ga0070671_100011676
677 Ga0070671_100015632
678 Ga0070671_100043643
679 Ga0070671_100152599
680 Ga0070671_100494542
681 Ga0070674_100000390
682 Ga0070674_100013391
683 Ga0070674_100048710
684 Ga0070674_100221369
685 Ga0070673_100000056
686 Ga0070673_100005761
687 Ga0070673_100017986
688 Ga0070673_100111971
689 Ga0070688_100000021
690 Ga0070688_100004134
691 Ga0070659_100003801
692 Ga0070659_100020745
693 Ga0070659_100280351
694 Ga0070659_100328210
695 Ga0070667_100000824
696 Ga0070667_100007668
697 Ga0070667_100011318
698 Ga0070667_100047598
699 Ga0070667_100517786
700 Ga0070703_10002956
701 Ga0070703_10006086
702 Ga0070714_100073392
703 Ga0070713_100065139
704 Ga0070710_10058676
705 Ga0070711_100022385
706 Ga0070705_100000674
707 Ga0070705_100030592
708 Ga0070705_100203106
709 Ga0070700_100002048
710 Ga0070708_100003072
711 Ga0070708_100009361
712 Ga0070708_100027237
713 Ga0070708_100121546
714 Ga0070708_100168865
715 Ga0070708_100474532
716 Ga0070708_100855186
717 Ga0070678_100002065
718 Ga0070678_100065075
719 Ga0070678_100227341
720 Ga0070678_100319587
721 Ga0070662_100001048
722 Ga0070662_100003495
723 Ga0070662_100074318
724 Ga0068867_100000015
725 Ga0068867_100000140
726 Ga0068867_100004727
727 Ga0070685_10000033
728 Ga0070706_100000049
729 Ga0070706_100018905
730 Ga0070706_100047108
731 Ga0070706_100054887
732 Ga0070706_100077075
733 Ga0070706_100162353
734 Ga0070707_100009296
735 Ga0070707_100010575
736 Ga0070707_100020991
737 Ga0070707_100024846
738 Ga0070707_100032908
739 Ga0070707_100171483
740 Ga0070707_100366001
741 Ga0070698_100005083
742 Ga0070698_100236101
743 Ga0070699_100053721
744 Ga0070699_100116182
745 Ga0070699_100136358
746 Ga0070699_100140812
747 Ga0070699_100346366
748 Ga0070679_100037041
749 Ga0070679_100481598
750 Ga0070679_100561899
751 Ga0070684_100003583
752 Ga0070697_100013743
753 Ga0070697_100022777
754 Ga0070697_100029711
755 Ga0070697_100054352
756 Ga0070697_100067686
757 Ga0070697_100763862
758 Ga0068853_100000297
759 Ga0070672_100000085
760 Ga0070672_100004670
761 Ga0070672_100025998
762 Ga0070672_100043282
763 Ga0070672_100206155
764 Ga0070686_100000271
765 Ga0070695_100000781
766 Ga0070695_100039913
767 Ga0070696_100018796
768 Ga0070696_100038215
769 Ga0070693_100004853
770 Ga0070665_100007343
771 Ga0070665_100064838
772 Ga0070665_100077287
773 Ga0070665_100211830
774 Ga0070704_100020844
775 Ga0070704_100052287
776 Ga0070704_100543472
777 Ga0068855_100000438
778 Ga0070664_100004883
779 Ga0070664_100009219
780 Ga0070664_100060778
781 Ga0068857_100000076
782 Ga0068857_100015258
783 Ga0068857_100454329
784 Ga0068854_100000120
785 Ga0068856_100005499
786 Ga0068856_100099822
787 Ga0070702_100025622
788 Ga0068852_100000100
789 Ga0068852_100020384
790 Ga0068859_100000653
791 Ga0068864_100000296
792 Ga0068866_10000044
793 Ga0068861_100000006
794 Ga0068861_100217397
795 Ga0068851_10000073
796 Ga0068870_10001687
797 Ga0068863_100001171
798 Ga0068863_100158177
799 Ga0068863_100457000
800 Ga0068858_100001562
801 Ga0068858_100079263
802 Ga0068860_100000998
803 Ga0068860_100007845
804 Ga0068860_100009491
805 Ga0068860_100101367
806 Ga0068860_100210295
807 Ga0068860_100223973
808 Ga0068860_100243609
809 Ga0068860_100267426
810 Ga0068862_100003041
811 Ga0068862_100112887
812 Ga0068862_100608675
813 Ga0081455_10086136
814 Ga0081540_1000013
815 Ga0081540_1000135
816 Ga0081540_1000203
817 Ga0081540_1031586
818 Ga0070717_10226840
819 Ga0070715_10020912
820 Ga0070716_100017659
821 Ga0070712_100003966
822 Ga0070712_100032092
823 Ga0070712_100196954
824 Ga0070712_100300546
825 Ga0097621_100001139
826 Ga0097621_100008354
827 Ga0097621_100017948
828 Ga0097621_100140473
829 Ga0068871_100007380
830 Ga0068871_100053555
831 Ga0068871_100156680
832 Ga0075428_100159216
833 Ga0075430_100277137
834 Ga0075431_100034212
835 Ga0075433_10128184
836 Ga0075434_100202460
837 Ga0068865_100000053
838 Ga0068865_100023693
839 Ga0068865_100133705
840 Ga0075436_100029492
841 Ga0075436_100047103
842 Ga0075436_100080318
843 Ga0075436_100083947
844 Ga0075436_100205101
845 Ga0097620_100000653
846 Ga0075435_100129499
847 Ga0075435_100220771
848 Ga0075435_100432673
849 Ga0099794_10017089
850 Ga0105240_10018509
851 Ga0105240_10107233
852 Ga0111539_10185686
853 Ga0111539_10228611
854 Ga0105245_10000401
855 Ga0105245_10013103
856 Ga0105245_10064207
857 Ga0105245_10080763
858 Ga0105245_10155328
859 Ga0105245_10228630
860 Ga0105245_11062526
861 Ga0105247_10004420
862 Ga0105247_10252684
863 Ga0114129_10251898
864 Ga0114129_10564555
865 Ga0105243_10000014
866 Ga0105241_10000689
867 Ga0105242_10010135
868 Ga0105242_10055075
869 Ga0105248_10000322
870 Ga0105237_10000280
871 Ga0105237_10431210
872 Ga0105238_10000506
873 Ga0105249_10000197
874 Ga0105249_10001542
875 Ga0099796_10037676
876 Ga0105239_10000349
877 Ga0105239_10024798
878 Ga0105246_10149022
879 Ga0157373_10000432
880 Ga0157371_10000236
881 Ga0157369_10000132
882 Ga0157374_10000617
883 Ga0157374_10018528
884 Ga0157374_10026346
885 Ga0157374_10035067
886 Ga0157374_10093539
887 Ga0157378_10001088
888 Ga0157378_10005615
889 Ga0157378_10060747
890 Ga0157378_10103446
891 Ga0163162_10000129
892 Ga0163162_10015503
893 Ga0163162_10056453
894 Ga0163162_10127169
895 Ga0157372_10002052
896 Ga0157375_10000264
897 Ga0157375_10004339
898 Ga0157375_10005881
899 Ga0157375_10024965
900 Ga0182008_10114094
901 Ga0157377_10008556
902 Ga0157377_10018112
903 Ga0157379_10000064
904 Ga0157376_10003477
905 Ga0157376_10008164
906 Ga0157376_10128282
907 Ga0157376_10170292
908 Ga0163161_10009483
909 Ga0163161_10035997
910 Ga0163161_10090930
911 Ga0213874_10050084
912 Ga0213876_10061452
913 Ga0224572_1006755
914 Ga0207666_1008638
915 Ga0207697_10000012
916 Ga0207697_10000475
917 Ga0207697_10009116
918 Ga0207697_10009414
919 Ga0207697_10017443
920 Ga0207656_10001393
921 Ga0207653_10007661
922 Ga0207653_10014908
923 Ga0207682_10000197
924 Ga0207682_10042454
925 Ga0207642_10000072
926 Ga0207710_10002040
927 Ga0207688_10003368
928 Ga0207688_10042237
929 Ga0207688_10045381
930 Ga0207688_10106164
931 Ga0207680_10000095
932 Ga0207680_10004325
933 Ga0207680_10009297
934 Ga0207680_10018338
935 Ga0207647_10000004
936 Ga0207647_10011391
937 Ga0207699_10106666
938 Ga0207645_10000068
939 Ga0207645_10000363
940 Ga0207645_10009833
941 Ga0207645_10035410
942 Ga0207645_10048334
943 Ga0207645_10072780
944 Ga0207643_10000029
945 Ga0207705_10044488
946 Ga0207705_10297954
947 Ga0207684_10000011
948 Ga0207684_10000740
949 Ga0207684_10005068
950 Ga0207684_10017396
951 Ga0207684_10040472
952 Ga0207684_10062238
953 Ga0207684_10140656
954 Ga0207684_10146491
955 Ga0207684_10588078
956 Ga0207654_10001066
957 Ga0207695_10043568
958 Ga0207671_10000775
959 Ga0207671_10288667
960 Ga0207693_10005451
961 Ga0207693_10011372
962 Ga0207693_10014184
963 Ga0207663_10061557
964 Ga0207663_10280943
965 Ga0207660_10522782
966 Ga0207662_10000016
967 Ga0207662_10000175
968 Ga0207662_10106081
969 Ga0207657_10000134
970 Ga0207649_10000459
971 Ga0207649_10010679
972 Ga0207652_10109793
973 Ga0207646_10002202
974 Ga0207646_10003084
975 Ga0207646_10030909
976 Ga0207646_10038684
977 Ga0207646_10082473
978 Ga0207646_10093577
979 Ga0207646_10120433
980 Ga0207646_10126286
981 Ga0207681_10000072
982 Ga0207681_10004440
983 Ga0207681_10018334
984 Ga0207681_10147116
985 Ga0207681_10397498
986 Ga0207694_10002261
987 Ga0207650_10000127
988 Ga0207650_10047593
989 Ga0207650_10275549
990 Ga0207650_10489605
991 Ga0207659_10000185
992 Ga0207659_10039802
993 Ga0207659_10424818
994 Ga0207687_10000203
995 Ga0207687_10027435
996 Ga0207687_10054195
997 Ga0207700_10352480
998 Ga0207664_10050837
999 Ga0207644_10000081
1000 Ga0207644_10006795
1001 Ga0207644_10099113
1002 Ga0207690_10000181
1003 Ga0207690_10279025
1004 Ga0207706_10000084
1005 Ga0207706_10000319
1006 Ga0207686_10006007
1007 Ga0207709_10000046
1008 Ga0207709_10159079
1009 Ga0207670_10000274
1010 Ga0207670_10078055
1011 Ga0207670_10346511
1012 Ga0207669_10000134
1013 Ga0207669_10011701
1014 Ga0207669_10178882
1015 Ga0207669_10192485
1016 Ga0207704_10000111
1017 Ga0207704_10050182
1018 Ga0207704_10358171
1019 Ga0207665_10008854
1020 Ga0207691_10000203
1021 Ga0207691_10001923
1022 Ga0207691_10011875
1023 Ga0207691_10033548
1024 Ga0207691_10151723
1025 Ga0207711_10000179
1026 Ga0207689_10000111
1027 Ga0207689_10060223
1028 Ga0207661_10021274
1029 Ga0207661_10034009
1030 Ga0207679_10000062
1031 Ga0207679_10000455
1032 Ga0207679_10019151
1033 Ga0207679_10246245
1034 Ga0207667_10015376
1035 Ga0207651_10000019
1036 Ga0207651_10006055
1037 Ga0207651_10016890
1038 Ga0207651_10061257
1039 Ga0207651_10096607
1040 Ga0207651_10477993
1041 Ga0207712_10000160
1042 Ga0207712_10061961
1043 Ga0207668_10000590
1044 Ga0207668_10004551
1045 Ga0207668_10147820
1046 Ga0207640_10000265
1047 Ga0207658_10000503
1048 Ga0207658_10028310
1049 Ga0207658_10068583
1050 Ga0207658_10103212
1051 Ga0207658_10475540
1052 Ga0207658_10566775
1053 Ga0207677_10000026
1054 Ga0207677_10032840
1055 Ga0207677_10071134
1056 Ga0207677_10124936
1057 Ga0207677_10319941
1058 Ga0207703_10000298
1059 Ga0207703_10086631
1060 Ga0207639_10000921
1061 Ga0207708_10025528
1062 Ga0207702_10001140
1063 Ga0207641_10001019
1064 Ga0207641_10246508
1065 Ga0207648_10000033
1066 Ga0207648_10000249
1067 Ga0207648_10037976
1068 Ga0207648_10183204
1069 Ga0207648_10327766
1070 Ga0207676_10000106
1071 Ga0207674_10001123
1072 Ga0207674_10008450
1073 Ga0207674_10030104
1074 Ga0207675_100000112
1075 Ga0207683_10000269
1076 Ga0207683_10008354
1077 Ga0207698_10000420
1078 Ga0207698_10011568
1079 Ga0209974_10009910
1080 Ga0268266_10000308
1081 Ga0268266_10008448
1082 Ga0268266_10044225
1083 Ga0268266_10069216
1084 Ga0268266_10662010
1085 Ga0268265_10000133
1086 Ga0268265_10059388
1087 Ga0268264_10000186
1088 Ga0268264_10011871
1089 Ga0268264_10414290
1090 Ga0265324_10000938
1091 Ga0265332_10000925
1092 Ga0265339_10098794
1093 Ga0265331_10038328
1094 Ga0265327_10001535
1095 Ga0307408_100000061
1096 Ga0316576_10258445
1097 Ga0307407_10000391
1098 Ga0307412_10000013
1099 Ga0307409_100532285
1100 Ga0307411_10040268
1101 Ga0373959_0040070
1102 Ga0373944_0079193
1103 Ga0373923_0063430
1104 Ga0373939_0045694
1105 Ga0373939_0047011
1106 Ga0373945_0041576
1107 Ga0373955_0010277
1108 Ga0373961_0016827
1109 Ga0373931_0129595
1110 Ga0373931_0303308
1111 Ga0373927_0103331
1112 Ga0373925_0318295
1113 Ga0395900_0166546
1114 Ga0395905_0569514
1115 Ga0436365_0850701
1116 Ga0436365_0871657
1117 Ga0436360_1103239
1118 Ga0436361_0789733
1119 Ga0436363_1534662
1120 Ga0439453_0004649
1121 Ga0439448_0004102
1122 Ga0439450_044583
1123 Ga0450892_002299
1124 Ga0451577_0052535
1125 Ga0453683_0003075
1126 Ga0453683_0038793
1127 Ga0453683_0073962
1128 Ga0453683_0135152
1129 Ga0453684_0003078
1130 Ga0453684_0046091
1131 Ga0495651_0209766
1132 Ga0495580_0133545
1133 Ga0495584_0069186
1134 Ga0495630_0297798
1135 Ga0495652_0061238
1136 Ga0495598_0005900
1137 Ga0495645_0097310
1138 Ga0495667_0097957
1139 Ga0495659_0026883
1140 Ga0495657_0068190
1141 Ga0495623_0256149
1142 Ga0495646_0214097
1143 Ga0495647_0096234
1144 Ga0495647_0124200
1145 Ga0495658_0010529
1146 Ga0495658_0020291
1147 Ga0495658_0056661
1148 Ga0495613_0140028
1149 Ga0495604_0110252
1150 Ga0495675_0017966
1151 Ga0496100_0003946
1152 Ga0496101_0004160
1153 Ga0496102_0003038
1154 Ga0496102_0021990
1155 Ga0496103_0012489
1156 Ga0496103_0033888
1157 Ga0496104_0150037
1158 Ga0496104_0179464
1159 Ga0496104_0217415
1160 Ga0496104_0372631
1161 Ga0496104_0766992
1162 Ga0496105_0345220
1163 Ga0496105_0568301
1164 Ga0496106_0002617
1165 Ga0496106_0006028
1166 Ga0496107_0001755
1167 Ga0496107_0146845
1168 Ga0496108_0018486
1169 Ga0496108_0196049
1170 Ga0496109_0008644
1171 Ga0496109_0364020
1172 Ga0496110_0385364
1173 Ga0496110_0464779
1174 Ga0496111_0220027
1175 Ga0496112_0004167
1176 Ga0496112_0030505
1177 Ga0496112_0031628
1178 Ga0496112_0057531
1179 Ga0496112_0072943
1180 Ga0496112_0477569
1181 Ga0496113_0022910
1182 Ga0496113_0023079
1183 Ga0496113_0097905
1184 Ga0496115_0003495
1185 Ga0496115_0004420
1186 Ga0496121_0041941
1187 Ga0501079_0042434
1188 Ga0501081_0574708
1189 Ga0501035_0000464
1190 nmdc:mga05p37_225898_c1
1191 nmdc:mga0qj67_138414_c1
1192 nmdc:mga06r32_45458_c1
1193 nmdc:mga08y16_591419_c1
1194 nmdc:mga0n895_125741_c1
1195 nmdc:mga0n895_35803_c1
1196 nmdc:mga0n895_3922_c1
1197 nmdc:mga0n895_4145_c1
1198 nmdc:mga0rr50_184137_c1
1199 nmdc:mga08x19_155861_c1
1200 nmdc:mga08x19_221919_c1
1201 nmdc:mga08x19_34829_c1
1202 nmdc:mga08x19_4268_c1
1203 nmdc:mga08x19_87743_c1
1204 nmdc:mga0a205_518284_c1
1205 nmdc:mga0a205_6989_c1
1206 nmdc:mga0a205_9118_c1
1207 Ga0495601_0087954
1208 Ga0495595_0175312
1209 Ga0500568_0026735
1210 Ga0501082_0386593
1211 Ga0530510_0063131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

53

124

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

131

287

0.97

Map