F468402
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 604 | 342 | 585 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0043943|Ga0466963_0043943_1670_2515 |
| Length | 281 |
| Sequence | VRVLPSSPVSELVLSLRHRREGAIGMDLQLTGRRALVTGGTRGIGRAIVEQFLAEGASVAFCARDSDAVKRRQDELAAGLAAATRVVGTALDVADAGALADWVTSSAEQLGGIDIVVSNVSALAIPDELDNWTASFEVDLMAAVRLVRAAMPYLEASDAACIIAVSSVSGREIDFAAGPYGTMKAALVHYMQGLAYQLAPKGIRANAVSPGNTYFDGGVWQSIEQNQPELFATALDLNPTKRMGTPDEIARTVVFVASPASSRTSGANILVDGALSRGVQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 5 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 6 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 7 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 8 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 9 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 10 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 11 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 12 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 13 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 14 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 15 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 16 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 17 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 18 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 19 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 232 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 342 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.19 |
| Metatranscriptomes | 0.66 |
| Isolates | 3.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.97 |
| Nodule | 0.83 |
| Rhizoplane | 8.77 |
| Rhizosphere | 81.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10016105 | 3300001990 | Bacteria | 2414 |
| 2 | rootH2_10109253 | 3300003320 | Bacteria | 3138 |
| 3 | Ga0070658_10356654 | 3300005327 | Bacteria | 1252 |
| 4 | Ga0070683_100082953 | 3300005329 | Bacteria | 3002 |
| 5 | Ga0070683_100119571 | 3300005329 | Bacteria | 2488 |
| 6 | Ga0070670_100333804 | 3300005331 | Bacteria | 1330 |
| 7 | Ga0068869_100056219 | 3300005334 | Bacteria | 2869 |
| 8 | Ga0068869_100078718 | 3300005334 | Bacteria | 2455 |
| 9 | Ga0068869_100141222 | 3300005334 | Bacteria | 1859 |
| 10 | Ga0070666_10311989 | 3300005335 | Bacteria | 1121 |
| 11 | Ga0070682_100227107 | 3300005337 | Bacteria | 1332 |
| 12 | Ga0070682_100402234 | 3300005337 | Bacteria | 1036 |
| 13 | Ga0068868_100161719 | 3300005338 | Bacteria | 1849 |
| 14 | Ga0070660_100151201 | 3300005339 | Bacteria | 1866 |
| 15 | Ga0070691_10020329 | 3300005341 | Bacteria | 3068 |
| 16 | Ga0070687_100071458 | 3300005343 | Bacteria | 1865 |
| 17 | Ga0070661_100354554 | 3300005344 | Bacteria | 1152 |
| 18 | Ga0070692_10070893 | 3300005345 | Bacteria | 1856 |
| 19 | Ga0070668_100025190 | 3300005347 | Bacteria | 4510 |
| 20 | Ga0070668_100073271 | 3300005347 | Bacteria | 2670 |
| 21 | Ga0070668_100157039 | 3300005347 | Bacteria | 1843 |
| 22 | Ga0070671_100003181 | 3300005355 | Bacteria | 12794 |
| 23 | Ga0070673_100256280 | 3300005364 | Bacteria | 1527 |
| 24 | Ga0070659_100048061 | 3300005366 | Bacteria | 3350 |
| 25 | Ga0070667_100078297 | 3300005367 | Bacteria | 2824 |
| 26 | Ga0070667_100438905 | 3300005367 | Bacteria | 1192 |
| 27 | Ga0070709_10002092 | 3300005434 | Bacteria | 10808 |
| 28 | Ga0070714_100001185 | 3300005435 | Bacteria | 18771 |
| 29 | Ga0070714_100115010 | 3300005435 | Bacteria | 2387 |
| 30 | Ga0070714_100450616 | 3300005435 | Bacteria | 1222 |
| 31 | Ga0070714_100575515 | 3300005435 | Bacteria | 1080 |
| 32 | Ga0070713_100001804 | 3300005436 | Bacteria | 13808 |
| 33 | Ga0070713_100184129 | 3300005436 | Bacteria | 1878 |
| 34 | Ga0070713_100198111 | 3300005436 | Bacteria | 1812 |
| 35 | Ga0070713_100472323 | 3300005436 | Bacteria | 1181 |
| 36 | Ga0070713_100674280 | 3300005436 | Bacteria | 986 |
| 37 | Ga0070710_10019981 | 3300005437 | Bacteria | 3469 |
| 38 | Ga0070710_10102981 | 3300005437 | Bacteria | 1703 |
| 39 | Ga0070710_10205154 | 3300005437 | Bacteria | 1246 |
| 40 | Ga0070711_100007080 | 3300005439 | Bacteria | 6802 |
| 41 | Ga0070711_100216635 | 3300005439 | Bacteria | 1486 |
| 42 | Ga0070705_100020359 | 3300005440 | Bacteria | 3509 |
| 43 | Ga0070700_100101355 | 3300005441 | Bacteria | 1897 |
| 44 | Ga0070694_100110753 | 3300005444 | Bacteria | 1955 |
| 45 | Ga0070708_100038177 | 3300005445 | Bacteria | 4195 |
| 46 | Ga0070708_100085770 | 3300005445 | Bacteria | 2859 |
| 47 | Ga0070708_100525656 | 3300005445 | Bacteria | 1116 |
| 48 | Ga0070663_100025673 | 3300005455 | Bacteria | 3981 |
| 49 | Ga0070663_100391434 | 3300005455 | Bacteria | 1134 |
| 50 | Ga0070678_100103384 | 3300005456 | Bacteria | 2213 |
| 51 | Ga0070678_100341240 | 3300005456 | Bacteria | 1285 |
| 52 | Ga0070678_100403105 | 3300005456 | Bacteria | 1189 |
| 53 | Ga0070662_100097191 | 3300005457 | Bacteria | 2222 |
| 54 | Ga0070662_100188417 | 3300005457 | Bacteria | 1630 |
| 55 | Ga0070681_10192952 | 3300005458 | Bacteria | 1956 |
| 56 | Ga0068867_100072537 | 3300005459 | Bacteria | 2577 |
| 57 | Ga0070685_10280615 | 3300005466 | Bacteria | 1115 |
| 58 | Ga0070685_10422067 | 3300005466 | Bacteria | 928 |
| 59 | Ga0070707_100035129 | 3300005468 | Bacteria | 4781 |
| 60 | Ga0070699_100000237 | 3300005518 | Bacteria | 53797 |
| 61 | Ga0070679_100030899 | 3300005530 | Bacteria | 5291 |
| 62 | Ga0070684_100076830 | 3300005535 | Bacteria | 2948 |
| 63 | Ga0070684_100177777 | 3300005535 | Bacteria | 1935 |
| 64 | Ga0070684_100894413 | 3300005535 | Bacteria | 832 |
| 65 | Ga0070697_100003854 | 3300005536 | Bacteria | 11521 |
| 66 | Ga0068853_100139895 | 3300005539 | Bacteria | 2173 |
| 67 | Ga0070672_100405247 | 3300005543 | Bacteria | 1169 |
| 68 | Ga0070693_100127901 | 3300005547 | Bacteria | 1584 |
| 69 | Ga0070665_100015743 | 3300005548 | Bacteria | 7598 |
| 70 | Ga0070665_100141219 | 3300005548 | Bacteria | 2411 |
| 71 | Ga0070665_100401019 | 3300005548 | Bacteria | 1379 |
| 72 | Ga0068855_100084353 | 3300005563 | Bacteria | 3678 |
| 73 | Ga0068855_100208300 | 3300005563 | Bacteria | 2199 |
| 74 | Ga0070664_100164090 | 3300005564 | Bacteria | 1967 |
| 75 | Ga0068857_100081360 | 3300005577 | Bacteria | 2892 |
| 76 | Ga0068857_100231619 | 3300005577 | Bacteria | 1689 |
| 77 | Ga0068854_100080106 | 3300005578 | Bacteria | 2409 |
| 78 | Ga0068856_100054377 | 3300005614 | Bacteria | 3948 |
| 79 | Ga0070702_100004665 | 3300005615 | Bacteria | 6286 |
| 80 | Ga0070702_100116505 | 3300005615 | Bacteria | 1666 |
| 81 | Ga0070702_100186383 | 3300005615 | Bacteria | 1362 |
| 82 | Ga0068852_100511999 | 3300005616 | Bacteria | 1196 |
| 83 | Ga0068859_100289242 | 3300005617 | Bacteria | 1732 |
| 84 | Ga0068864_100655511 | 3300005618 | Bacteria | 1022 |
| 85 | Ga0068864_100821475 | 3300005618 | Bacteria | 914 |
| 86 | Ga0068861_100075641 | 3300005719 | Bacteria | 2622 |
| 87 | Ga0068851_10009856 | 3300005834 | Bacteria | 4450 |
| 88 | Ga0068870_10195462 | 3300005840 | Bacteria | 1223 |
| 89 | Ga0068870_10360697 | 3300005840 | Bacteria | 935 |
| 90 | Ga0068863_100000320 | 3300005841 | Bacteria | 48819 |
| 91 | Ga0068863_100063341 | 3300005841 | Bacteria | 3497 |
| 92 | Ga0068863_100537142 | 3300005841 | Bacteria | 1154 |
| 93 | Ga0068858_100214516 | 3300005842 | Bacteria | 1822 |
| 94 | Ga0068858_100439294 | 3300005842 | Bacteria | 1257 |
| 95 | Ga0068860_100145979 | 3300005843 | Bacteria | 2277 |
| 96 | Ga0068860_100379301 | 3300005843 | Bacteria | 1395 |
| 97 | Ga0081455_10013471 | 3300005937 | Bacteria | 8077 |
| 98 | Ga0081455_10222990 | 3300005937 | Bacteria | 1396 |
| 99 | Ga0081538_10065032 | 3300005981 | Bacteria | 2057 |
| 100 | Ga0081540_1030190 | 3300005983 | Bacteria | 3006 |
| 101 | Ga0081540_1047338 | 3300005983 | Bacteria | 2163 |
| 102 | Ga0070717_10018722 | 3300006028 | Bacteria | 5415 |
| 103 | Ga0070717_10029509 | 3300006028 | Bacteria | 4400 |
| 104 | Ga0070717_10139184 | 3300006028 | Bacteria | 2092 |
| 105 | Ga0075365_10065250 | 3300006038 | Bacteria | 2440 |
| 106 | Ga0075363_100094975 | 3300006048 | Bacteria | 1644 |
| 107 | Ga0075364_10019596 | 3300006051 | Bacteria | 4246 |
| 108 | Ga0075364_10062636 | 3300006051 | Bacteria | 2441 |
| 109 | Ga0070716_100081181 | 3300006173 | Bacteria | 1935 |
| 110 | Ga0070712_100014211 | 3300006175 | Bacteria | 5109 |
| 111 | Ga0070712_100278544 | 3300006175 | Bacteria | 1346 |
| 112 | Ga0075362_10234190 | 3300006177 | Bacteria | 900 |
| 113 | Ga0075369_10004933 | 3300006186 | Bacteria | 4961 |
| 114 | Ga0075369_10005201 | 3300006186 | Bacteria | 4846 |
| 115 | Ga0075369_10034553 | 3300006186 | Bacteria | 2146 |
| 116 | Ga0097621_100141378 | 3300006237 | Bacteria | 2057 |
| 117 | Ga0075370_10045509 | 3300006353 | Bacteria | 2482 |
| 118 | Ga0068871_100233012 | 3300006358 | Bacteria | 1599 |
| 119 | Ga0075428_100442141 | 3300006844 | Bacteria | 1393 |
| 120 | Ga0075430_100109919 | 3300006846 | Bacteria | 2299 |
| 121 | Ga0075431_100302135 | 3300006847 | Bacteria | 1617 |
| 122 | Ga0075434_100081295 | 3300006871 | Bacteria | 3237 |
| 123 | Ga0075429_100303347 | 3300006880 | Bacteria | 1398 |
| 124 | Ga0075436_100026820 | 3300006914 | Bacteria | 3966 |
| 125 | Ga0097620_100289238 | 3300006931 | Bacteria | 1732 |
| 126 | Ga0075435_100017648 | 3300007076 | Bacteria | 5407 |
| 127 | Ga0105251_10000902 | 3300009011 | Bacteria | 26630 |
| 128 | Ga0105251_10027728 | 3300009011 | Bacteria | 2867 |
| 129 | Ga0105244_10032435 | 3300009036 | Bacteria | 2765 |
| 130 | Ga0105244_10124038 | 3300009036 | Bacteria | 1249 |
| 131 | Ga0105240_10058935 | 3300009093 | Bacteria | 4793 |
| 132 | Ga0105240_10844755 | 3300009093 | Bacteria | 989 |
| 133 | Ga0111539_10033925 | 3300009094 | Bacteria | 6193 |
| 134 | Ga0111539_10072207 | 3300009094 | Bacteria | 4070 |
| 135 | Ga0111539_10082922 | 3300009094 | Bacteria | 3771 |
| 136 | Ga0111539_11061190 | 3300009094 | Bacteria | 942 |
| 137 | Ga0105245_10033190 | 3300009098 | Bacteria | 4573 |
| 138 | Ga0105245_10085728 | 3300009098 | Bacteria | 2888 |
| 139 | Ga0105247_10077192 | 3300009101 | Bacteria | 2093 |
| 140 | Ga0105243_10071575 | 3300009148 | Bacteria | 2804 |
| 141 | Ga0105241_10334246 | 3300009174 | Bacteria | 1310 |
| 142 | Ga0105242_10692930 | 3300009176 | Bacteria | 996 |
| 143 | Ga0105248_10177217 | 3300009177 | Bacteria | 2402 |
| 144 | Ga0105248_11051674 | 3300009177 | Bacteria | 920 |
| 145 | Ga0105237_10086252 | 3300009545 | Bacteria | 3129 |
| 146 | Ga0105237_10429198 | 3300009545 | Bacteria | 1327 |
| 147 | Ga0105238_10111356 | 3300009551 | Bacteria | 2718 |
| 148 | Ga0105238_10116795 | 3300009551 | Bacteria | 2648 |
| 149 | Ga0105238_10135373 | 3300009551 | Bacteria | 2442 |
| 150 | Ga0105249_10114196 | 3300009553 | Bacteria | 2557 |
| 151 | Ga0105249_10252977 | 3300009553 | Bacteria | 1747 |
| 152 | Ga0105239_10033883 | 3300010375 | Bacteria | 5606 |
| 153 | Ga0105239_10041196 | 3300010375 | Bacteria | 5061 |
| 154 | Ga0105239_10694977 | 3300010375 | Bacteria | 1163 |
| 155 | Ga0105246_10064761 | 3300011119 | Bacteria | 2554 |
| 156 | Ga0105246_10122539 | 3300011119 | Bacteria | 1929 |
| 157 | Ga0105246_10396758 | 3300011119 | Bacteria | 1144 |
| 158 | Ga0105246_10625588 | 3300011119 | Bacteria | 934 |
| 159 | Ga0157370_10018423 | 3300013104 | Bacteria | 7021 |
| 160 | Ga0157369_10096818 | 3300013105 | Bacteria | 3148 |
| 161 | Ga0157369_10506337 | 3300013105 | Bacteria | 1249 |
| 162 | Ga0157374_10096969 | 3300013296 | Bacteria | 2820 |
| 163 | Ga0157378_10229363 | 3300013297 | Bacteria | 1769 |
| 164 | Ga0163162_10002167 | 3300013306 | Bacteria | 18428 |
| 165 | Ga0163162_10166125 | 3300013306 | Bacteria | 2331 |
| 166 | Ga0163162_10506486 | 3300013306 | Bacteria | 1337 |
| 167 | Ga0163162_10513047 | 3300013306 | Bacteria | 1329 |
| 168 | Ga0157372_10032275 | 3300013307 | Bacteria | 5741 |
| 169 | Ga0157372_10048710 | 3300013307 | Bacteria | 4710 |
| 170 | Ga0157372_10898565 | 3300013307 | Bacteria | 1028 |
| 171 | Ga0157375_10011549 | 3300013308 | Bacteria | 7800 |
| 172 | Ga0157375_10198382 | 3300013308 | Bacteria | 2162 |
| 173 | Ga0157375_10250147 | 3300013308 | Bacteria | 1933 |
| 174 | Ga0157375_10694031 | 3300013308 | Bacteria | 1172 |
| 175 | Ga0157375_10800285 | 3300013308 | Bacteria | 1091 |
| 176 | Ga0163163_10417551 | 3300014325 | Bacteria | 1400 |
| 177 | Ga0157377_10134231 | 3300014745 | Bacteria | 1515 |
| 178 | Ga0157379_10172659 | 3300014968 | Bacteria | 1951 |
| 179 | Ga0157379_10509829 | 3300014968 | Bacteria | 1116 |
| 180 | Ga0157376_10470653 | 3300014969 | Bacteria | 1229 |
| 181 | Ga0157376_10473912 | 3300014969 | Bacteria | 1225 |
| 182 | Ga0183361_10004 | 3300016635 | Bacteria | 484183 |
| 183 | Ga0163161_10026821 | 3300017792 | Bacteria | 4084 |
| 184 | Ga0163161_10230005 | 3300017792 | Bacteria | 1439 |
| 185 | Ga0206351_10719505 | 3300020077 | Bacteria | 810 |
| 186 | Ga0206354_10719664 | 3300020081 | Bacteria | 1539 |
| 187 | Ga0206353_10101519 | 3300020082 | Bacteria | 1016 |
| 188 | Ga0213875_10002693 | 3300021388 | Bacteria | 10486 |
| 189 | Ga0224712_10084796 | 3300022467 | Bacteria | 1315 |
| 190 | Ga0224572_1010853 | 3300024225 | Bacteria | 1718 |
| 191 | Ga0209759_1000130 | 3300025256 | Bacteria | 130638 |
| 192 | Ga0207426_1001241 | 3300025302 | Bacteria | 22421 |
| 193 | Ga0209051_1001907 | 3300025303 | Bacteria | 16242 |
| 194 | Ga0209051_1002547 | 3300025303 | Bacteria | 12872 |
| 195 | Ga0209051_1012164 | 3300025303 | Bacteria | 4179 |
| 196 | Ga0209051_1023549 | 3300025303 | Bacteria | 2556 |
| 197 | Ga0207655_1038919 | 3300025728 | Bacteria | 2072 |
| 198 | Ga0207713_1002952 | 3300025735 | Bacteria | 11889 |
| 199 | Ga0207713_1024454 | 3300025735 | Bacteria | 2817 |
| 200 | Ga0207692_10088344 | 3300025898 | Bacteria | 1675 |
| 201 | Ga0207642_10197446 | 3300025899 | Bacteria | 1109 |
| 202 | Ga0207710_10214137 | 3300025900 | Bacteria | 955 |
| 203 | Ga0207688_10006956 | 3300025901 | Bacteria | 6155 |
| 204 | Ga0207688_10100635 | 3300025901 | Bacteria | 1669 |
| 205 | Ga0207688_10191398 | 3300025901 | Bacteria | 1224 |
| 206 | Ga0207647_10021916 | 3300025904 | Bacteria | 4253 |
| 207 | Ga0207699_10309899 | 3300025906 | Bacteria | 1104 |
| 208 | Ga0207699_10389317 | 3300025906 | Bacteria | 991 |
| 209 | Ga0207705_10286833 | 3300025909 | Bacteria | 1261 |
| 210 | Ga0207684_10018224 | 3300025910 | Bacteria | 6014 |
| 211 | Ga0207654_10211947 | 3300025911 | Bacteria | 1281 |
| 212 | Ga0207654_10258287 | 3300025911 | Bacteria | 1170 |
| 213 | Ga0207654_10288108 | 3300025911 | Bacteria | 1113 |
| 214 | Ga0207671_10097575 | 3300025914 | Bacteria | 2222 |
| 215 | Ga0207693_10002076 | 3300025915 | Bacteria | 17507 |
| 216 | Ga0207693_10074595 | 3300025915 | Bacteria | 2657 |
| 217 | Ga0207693_10263939 | 3300025915 | Bacteria | 1350 |
| 218 | Ga0207663_10053772 | 3300025916 | Bacteria | 2517 |
| 219 | Ga0207663_10233145 | 3300025916 | Bacteria | 1346 |
| 220 | Ga0207663_10349658 | 3300025916 | Bacteria | 1119 |
| 221 | Ga0207657_10125487 | 3300025919 | Bacteria | 2108 |
| 222 | Ga0207652_10019581 | 3300025921 | Bacteria | 5568 |
| 223 | Ga0207646_10070221 | 3300025922 | Bacteria | 3128 |
| 224 | Ga0207681_10038738 | 3300025923 | Bacteria | 3161 |
| 225 | Ga0207694_10061792 | 3300025924 | Bacteria | 2916 |
| 226 | Ga0207687_10051953 | 3300025927 | Bacteria | 2859 |
| 227 | Ga0207687_10487138 | 3300025927 | Bacteria | 1028 |
| 228 | Ga0207700_10021197 | 3300025928 | Bacteria | 4431 |
| 229 | Ga0207700_10061437 | 3300025928 | Bacteria | 2849 |
| 230 | Ga0207700_10066166 | 3300025928 | Bacteria | 2761 |
| 231 | Ga0207700_10238913 | 3300025928 | Bacteria | 1548 |
| 232 | Ga0207700_10378001 | 3300025928 | Bacteria | 1238 |
| 233 | Ga0207664_10042292 | 3300025929 | Bacteria | 3556 |
| 234 | Ga0207664_10096404 | 3300025929 | Bacteria | 2434 |
| 235 | Ga0207664_10099851 | 3300025929 | Bacteria | 2396 |
| 236 | Ga0207664_10132215 | 3300025929 | Bacteria | 2102 |
| 237 | Ga0207644_10011665 | 3300025931 | Bacteria | 5820 |
| 238 | Ga0207690_10034738 | 3300025932 | Bacteria | 3250 |
| 239 | Ga0207709_10073548 | 3300025935 | Bacteria | 2178 |
| 240 | Ga0207709_10238266 | 3300025935 | Bacteria | 1322 |
| 241 | Ga0207670_10085351 | 3300025936 | Bacteria | 2219 |
| 242 | Ga0207669_10049241 | 3300025937 | Bacteria | 2510 |
| 243 | Ga0207704_10177122 | 3300025938 | Bacteria | 1537 |
| 244 | Ga0207665_10000414 | 3300025939 | Bacteria | 29429 |
| 245 | Ga0207691_10516658 | 3300025940 | Bacteria | 1013 |
| 246 | Ga0207711_10117197 | 3300025941 | Bacteria | 2375 |
| 247 | Ga0207711_10223608 | 3300025941 | Bacteria | 1723 |
| 248 | Ga0207711_10302704 | 3300025941 | Bacteria | 1475 |
| 249 | Ga0207689_10293646 | 3300025942 | Bacteria | 1347 |
| 250 | Ga0207661_10159207 | 3300025944 | Bacteria | 1958 |
| 251 | Ga0207679_10875081 | 3300025945 | Bacteria | 821 |
| 252 | Ga0207667_10187380 | 3300025949 | Bacteria | 2123 |
| 253 | Ga0207651_10119302 | 3300025960 | Bacteria | 1997 |
| 254 | Ga0207712_10026482 | 3300025961 | Bacteria | 3864 |
| 255 | Ga0207712_10043019 | 3300025961 | Bacteria | 3113 |
| 256 | Ga0207712_10090400 | 3300025961 | Bacteria | 2253 |
| 257 | Ga0207668_10017140 | 3300025972 | Bacteria | 4533 |
| 258 | Ga0207668_10089646 | 3300025972 | Bacteria | 2255 |
| 259 | Ga0207668_10421938 | 3300025972 | Bacteria | 1132 |
| 260 | Ga0207640_10048055 | 3300025981 | Bacteria | 2756 |
| 261 | Ga0207640_10061175 | 3300025981 | Bacteria | 2493 |
| 262 | Ga0207640_10275810 | 3300025981 | Bacteria | 1318 |
| 263 | Ga0207658_10061822 | 3300025986 | Bacteria | 2800 |
| 264 | Ga0207677_10286223 | 3300026023 | Bacteria | 1355 |
| 265 | Ga0207677_10453876 | 3300026023 | Bacteria | 1099 |
| 266 | Ga0207703_10161545 | 3300026035 | Bacteria | 1963 |
| 267 | Ga0207639_10145589 | 3300026041 | Bacteria | 1979 |
| 268 | Ga0207678_10026393 | 3300026067 | Bacteria | 5067 |
| 269 | Ga0207678_10028607 | 3300026067 | Bacteria | 4863 |
| 270 | Ga0207678_10096133 | 3300026067 | Bacteria | 2531 |
| 271 | Ga0207678_10100179 | 3300026067 | Bacteria | 2475 |
| 272 | Ga0207678_10550602 | 3300026067 | Bacteria | 1009 |
| 273 | Ga0207708_10029199 | 3300026075 | Bacteria | 4179 |
| 274 | Ga0207708_10052679 | 3300026075 | Bacteria | 3100 |
| 275 | Ga0207702_10445456 | 3300026078 | Bacteria | 1256 |
| 276 | Ga0207702_10989848 | 3300026078 | Bacteria | 834 |
| 277 | Ga0207641_10003778 | 3300026088 | Bacteria | 13291 |
| 278 | Ga0207641_10178611 | 3300026088 | Bacteria | 1943 |
| 279 | Ga0207676_10195292 | 3300026095 | Bacteria | 1784 |
| 280 | Ga0207676_10231117 | 3300026095 | Bacteria | 1653 |
| 281 | Ga0207676_10303552 | 3300026095 | Bacteria | 1458 |
| 282 | Ga0207674_10107378 | 3300026116 | Bacteria | 2768 |
| 283 | Ga0207675_100010336 | 3300026118 | Bacteria | 8746 |
| 284 | Ga0207683_10039903 | 3300026121 | Bacteria | 4095 |
| 285 | Ga0207683_10047866 | 3300026121 | Bacteria | 3744 |
| 286 | Ga0207683_10152687 | 3300026121 | Bacteria | 2084 |
| 287 | Ga0207683_10619361 | 3300026121 | Bacteria | 1002 |
| 288 | Ga0207428_10065580 | 3300027907 | Bacteria | 2864 |
| 289 | Ga0207428_10151493 | 3300027907 | Bacteria | 1765 |
| 290 | Ga0207428_10247983 | 3300027907 | Bacteria | 1329 |
| 291 | Ga0268266_10098914 | 3300028379 | Bacteria | 2567 |
| 292 | Ga0268266_10119028 | 3300028379 | Bacteria | 2348 |
| 293 | Ga0268266_10226306 | 3300028379 | Bacteria | 1721 |
| 294 | Ga0268266_10265125 | 3300028379 | Bacteria | 1593 |
| 295 | Ga0268266_10543405 | 3300028379 | Bacteria | 1113 |
| 296 | Ga0268265_10115172 | 3300028380 | Bacteria | 2203 |
| 297 | Ga0268264_10286878 | 3300028381 | Bacteria | 1544 |
| 298 | Ga0268264_10583328 | 3300028381 | Bacteria | 1100 |
| 299 | Ga0265319_1002788 | 3300028563 | Bacteria | 9375 |
| 300 | Ga0265334_10007367 | 3300028573 | Bacteria | 4720 |
| 301 | Ga0265322_10015169 | 3300028654 | Bacteria | 2228 |
| 302 | Ga0265338_10001289 | 3300028800 | Bacteria | 41134 |
| 303 | Ga0265324_10003207 | 3300029957 | Bacteria | 7910 |
| 304 | Ga0265332_10002488 | 3300031238 | Bacteria | 9375 |
| 305 | Ga0265320_10021590 | 3300031240 | Bacteria | 3458 |
| 306 | Ga0265339_10019095 | 3300031249 | Bacteria | 4028 |
| 307 | Ga0265316_10138018 | 3300031344 | Bacteria | 1833 |
| 308 | Ga0307408_100004673 | 3300031548 | Bacteria | 9252 |
| 309 | Ga0265313_10020870 | 3300031595 | Bacteria | 3599 |
| 310 | Ga0265314_10273180 | 3300031711 | Bacteria | 959 |
| 311 | Ga0265342_10006091 | 3300031712 | Bacteria | 9048 |
| 312 | Ga0307405_10019951 | 3300031731 | Bacteria | 3735 |
| 313 | Ga0307410_10252692 | 3300031852 | Bacteria | 1371 |
| 314 | Ga0307410_10273666 | 3300031852 | Bacteria | 1322 |
| 315 | Ga0307406_10122425 | 3300031901 | Bacteria | 1811 |
| 316 | Ga0307412_10036248 | 3300031911 | Bacteria | 3158 |
| 317 | Ga0307416_100080927 | 3300032002 | Bacteria | 2744 |
| 318 | Ga0307411_10136856 | 3300032005 | Bacteria | 1800 |
| 319 | Ga0307411_10252807 | 3300032005 | Bacteria | 1387 |
| 320 | Ga0373930_0002507 | 3300034816 | Bacteria | 2845 |
| 321 | Ga0373939_0001572 | 3300035114 | Bacteria | 5525 |
| 322 | Ga0373941_0001653 | 3300035115 | Bacteria | 4767 |
| 323 | Ga0373960_0009273 | 3300035121 | Bacteria | 2379 |
| 324 | Ga0373942_0006729 | 3300035207 | Bacteria | 2656 |
| 325 | Ga0373962_0087105 | 3300035242 | Bacteria | 957 |
| 326 | Ga0316574_0023165 | 3300035398 | Bacteria | 3706 |
| 327 | Ga0373931_0006681 | 3300035691 | Bacteria | 5406 |
| 328 | Ga0373935_0129525 | 3300035692 | Bacteria | 1694 |
| 329 | Ga0373935_0133067 | 3300035692 | Bacteria | 1673 |
| 330 | Ga0373933_0172526 | 3300035724 | Bacteria | 1377 |
| 331 | Ga0373947_0226159 | 3300035725 | Bacteria | 1231 |
| 332 | Ga0373947_0544322 | 3300035725 | Bacteria | 790 |
| 333 | Ga0373937_0139628 | 3300036401 | Bacteria | 2266 |
| 334 | Ga0373925_0106141 | 3300037068 | Bacteria | 2165 |
| 335 | Ga0395905_0044417 | 3300037471 | Bacteria | 4171 |
| 336 | Ga0436364_0324998 | 3300037853 | Bacteria | 20353 |
| 337 | Ga0436365_0428073 | 3300039437 | Bacteria | 1151 |
| 338 | Ga0436365_0659902 | 3300039437 | Bacteria | 1154 |
| 339 | Ga0436365_1432981 | 3300039437 | Bacteria | 1444 |
| 340 | Ga0436362_0843181 | 3300039453 | Bacteria | 7832 |
| 341 | Ga0439466_0011317 | 3300041411 | Bacteria | 3302 |
| 342 | Ga0439465_0021859 | 3300041413 | Bacteria | 2008 |
| 343 | Ga0439431_0014813 | 3300041997 | Bacteria | 1810 |
| 344 | Ga0439442_055461 | 3300042002 | Bacteria | 838 |
| 345 | Ga0439450_016451 | 3300042008 | Bacteria | 1530 |
| 346 | Ga0451577_0011794 | 3300042876 | Bacteria | 8247 |
| 347 | Ga0451577_0378210 | 3300042876 | Bacteria | 1285 |
| 348 | Ga0466961_0136827 | 3300044693 | Bacteria | 1535 |
| 349 | Ga0466963_0000820 | 3300044694 | Bacteria | 15535 |
| 350 | Ga0466963_0033591 | 3300044694 | Bacteria | 3333 |
| 351 | Ga0466963_0043943 | 3300044694 | Bacteria | 2940 |
| 352 | Ga0453684_0170855 | 3300044712 | Bacteria | 2562 |
| 353 | Ga0453684_0817112 | 3300044712 | Bacteria | 1004 |
| 354 | Ga0466970_0155951 | 3300044765 | Bacteria | 1262 |
| 355 | Ga0466957_0200434 | 3300044842 | Bacteria | 1311 |
| 356 | Ga0466959_0115730 | 3300045049 | Bacteria | 1910 |
| 357 | Ga0451576_0113444 | 3300045051 | Bacteria | 2821 |
| 358 | Ga0466958_0057561 | 3300045836 | Bacteria | 2362 |
| 359 | Ga0466967_0030783 | 3300045976 | Bacteria | 4507 |
| 360 | Ga0466967_0049170 | 3300045976 | Bacteria | 3687 |
| 361 | Ga0466967_0158852 | 3300045976 | Bacteria | 2120 |
| 362 | Ga0466967_0190374 | 3300045976 | Bacteria | 1938 |
| 363 | Ga0466967_0282195 | 3300045976 | Bacteria | 1594 |
| 364 | Ga0466967_0424557 | 3300045976 | Bacteria | 1296 |
| 365 | Ga0495592_0005032 | 3300046454 | Bacteria | 9722 |
| 366 | Ga0495592_0078911 | 3300046454 | Bacteria | 2384 |
| 367 | Ga0495603_0023699 | 3300046455 | Bacteria | 3713 |
| 368 | Ga0495603_0217355 | 3300046455 | Bacteria | 1103 |
| 369 | Ga0495590_0001075 | 3300046457 | Bacteria | 12028 |
| 370 | Ga0495590_0006611 | 3300046457 | Bacteria | 4518 |
| 371 | Ga0495591_000630 | 3300046458 | Bacteria | 26156 |
| 372 | Ga0495591_071276 | 3300046458 | Bacteria | 902 |
| 373 | Ga0495629_0001892 | 3300046459 | Bacteria | 16301 |
| 374 | Ga0495629_0004420 | 3300046459 | Bacteria | 10532 |
| 375 | Ga0495629_0073542 | 3300046459 | Bacteria | 2386 |
| 376 | Ga0495638_0003764 | 3300046460 | Bacteria | 11793 |
| 377 | Ga0495638_0005628 | 3300046460 | Bacteria | 9241 |
| 378 | Ga0495641_0022941 | 3300046461 | Bacteria | 3112 |
| 379 | Ga0495651_0000569 | 3300046462 | Bacteria | 28595 |
| 380 | Ga0495653_0029572 | 3300046463 | Bacteria | 4372 |
| 381 | Ga0495653_0237896 | 3300046463 | Bacteria | 1215 |
| 382 | Ga0495580_0000889 | 3300046472 | Bacteria | 25974 |
| 383 | Ga0495580_0004799 | 3300046472 | Bacteria | 11322 |
| 384 | Ga0495580_0049018 | 3300046472 | Bacteria | 2988 |
| 385 | Ga0495582_0076703 | 3300046473 | Bacteria | 1853 |
| 386 | Ga0495605_0002296 | 3300046474 | Bacteria | 11924 |
| 387 | Ga0495605_0078190 | 3300046474 | Bacteria | 1551 |
| 388 | Ga0495605_0122949 | 3300046474 | Bacteria | 1175 |
| 389 | Ga0495662_0039389 | 3300046476 | Bacteria | 2283 |
| 390 | Ga0495664_0003070 | 3300046477 | Bacteria | 9048 |
| 391 | Ga0495664_0019767 | 3300046477 | Bacteria | 3877 |
| 392 | Ga0495596_0009370 | 3300046500 | Bacteria | 4307 |
| 393 | Ga0495596_0075667 | 3300046500 | Bacteria | 1308 |
| 394 | Ga0495607_0006590 | 3300046501 | Bacteria | 8151 |
| 395 | Ga0495607_0246863 | 3300046501 | Bacteria | 861 |
| 396 | Ga0495583_0004834 | 3300046506 | Bacteria | 9428 |
| 397 | Ga0495606_0134456 | 3300046507 | Bacteria | 1466 |
| 398 | Ga0495608_0001673 | 3300046511 | Bacteria | 15948 |
| 399 | Ga0495608_0151602 | 3300046511 | Bacteria | 1477 |
| 400 | Ga0495616_0219706 | 3300046513 | Bacteria | 828 |
| 401 | Ga0495618_0206167 | 3300046514 | Bacteria | 1243 |
| 402 | Ga0495620_0048889 | 3300046515 | Bacteria | 1813 |
| 403 | Ga0495628_0028776 | 3300046516 | Bacteria | 4512 |
| 404 | Ga0495628_0043558 | 3300046516 | Bacteria | 3573 |
| 405 | Ga0495628_0048363 | 3300046516 | Bacteria | 3371 |
| 406 | Ga0495628_0203979 | 3300046516 | Bacteria | 1489 |
| 407 | Ga0495630_0054576 | 3300046517 | Bacteria | 2993 |
| 408 | Ga0495630_0177780 | 3300046517 | Bacteria | 1622 |
| 409 | Ga0495631_0139050 | 3300046518 | Bacteria | 1043 |
| 410 | Ga0495644_0025944 | 3300046523 | Bacteria | 2224 |
| 411 | Ga0495648_0006835 | 3300046524 | Bacteria | 9211 |
| 412 | Ga0495648_0020754 | 3300046524 | Bacteria | 4570 |
| 413 | Ga0495648_0021191 | 3300046524 | Bacteria | 4508 |
| 414 | Ga0495648_0042187 | 3300046524 | Bacteria | 2873 |
| 415 | Ga0495666_0003783 | 3300046526 | Bacteria | 7651 |
| 416 | Ga0495666_0030226 | 3300046526 | Bacteria | 2661 |
| 417 | Ga0495642_0015321 | 3300046528 | Bacteria | 2979 |
| 418 | Ga0495652_0004265 | 3300046529 | Bacteria | 13734 |
| 419 | Ga0495652_0021421 | 3300046529 | Bacteria | 5747 |
| 420 | Ga0495652_0308960 | 3300046529 | Bacteria | 1146 |
| 421 | Ga0495665_0039793 | 3300046531 | Bacteria | 2503 |
| 422 | Ga0495665_0104725 | 3300046531 | Bacteria | 1484 |
| 423 | Ga0495640_0057415 | 3300046533 | Bacteria | 2656 |
| 424 | Ga0495640_0215281 | 3300046533 | Bacteria | 1213 |
| 425 | Ga0495586_0006562 | 3300046535 | Bacteria | 6217 |
| 426 | Ga0495586_0132771 | 3300046535 | Bacteria | 1394 |
| 427 | Ga0495586_0450966 | 3300046535 | Bacteria | 741 |
| 428 | Ga0495587_0054121 | 3300046536 | Bacteria | 2365 |
| 429 | Ga0495597_0003843 | 3300046542 | Bacteria | 8528 |
| 430 | Ga0495645_0005345 | 3300046543 | Bacteria | 8801 |
| 431 | Ga0495645_0032852 | 3300046543 | Bacteria | 3785 |
| 432 | Ga0495667_0027842 | 3300046559 | Bacteria | 3806 |
| 433 | Ga0495667_0116493 | 3300046559 | Bacteria | 1726 |
| 434 | Ga0495611_0077346 | 3300046648 | Bacteria | 1526 |
| 435 | Ga0495611_0113257 | 3300046648 | Bacteria | 1263 |
| 436 | Ga0495625_0086052 | 3300046660 | Bacteria | 2181 |
| 437 | Ga0495635_0218194 | 3300046663 | Bacteria | 1290 |
| 438 | Ga0495661_0044842 | 3300046665 | Bacteria | 2707 |
| 439 | Ga0495661_0051976 | 3300046665 | Bacteria | 2471 |
| 440 | Ga0495599_0010836 | 3300046678 | Bacteria | 5586 |
| 441 | Ga0495599_0066384 | 3300046678 | Bacteria | 2253 |
| 442 | Ga0495599_0107325 | 3300046678 | Bacteria | 1740 |
| 443 | Ga0495599_0271809 | 3300046678 | Bacteria | 1028 |
| 444 | Ga0495623_0002549 | 3300046679 | Bacteria | 12047 |
| 445 | Ga0495623_0009365 | 3300046679 | Bacteria | 6363 |
| 446 | Ga0495623_0047090 | 3300046679 | Bacteria | 2737 |
| 447 | Ga0495646_0036757 | 3300046680 | Bacteria | 3032 |
| 448 | Ga0495646_0052827 | 3300046680 | Bacteria | 2452 |
| 449 | Ga0495646_0053918 | 3300046680 | Bacteria | 2421 |
| 450 | Ga0495646_0194727 | 3300046680 | Bacteria | 1106 |
| 451 | Ga0495624_0001835 | 3300046690 | Bacteria | 16213 |
| 452 | Ga0495624_0007211 | 3300046690 | Bacteria | 7815 |
| 453 | Ga0495624_0007632 | 3300046690 | Bacteria | 7593 |
| 454 | Ga0495624_0046131 | 3300046690 | Bacteria | 2771 |
| 455 | Ga0495624_0185128 | 3300046690 | Bacteria | 1268 |
| 456 | Ga0495671_0043647 | 3300046692 | Bacteria | 2250 |
| 457 | Ga0495649_0015797 | 3300046694 | Bacteria | 4292 |
| 458 | Ga0495589_0004936 | 3300046794 | Bacteria | 7070 |
| 459 | Ga0495589_0041963 | 3300046794 | Bacteria | 2281 |
| 460 | Ga0495589_0272616 | 3300046794 | Bacteria | 787 |
| 461 | Ga0495660_0088867 | 3300046810 | Bacteria | 1609 |
| 462 | Ga0495604_0006195 | 3300047317 | Bacteria | 9496 |
| 463 | Ga0495604_0022967 | 3300047317 | Bacteria | 4978 |
| 464 | Ga0495604_0054452 | 3300047317 | Bacteria | 3086 |
| 465 | Ga0495604_0329986 | 3300047317 | Bacteria | 1018 |
| 466 | Ga0495674_0003086 | 3300047319 | Bacteria | 16194 |
| 467 | Ga0495674_0089728 | 3300047319 | Bacteria | 2627 |
| 468 | Ga0495674_0123546 | 3300047319 | Bacteria | 2185 |
| 469 | Ga0495674_0282842 | 3300047319 | Bacteria | 1358 |
| 470 | Ga0495672_0042143 | 3300047320 | Bacteria | 2754 |
| 471 | Ga0495672_0106176 | 3300047320 | Bacteria | 1514 |
| 472 | Ga0495676_0188857 | 3300047321 | Bacteria | 1438 |
| 473 | Ga0495680_0022210 | 3300047322 | Bacteria | 5294 |
| 474 | Ga0495680_0041319 | 3300047322 | Bacteria | 3668 |
| 475 | Ga0495680_0166581 | 3300047322 | Bacteria | 1597 |
| 476 | Ga0495683_0002778 | 3300047323 | Bacteria | 10423 |
| 477 | Ga0495683_0018269 | 3300047323 | Bacteria | 3627 |
| 478 | Ga0495683_0024999 | 3300047323 | Bacteria | 3062 |
| 479 | Ga0495683_0040475 | 3300047323 | Bacteria | 2354 |
| 480 | Ga0495679_000069 | 3300047446 | Bacteria | 99286 |
| 481 | Ga0495679_005819 | 3300047446 | Bacteria | 5423 |
| 482 | Ga0495679_036132 | 3300047446 | Bacteria | 1561 |
| 483 | Ga0495673_0012297 | 3300047469 | Bacteria | 4549 |
| 484 | Ga0495673_0024129 | 3300047469 | Bacteria | 2945 |
| 485 | Ga0495681_0008254 | 3300047470 | Bacteria | 6543 |
| 486 | Ga0495681_0048514 | 3300047470 | Bacteria | 2012 |
| 487 | Ga0495684_0020901 | 3300047471 | Bacteria | 5043 |
| 488 | Ga0495684_0037263 | 3300047471 | Bacteria | 3730 |
| 489 | Ga0495686_0000048 | 3300047472 | Bacteria | 278044 |
| 490 | Ga0495686_0002817 | 3300047472 | Bacteria | 15762 |
| 491 | Ga0495686_0132599 | 3300047472 | Bacteria | 1476 |
| 492 | Ga0495686_0274444 | 3300047472 | Bacteria | 939 |
| 493 | Ga0495593_0001498 | 3300047673 | Bacteria | 13736 |
| 494 | Ga0495593_0029529 | 3300047673 | Bacteria | 3006 |
| 495 | Ga0495593_0107578 | 3300047673 | Bacteria | 1425 |
| 496 | Ga0495602_0056072 | 3300048088 | Bacteria | 3467 |
| 497 | Ga0495602_0064400 | 3300048088 | Bacteria | 3169 |
| 498 | Ga0495602_0115864 | 3300048088 | Bacteria | 2166 |
| 499 | Ga0496100_0000113 | 3300048903 | Bacteria | 46589 |
| 500 | Ga0496100_0006352 | 3300048903 | Bacteria | 6440 |
| 501 | Ga0496101_0000363 | 3300048904 | Bacteria | 30086 |
| 502 | Ga0496101_0011523 | 3300048904 | Bacteria | 5870 |
| 503 | Ga0496101_0070727 | 3300048904 | Bacteria | 2556 |
| 504 | Ga0496101_0199918 | 3300048904 | Bacteria | 1545 |
| 505 | Ga0496102_0092435 | 3300048905 | Bacteria | 2801 |
| 506 | Ga0496102_0143444 | 3300048905 | Bacteria | 2240 |
| 507 | Ga0496102_0389809 | 3300048905 | Bacteria | 1310 |
| 508 | Ga0496103_0001462 | 3300048906 | Bacteria | 15822 |
| 509 | Ga0496103_0297690 | 3300048906 | Bacteria | 1038 |
| 510 | Ga0496104_0009123 | 3300048907 | Bacteria | 8820 |
| 511 | Ga0496104_0034035 | 3300048907 | Bacteria | 4749 |
| 512 | Ga0496104_0063350 | 3300048907 | Bacteria | 3506 |
| 513 | Ga0496104_0122114 | 3300048907 | Bacteria | 2501 |
| 514 | Ga0496104_0316203 | 3300048907 | Bacteria | 1474 |
| 515 | Ga0496105_0007018 | 3300048908 | Bacteria | 8676 |
| 516 | Ga0496105_0225948 | 3300048908 | Bacteria | 1522 |
| 517 | Ga0496106_0075297 | 3300048909 | Bacteria | 2585 |
| 518 | Ga0496106_0152345 | 3300048909 | Bacteria | 1824 |
| 519 | Ga0496106_0220430 | 3300048909 | Bacteria | 1513 |
| 520 | Ga0496107_0001890 | 3300048910 | Bacteria | 13265 |
| 521 | Ga0496107_0067422 | 3300048910 | Bacteria | 2596 |
| 522 | Ga0496107_0071745 | 3300048910 | Bacteria | 2517 |
| 523 | Ga0496108_0005802 | 3300048911 | Bacteria | 10008 |
| 524 | Ga0496108_0014994 | 3300048911 | Bacteria | 6325 |
| 525 | Ga0496108_0036994 | 3300048911 | Bacteria | 4064 |
| 526 | Ga0496108_0310321 | 3300048911 | Bacteria | 1374 |
| 527 | Ga0496108_0559784 | 3300048911 | Bacteria | 997 |
| 528 | Ga0496109_0015999 | 3300048912 | Bacteria | 6555 |
| 529 | Ga0496109_0021547 | 3300048912 | Bacteria | 5701 |
| 530 | Ga0496109_0079671 | 3300048912 | Bacteria | 3018 |
| 531 | Ga0496109_0345610 | 3300048912 | Bacteria | 1405 |
| 532 | Ga0496109_0531009 | 3300048912 | Bacteria | 1110 |
| 533 | Ga0496110_0187267 | 3300048913 | Bacteria | 1879 |
| 534 | Ga0496111_0107357 | 3300048914 | Bacteria | 2055 |
| 535 | Ga0496112_0003887 | 3300048915 | Bacteria | 12493 |
| 536 | Ga0496112_0024759 | 3300048915 | Bacteria | 5755 |
| 537 | Ga0496112_0112235 | 3300048915 | Bacteria | 2695 |
| 538 | Ga0496112_0442212 | 3300048915 | Bacteria | 1238 |
| 539 | Ga0496113_0048282 | 3300048916 | Bacteria | 3167 |
| 540 | Ga0496113_0049790 | 3300048916 | Bacteria | 3121 |
| 541 | Ga0496113_0115675 | 3300048916 | Bacteria | 2092 |
| 542 | Ga0496114_0001090 | 3300048917 | Bacteria | 20470 |
| 543 | Ga0496114_0164549 | 3300048917 | Bacteria | 1930 |
| 544 | Ga0496114_0372622 | 3300048917 | Bacteria | 1264 |
| 545 | Ga0496114_0409087 | 3300048917 | Bacteria | 1201 |
| 546 | Ga0496115_0006794 | 3300048918 | Bacteria | 8392 |
| 547 | Ga0496115_0059594 | 3300048918 | Bacteria | 3074 |
| 548 | Ga0496115_0065658 | 3300048918 | Bacteria | 2931 |
| 549 | Ga0496115_0095218 | 3300048918 | Bacteria | 2437 |
| 550 | Ga0496115_0134411 | 3300048918 | Bacteria | 2039 |
| 551 | Ga0496115_0184268 | 3300048918 | Bacteria | 1725 |
| 552 | Ga0496116_0004565 | 3300048919 | Bacteria | 13133 |
| 553 | Ga0496119_0001657 | 3300048922 | Bacteria | 26171 |
| 554 | Ga0496121_0023936 | 3300048924 | Bacteria | 5856 |
| 555 | Ga0496121_0119125 | 3300048924 | Bacteria | 1997 |
| 556 | Ga0496122_0000380 | 3300048925 | Bacteria | 95108 |
| 557 | Ga0496122_0006381 | 3300048925 | Bacteria | 13555 |
| 558 | Ga0496123_0000246 | 3300048926 | Bacteria | 109397 |
| 559 | Ga0496123_0010425 | 3300048926 | Bacteria | 8215 |
| 560 | Ga0496124_0011385 | 3300048927 | Bacteria | 8895 |
| 561 | Ga0496124_0185311 | 3300048927 | Bacteria | 1598 |
| 562 | Ga0496125_0004295 | 3300048928 | Bacteria | 16544 |
| 563 | Ga0496125_0373205 | 3300048928 | Bacteria | 843 |
| 564 | Ga0496126_0000196 | 3300048929 | Bacteria | 134394 |
| 565 | Ga0496126_0039177 | 3300048929 | Bacteria | 4400 |
| 566 | Ga0495682_0065720 | 3300049460 | Bacteria | 1307 |
| 567 | Ga0501047_0052386 | 3300049581 | Bacteria | 3945 |
| 568 | nmdc:mga03683_198085_c1 | 3300050489 | Bacteria | 921 |
| 569 | nmdc:mga03683_40724_c1 | 3300050489 | Bacteria | 1906 |
| 570 | nmdc:mga00v17_281619_c1 | 3300050491 | Bacteria | 1079 |
| 571 | nmdc:mga00v17_344773_c1 | 3300050491 | Bacteria | 968 |
| 572 | nmdc:mga00v17_3911_c1 | 3300050491 | Bacteria | 7683 |
| 573 | nmdc:mga07m45_49417_c1 | 3300050496 | Bacteria | 2367 |
| 574 | nmdc:mga0qj67_48287_c1 | 3300050509 | Bacteria | 3362 |
| 575 | nmdc:mga08y16_189044_c1 | 3300050511 | Bacteria | 2136 |
| 576 | nmdc:mga08y16_342139_c1 | 3300050511 | Unclassified | 1538 |
| 577 | nmdc:mga0n895_74802_c1 | 3300050512 | Bacteria | 3366 |
| 578 | nmdc:mga0rr50_66397_c1 | 3300050513 | Bacteria | 2737 |
| 579 | nmdc:mga08x19_375944_c1 | 3300050514 | Bacteria | 995 |
| 580 | nmdc:mga0a205_3532_c1 | 3300050515 | Bacteria | 13972 |
| 581 | nmdc:mga0sz30_1805_c1 | 3300050516 | Bacteria | 7610 |
| 582 | nmdc:mga0sz30_224576_c1 | 3300050516 | Bacteria | 835 |
| 583 | nmdc:mga0sz30_74973_c1 | 3300050516 | Bacteria | 1460 |
| 584 | Ga0500556_0004611 | 3300053104 | Bacteria | 3916 |
| 585 | Ga0466962_0107786 | 3300061719 | Bacteria | 1340 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100575515 | Ga0070714_1005755151 | 214 |
| 2 | 3300025945 | Ga0207679_10875081 | Ga0207679_108750812 | 220 |
| 3 | 3300005436 | Ga0070713_100674280 | Ga0070713_1006742802 | 222 |
| 4 | 3300047320 | Ga0495672_0106176 | Ga0495672_0106176_25_795 | 225 |
| 5 | 3300046501 | Ga0495607_0246863 | Ga0495607_0246863_67_837 | 226 |
| 6 | 3300046648 | Ga0495611_0113257 | Ga0495611_0113257_376_1146 | 226 |
| 7 | 3300047323 | Ga0495683_0040475 | Ga0495683_0040475_425_1195 | 226 |
| 8 | 3300045049 | Ga0466959_0115730 | Ga0466959_0115730_1014_1697 | 227 |
| 9 | 3300046459 | Ga0495629_0004420 | Ga0495629_0004420_9414_10184 | 227 |
| 10 | 3300046461 | Ga0495641_0022941 | Ga0495641_0022941_1916_2686 | 227 |
| 11 | 3300046472 | Ga0495580_0000889 | Ga0495580_0000889_13075_13845 | 227 |
| 12 | 3300046476 | Ga0495662_0039389 | Ga0495662_0039389_352_1122 | 227 |
| 13 | 3300046477 | Ga0495664_0003070 | Ga0495664_0003070_6132_6902 | 227 |
| 14 | 3300046514 | Ga0495618_0206167 | Ga0495618_0206167_337_1107 | 227 |
| 15 | 3300046516 | Ga0495628_0043558 | Ga0495628_0043558_2375_3145 | 227 |
| 16 | 3300046529 | Ga0495652_0004265 | Ga0495652_0004265_4002_4772 | 227 |
| 17 | 3300046531 | Ga0495665_0039793 | Ga0495665_0039793_619_1389 | 227 |
| 18 | 3300046535 | Ga0495586_0006562 | Ga0495586_0006562_3648_4418 | 227 |
| 19 | 3300046543 | Ga0495645_0005345 | Ga0495645_0005345_1794_2564 | 227 |
| 20 | 3300046665 | Ga0495661_0044842 | Ga0495661_0044842_588_1358 | 227 |
| 21 | 3300046679 | Ga0495623_0009365 | Ga0495623_0009365_604_1374 | 227 |
| 22 | 3300046680 | Ga0495646_0052827 | Ga0495646_0052827_587_1357 | 227 |
| 23 | 3300046690 | Ga0495624_0046131 | Ga0495624_0046131_1701_2471 | 227 |
| 24 | 3300047319 | Ga0495674_0123546 | Ga0495674_0123546_1115_1885 | 227 |
| 25 | 3300047322 | Ga0495680_0041319 | Ga0495680_0041319_524_1294 | 227 |
| 26 | 3300047446 | Ga0495679_005819 | Ga0495679_005819_4035_4805 | 227 |
| 27 | 3300047470 | Ga0495681_0048514 | Ga0495681_0048514_143_913 | 227 |
| 28 | 3300047471 | Ga0495684_0020901 | Ga0495684_0020901_2817_3587 | 227 |
| 29 | 3300035725 | Ga0373947_0544322 | Ga0373947_0544322_35_727 | 230 |
| 30 | 3300046507 | Ga0495606_0134456 | Ga0495606_0134456_70_840 | 230 |
| 31 | 3300046526 | Ga0495666_0003783 | Ga0495666_0003783_6947_7639 | 230 |
| 32 | 3300046533 | Ga0495640_0215281 | Ga0495640_0215281_316_1008 | 230 |
| 33 | 3300046535 | Ga0495586_0132771 | Ga0495586_0132771_509_1201 | 230 |
| 34 | 3300046535 | Ga0495586_0450966 | Ga0495586_0450966_35_727 | 230 |
| 35 | 3300046678 | Ga0495599_0271809 | Ga0495599_0271809_314_1006 | 230 |
| 36 | 3300048915 | Ga0496112_0024759 | Ga0496112_0024759_11_703 | 230 |
| 37 | 3300005445 | Ga0070708_100038177 | Ga0070708_1000381773 | 231 |
| 38 | 3300005468 | Ga0070707_100035129 | Ga0070707_1000351292 | 231 |
| 39 | 3300005518 | Ga0070699_100000237 | Ga0070699_1000002377 | 231 |
| 40 | 3300005536 | Ga0070697_100003854 | Ga0070697_1000038547 | 231 |
| 41 | 3300006028 | Ga0070717_10029509 | Ga0070717_100295092 | 231 |
| 42 | 3300025910 | Ga0207684_10018224 | Ga0207684_100182246 | 231 |
| 43 | 3300025922 | Ga0207646_10070221 | Ga0207646_100702213 | 231 |
| 44 | 3300046511 | Ga0495608_0151602 | Ga0495608_0151602_612_1310 | 232 |
| 45 | 3300047323 | Ga0495683_0018269 | Ga0495683_0018269_1699_2469 | 233 |
| 46 | 3300005937 | Ga0081455_10222990 | Ga0081455_102229902 | 234 |
| 47 | 3300046457 | Ga0495590_0006611 | Ga0495590_0006611_3263_4033 | 234 |
| 48 | 3300047446 | Ga0495679_000069 | Ga0495679_000069_31390_32160 | 234 |
| 49 | 3300046460 | Ga0495638_0003764 | Ga0495638_0003764_955_1725 | 235 |
| 50 | 3300046506 | Ga0495583_0004834 | Ga0495583_0004834_6696_7466 | 235 |
| 51 | 3300049460 | Ga0495682_0065720 | Ga0495682_0065720_63_833 | 235 |
| 52 | 3300046472 | Ga0495580_0049018 | Ga0495580_0049018_370_1140 | 236 |
| 53 | 3300046524 | Ga0495648_0020754 | Ga0495648_0020754_417_1187 | 236 |
| 54 | 3300046692 | Ga0495671_0043647 | Ga0495671_0043647_266_1036 | 236 |
| 55 | 3300046694 | Ga0495649_0015797 | Ga0495649_0015797_3384_4154 | 236 |
| 56 | 3300047320 | Ga0495672_0042143 | Ga0495672_0042143_489_1259 | 236 |
| 57 | 3300047469 | Ga0495673_0012297 | Ga0495673_0012297_3641_4411 | 236 |
| 58 | 3300005564 | Ga0070664_100164090 | Ga0070664_1001640902 | 237 |
| 59 | 3300009094 | Ga0111539_11061190 | Ga0111539_110611902 | 237 |
| 60 | 3300011119 | Ga0105246_10122539 | Ga0105246_101225392 | 237 |
| 61 | 3300013308 | Ga0157375_10694031 | Ga0157375_106940312 | 237 |
| 62 | 3300014968 | Ga0157379_10509829 | Ga0157379_105098292 | 237 |
| 63 | 3300026067 | Ga0207678_10096133 | Ga0207678_100961333 | 237 |
| 64 | 3300046474 | Ga0495605_0122949 | Ga0495605_0122949_153_923 | 237 |
| 65 | 3300050511 | nmdc:mga08y16_189044_c1 | nmdc:mga08y16_189044_c1_120_878 | 237 |
| 66 | 3300050489 | nmdc:mga03683_40724_c1 | nmdc:mga03683_40724_c1_300_1028 | 238 |
| 67 | 3300046679 | Ga0495623_0047090 | Ga0495623_0047090_755_1519 | 240 |
| 68 | 3300048916 | Ga0496113_0048282 | Ga0496113_0048282_276_1034 | 240 |
| 69 | iso_pu_bacteria | 2643221687 | 2644486073 | 241 |
| 70 | iso_pu_bacteria | 2902837492 | 2902840586 | 241 |
| 71 | 3300005981 | Ga0081538_10065032 | Ga0081538_100650322 | 242 |
| 72 | 3300046794 | Ga0495589_0272616 | Ga0495589_0272616_14_751 | 242 |
| 73 | 3300006051 | Ga0075364_10062636 | Ga0075364_100626362 | 245 |
| 74 | 3300006177 | Ga0075362_10234190 | Ga0075362_102341902 | 245 |
| 75 | 3300006186 | Ga0075369_10005201 | Ga0075369_100052014 | 245 |
| 76 | 3300006353 | Ga0075370_10045509 | Ga0075370_100455092 | 245 |
| 77 | 3300025303 | Ga0209051_1001907 | Ga0209051_100190715 | 245 |
| 78 | 3300025303 | Ga0209051_1002547 | Ga0209051_10025475 | 245 |
| 79 | 3300025303 | Ga0209051_1012164 | Ga0209051_10121642 | 245 |
| 80 | 3300025303 | Ga0209051_1023549 | Ga0209051_10235492 | 245 |
| 81 | 3300050489 | nmdc:mga03683_198085_c1 | nmdc:mga03683_198085_c1_159_896 | 245 |
| 82 | 3300050491 | nmdc:mga00v17_281619_c1 | nmdc:mga00v17_281619_c1_134_871 | 245 |
| 83 | 3300050496 | nmdc:mga07m45_49417_c1 | nmdc:mga07m45_49417_c1_327_1064 | 245 |
| 84 | 3300050516 | nmdc:mga0sz30_224576_c1 | nmdc:mga0sz30_224576_c1_41_778 | 245 |
| 85 | 3300050516 | nmdc:mga0sz30_74973_c1 | nmdc:mga0sz30_74973_c1_633_1370 | 245 |
| 86 | iso_pu_bacteria | 2643221715 | 2644639304 | 246 |
| 87 | iso_pu_bacteria | 2902810491 | 2902816136 | 246 |
| 88 | 3300025981 | Ga0207640_10275810 | Ga0207640_102758102 | 248 |
| 89 | 3300045976 | Ga0466967_0282195 | Ga0466967_0282195_785_1546 | 248 |
| 90 | iso_pu_bacteria | 2816332139 | 2816509355 | 248 |
| 91 | iso_pu_bacteria | 2501025501 | 2501072184 | 249 |
| 92 | iso_pu_bacteria | 2501025504 | 2501408873 | 249 |
| 93 | iso_pu_bacteria | 2510917014 | 2511098578 | 249 |
| 94 | iso_pu_bacteria | 2510917015 | 2511106394 | 249 |
| 95 | iso_pu_bacteria | 2513237166 | 2514053552 | 249 |
| 96 | iso_pu_bacteria | 2562617112 | 2563064824 | 249 |
| 97 | iso_pu_bacteria | 2711768613 | 2713482187 | 249 |
| 98 | iso_pu_bacteria | 2842134933 | 2842139770 | 249 |
| 99 | iso_pu_bacteria | 2842324504 | 2842325670 | 249 |
| 100 | iso_pu_bacteria | 2842333319 | 2842338091 | 249 |
| 101 | iso_pu_bacteria | 2842348783 | 2842349949 | 249 |
| 102 | iso_pu_bacteria | 2870782633 | 2870784935 | 249 |
| 103 | iso_pu_bacteria | 2917554339 | 2917555935 | 249 |
| 104 | iso_pu_bacteria | 2929212328 | 2929213553 | 249 |
| 105 | 3300006051 | Ga0075364_10019596 | Ga0075364_100195963 | 250 |
| 106 | 3300006186 | Ga0075369_10034553 | Ga0075369_100345532 | 250 |
| 107 | 3300031852 | Ga0307410_10252692 | Ga0307410_102526921 | 250 |
| 108 | 3300031901 | Ga0307406_10122425 | Ga0307406_101224252 | 250 |
| 109 | 3300041997 | Ga0439431_0014813 | Ga0439431_0014813_319_1071 | 250 |
| 110 | 3300042002 | Ga0439442_055461 | Ga0439442_055461_68_820 | 250 |
| 111 | 3300050491 | nmdc:mga00v17_3911_c1 | nmdc:mga00v17_3911_c1_5399_6151 | 250 |
| 112 | 3300005347 | Ga0070668_100073271 | Ga0070668_1000732712 | 251 |
| 113 | 3300005355 | Ga0070671_100003181 | Ga0070671_1000031818 | 251 |
| 114 | 3300005548 | Ga0070665_100015743 | Ga0070665_1000157433 | 251 |
| 115 | 3300005841 | Ga0068863_100063341 | Ga0068863_1000633412 | 251 |
| 116 | 3300025906 | Ga0207699_10389317 | Ga0207699_103893171 | 251 |
| 117 | 3300025931 | Ga0207644_10011665 | Ga0207644_100116652 | 251 |
| 118 | 3300025972 | Ga0207668_10089646 | Ga0207668_100896462 | 251 |
| 119 | 3300028379 | Ga0268266_10098914 | Ga0268266_100989143 | 251 |
| 120 | 3300046454 | Ga0495592_0005032 | Ga0495592_0005032_7172_7942 | 251 |
| 121 | 3300046458 | Ga0495591_000630 | Ga0495591_000630_5287_6057 | 251 |
| 122 | 3300046459 | Ga0495629_0073542 | Ga0495629_0073542_1114_1884 | 251 |
| 123 | 3300046462 | Ga0495651_0000569 | Ga0495651_0000569_4567_5337 | 251 |
| 124 | 3300046500 | Ga0495596_0009370 | Ga0495596_0009370_3326_4096 | 251 |
| 125 | 3300046511 | Ga0495608_0001673 | Ga0495608_0001673_6384_7154 | 251 |
| 126 | 3300046513 | Ga0495616_0219706 | Ga0495616_0219706_18_788 | 251 |
| 127 | 3300046516 | Ga0495628_0028776 | Ga0495628_0028776_3454_4224 | 251 |
| 128 | 3300046524 | Ga0495648_0021191 | Ga0495648_0021191_2670_3440 | 251 |
| 129 | 3300046533 | Ga0495640_0057415 | Ga0495640_0057415_1742_2512 | 251 |
| 130 | 3300046536 | Ga0495587_0054121 | Ga0495587_0054121_482_1252 | 251 |
| 131 | 3300046559 | Ga0495667_0027842 | Ga0495667_0027842_842_1612 | 251 |
| 132 | 3300046663 | Ga0495635_0218194 | Ga0495635_0218194_418_1188 | 251 |
| 133 | 3300046665 | Ga0495661_0051976 | Ga0495661_0051976_588_1358 | 251 |
| 134 | 3300046678 | Ga0495599_0066384 | Ga0495599_0066384_482_1252 | 251 |
| 135 | 3300046680 | Ga0495646_0036757 | Ga0495646_0036757_807_1577 | 251 |
| 136 | 3300046690 | Ga0495624_0007211 | Ga0495624_0007211_7009_7779 | 251 |
| 137 | 3300047317 | Ga0495604_0054452 | Ga0495604_0054452_1248_2018 | 251 |
| 138 | 3300047319 | Ga0495674_0282842 | Ga0495674_0282842_37_807 | 251 |
| 139 | 3300047321 | Ga0495676_0188857 | Ga0495676_0188857_91_861 | 251 |
| 140 | 3300047322 | Ga0495680_0166581 | Ga0495680_0166581_503_1273 | 251 |
| 141 | 3300047323 | Ga0495683_0024999 | Ga0495683_0024999_2182_2952 | 251 |
| 142 | 3300047446 | Ga0495679_036132 | Ga0495679_036132_256_1026 | 251 |
| 143 | 3300047469 | Ga0495673_0024129 | Ga0495673_0024129_374_1144 | 251 |
| 144 | 3300047673 | Ga0495593_0107578 | Ga0495593_0107578_619_1389 | 251 |
| 145 | 3300048088 | Ga0495602_0064400 | Ga0495602_0064400_1781_2551 | 251 |
| 146 | 3300005329 | Ga0070683_100082953 | Ga0070683_1000829534 | 252 |
| 147 | 3300005329 | Ga0070683_100119571 | Ga0070683_1001195712 | 252 |
| 148 | 3300005331 | Ga0070670_100333804 | Ga0070670_1003338041 | 252 |
| 149 | 3300005334 | Ga0068869_100078718 | Ga0068869_1000787182 | 252 |
| 150 | 3300005334 | Ga0068869_100141222 | Ga0068869_1001412223 | 252 |
| 151 | 3300005337 | Ga0070682_100402234 | Ga0070682_1004022341 | 252 |
| 152 | 3300005344 | Ga0070661_100354554 | Ga0070661_1003545541 | 252 |
| 153 | 3300005347 | Ga0070668_100157039 | Ga0070668_1001570392 | 252 |
| 154 | 3300005367 | Ga0070667_100438905 | Ga0070667_1004389052 | 252 |
| 155 | 3300005435 | Ga0070714_100001185 | Ga0070714_10000118510 | 252 |
| 156 | 3300005436 | Ga0070713_100001804 | Ga0070713_10000180412 | 252 |
| 157 | 3300005436 | Ga0070713_100198111 | Ga0070713_1001981112 | 252 |
| 158 | 3300005439 | Ga0070711_100216635 | Ga0070711_1002166352 | 252 |
| 159 | 3300005441 | Ga0070700_100101355 | Ga0070700_1001013552 | 252 |
| 160 | 3300005455 | Ga0070663_100391434 | Ga0070663_1003914342 | 252 |
| 161 | 3300005457 | Ga0070662_100188417 | Ga0070662_1001884172 | 252 |
| 162 | 3300005458 | Ga0070681_10192952 | Ga0070681_101929522 | 252 |
| 163 | 3300005459 | Ga0068867_100072537 | Ga0068867_1000725372 | 252 |
| 164 | 3300005466 | Ga0070685_10280615 | Ga0070685_102806151 | 252 |
| 165 | 3300005530 | Ga0070679_100030899 | Ga0070679_1000308994 | 252 |
| 166 | 3300005535 | Ga0070684_100076830 | Ga0070684_1000768302 | 252 |
| 167 | 3300005535 | Ga0070684_100177777 | Ga0070684_1001777772 | 252 |
| 168 | 3300005535 | Ga0070684_100894413 | Ga0070684_1008944131 | 252 |
| 169 | 3300005543 | Ga0070672_100405247 | Ga0070672_1004052472 | 252 |
| 170 | 3300005547 | Ga0070693_100127901 | Ga0070693_1001279012 | 252 |
| 171 | 3300005548 | Ga0070665_100141219 | Ga0070665_1001412192 | 252 |
| 172 | 3300005563 | Ga0068855_100208300 | Ga0068855_1002083002 | 252 |
| 173 | 3300005577 | Ga0068857_100081360 | Ga0068857_1000813602 | 252 |
| 174 | 3300005615 | Ga0070702_100116505 | Ga0070702_1001165051 | 252 |
| 175 | 3300005616 | Ga0068852_100511999 | Ga0068852_1005119992 | 252 |
| 176 | 3300005618 | Ga0068864_100821475 | Ga0068864_1008214752 | 252 |
| 177 | 3300005834 | Ga0068851_10009856 | Ga0068851_100098562 | 252 |
| 178 | 3300005840 | Ga0068870_10195462 | Ga0068870_101954622 | 252 |
| 179 | 3300005842 | Ga0068858_100439294 | Ga0068858_1004392942 | 252 |
| 180 | 3300005843 | Ga0068860_100145979 | Ga0068860_1001459793 | 252 |
| 181 | 3300006028 | Ga0070717_10139184 | Ga0070717_101391842 | 252 |
| 182 | 3300006880 | Ga0075429_100303347 | Ga0075429_1003033472 | 252 |
| 183 | 3300009093 | Ga0105240_10844755 | Ga0105240_108447552 | 252 |
| 184 | 3300009148 | Ga0105243_10071575 | Ga0105243_100715753 | 252 |
| 185 | 3300009176 | Ga0105242_10692930 | Ga0105242_106929302 | 252 |
| 186 | 3300009551 | Ga0105238_10135373 | Ga0105238_101353733 | 252 |
| 187 | 3300009553 | Ga0105249_10252977 | Ga0105249_102529772 | 252 |
| 188 | 3300010375 | Ga0105239_10041196 | Ga0105239_100411964 | 252 |
| 189 | 3300010375 | Ga0105239_10694977 | Ga0105239_106949771 | 252 |
| 190 | 3300013307 | Ga0157372_10048710 | Ga0157372_100487102 | 252 |
| 191 | 3300014745 | Ga0157377_10134231 | Ga0157377_101342312 | 252 |
| 192 | 3300017792 | Ga0163161_10230005 | Ga0163161_102300052 | 252 |
| 193 | 3300020077 | Ga0206351_10719505 | Ga0206351_107195051 | 252 |
| 194 | 3300020081 | Ga0206354_10719664 | Ga0206354_107196641 | 252 |
| 195 | 3300020082 | Ga0206353_10101519 | Ga0206353_101015191 | 252 |
| 196 | 3300022467 | Ga0224712_10084796 | Ga0224712_100847962 | 252 |
| 197 | 3300025901 | Ga0207688_10100635 | Ga0207688_101006351 | 252 |
| 198 | 3300025906 | Ga0207699_10309899 | Ga0207699_103098992 | 252 |
| 199 | 3300025915 | Ga0207693_10074595 | Ga0207693_100745953 | 252 |
| 200 | 3300025916 | Ga0207663_10233145 | Ga0207663_102331452 | 252 |
| 201 | 3300025919 | Ga0207657_10125487 | Ga0207657_101254872 | 252 |
| 202 | 3300025921 | Ga0207652_10019581 | Ga0207652_100195813 | 252 |
| 203 | 3300025923 | Ga0207681_10038738 | Ga0207681_100387382 | 252 |
| 204 | 3300025928 | Ga0207700_10021197 | Ga0207700_100211972 | 252 |
| 205 | 3300025928 | Ga0207700_10238913 | Ga0207700_102389131 | 252 |
| 206 | 3300025929 | Ga0207664_10096404 | Ga0207664_100964043 | 252 |
| 207 | 3300025929 | Ga0207664_10099851 | Ga0207664_100998513 | 252 |
| 208 | 3300025935 | Ga0207709_10238266 | Ga0207709_102382661 | 252 |
| 209 | 3300025937 | Ga0207669_10049241 | Ga0207669_100492414 | 252 |
| 210 | 3300025938 | Ga0207704_10177122 | Ga0207704_101771221 | 252 |
| 211 | 3300025940 | Ga0207691_10516658 | Ga0207691_105166581 | 252 |
| 212 | 3300025941 | Ga0207711_10223608 | Ga0207711_102236082 | 252 |
| 213 | 3300025944 | Ga0207661_10159207 | Ga0207661_101592073 | 252 |
| 214 | 3300025961 | Ga0207712_10090400 | Ga0207712_100904002 | 252 |
| 215 | 3300025972 | Ga0207668_10421938 | Ga0207668_104219382 | 252 |
| 216 | 3300025981 | Ga0207640_10061175 | Ga0207640_100611752 | 252 |
| 217 | 3300026023 | Ga0207677_10453876 | Ga0207677_104538762 | 252 |
| 218 | 3300026067 | Ga0207678_10100179 | Ga0207678_101001792 | 252 |
| 219 | 3300026067 | Ga0207678_10550602 | Ga0207678_105506022 | 252 |
| 220 | 3300026075 | Ga0207708_10029199 | Ga0207708_100291993 | 252 |
| 221 | 3300026078 | Ga0207702_10989848 | Ga0207702_109898481 | 252 |
| 222 | 3300026095 | Ga0207676_10231117 | Ga0207676_102311172 | 252 |
| 223 | 3300026116 | Ga0207674_10107378 | Ga0207674_101073782 | 252 |
| 224 | 3300027907 | Ga0207428_10247983 | Ga0207428_102479832 | 252 |
| 225 | 3300028379 | Ga0268266_10119028 | Ga0268266_101190283 | 252 |
| 226 | 3300028380 | Ga0268265_10115172 | Ga0268265_101151722 | 252 |
| 227 | 3300028381 | Ga0268264_10286878 | Ga0268264_102868782 | 252 |
| 228 | 3300028563 | Ga0265319_1002788 | Ga0265319_10027885 | 252 |
| 229 | 3300028573 | Ga0265334_10007367 | Ga0265334_100073672 | 252 |
| 230 | 3300028654 | Ga0265322_10015169 | Ga0265322_100151692 | 252 |
| 231 | 3300028800 | Ga0265338_10001289 | Ga0265338_100012893 | 252 |
| 232 | 3300029957 | Ga0265324_10003207 | Ga0265324_100032074 | 252 |
| 233 | 3300031238 | Ga0265332_10002488 | Ga0265332_100024884 | 252 |
| 234 | 3300031240 | Ga0265320_10021590 | Ga0265320_100215903 | 252 |
| 235 | 3300031249 | Ga0265339_10019095 | Ga0265339_100190953 | 252 |
| 236 | 3300031344 | Ga0265316_10138018 | Ga0265316_101380182 | 252 |
| 237 | 3300031595 | Ga0265313_10020870 | Ga0265313_100208703 | 252 |
| 238 | 3300031711 | Ga0265314_10273180 | Ga0265314_102731802 | 252 |
| 239 | 3300031712 | Ga0265342_10006091 | Ga0265342_100060914 | 252 |
| 240 | 3300039437 | Ga0436365_0428073 | Ga0436365_0428073_228_986 | 252 |
| 241 | 3300039437 | Ga0436365_1432981 | Ga0436365_1432981_426_1184 | 252 |
| 242 | 3300044694 | Ga0466963_0033591 | Ga0466963_0033591_1779_2537 | 252 |
| 243 | 3300045976 | Ga0466967_0158852 | Ga0466967_0158852_1135_1893 | 252 |
| 244 | 3300045976 | Ga0466967_0424557 | Ga0466967_0424557_394_1152 | 252 |
| 245 | 3300046515 | Ga0495620_0048889 | Ga0495620_0048889_411_1169 | 252 |
| 246 | 3300048904 | Ga0496101_0199918 | Ga0496101_0199918_737_1495 | 252 |
| 247 | 3300048911 | Ga0496108_0559784 | Ga0496108_0559784_212_970 | 252 |
| 248 | 3300048917 | Ga0496114_0372622 | Ga0496114_0372622_382_1140 | 252 |
| 249 | 3300048918 | Ga0496115_0184268 | Ga0496115_0184268_524_1282 | 252 |
| 250 | 3300048929 | Ga0496126_0039177 | Ga0496126_0039177_92_850 | 252 |
| 251 | 3300061719 | Ga0466962_0107786 | Ga0466962_0107786_546_1304 | 252 |
| 252 | 3300001990 | JGI24737J22298_10016105 | JGI24737J22298_100161052 | 253 |
| 253 | 3300003320 | rootH2_10109253 | rootH2_101092533 | 253 |
| 254 | 3300005327 | Ga0070658_10356654 | Ga0070658_103566541 | 253 |
| 255 | 3300005334 | Ga0068869_100056219 | Ga0068869_1000562193 | 253 |
| 256 | 3300005335 | Ga0070666_10311989 | Ga0070666_103119892 | 253 |
| 257 | 3300005337 | Ga0070682_100227107 | Ga0070682_1002271072 | 253 |
| 258 | 3300005338 | Ga0068868_100161719 | Ga0068868_1001617192 | 253 |
| 259 | 3300005339 | Ga0070660_100151201 | Ga0070660_1001512012 | 253 |
| 260 | 3300005341 | Ga0070691_10020329 | Ga0070691_100203292 | 253 |
| 261 | 3300005343 | Ga0070687_100071458 | Ga0070687_1000714582 | 253 |
| 262 | 3300005345 | Ga0070692_10070893 | Ga0070692_100708931 | 253 |
| 263 | 3300005347 | Ga0070668_100025190 | Ga0070668_1000251904 | 253 |
| 264 | 3300005364 | Ga0070673_100256280 | Ga0070673_1002562801 | 253 |
| 265 | 3300005366 | Ga0070659_100048061 | Ga0070659_1000480612 | 253 |
| 266 | 3300005367 | Ga0070667_100078297 | Ga0070667_1000782973 | 253 |
| 267 | 3300005434 | Ga0070709_10002092 | Ga0070709_100020924 | 253 |
| 268 | 3300005435 | Ga0070714_100115010 | Ga0070714_1001150103 | 253 |
| 269 | 3300005435 | Ga0070714_100450616 | Ga0070714_1004506162 | 253 |
| 270 | 3300005436 | Ga0070713_100184129 | Ga0070713_1001841292 | 253 |
| 271 | 3300005436 | Ga0070713_100472323 | Ga0070713_1004723231 | 253 |
| 272 | 3300005437 | Ga0070710_10019981 | Ga0070710_100199813 | 253 |
| 273 | 3300005437 | Ga0070710_10102981 | Ga0070710_101029813 | 253 |
| 274 | 3300005437 | Ga0070710_10205154 | Ga0070710_102051542 | 253 |
| 275 | 3300005439 | Ga0070711_100007080 | Ga0070711_1000070803 | 253 |
| 276 | 3300005440 | Ga0070705_100020359 | Ga0070705_1000203591 | 253 |
| 277 | 3300005444 | Ga0070694_100110753 | Ga0070694_1001107531 | 253 |
| 278 | 3300005445 | Ga0070708_100085770 | Ga0070708_1000857702 | 253 |
| 279 | 3300005445 | Ga0070708_100525656 | Ga0070708_1005256562 | 253 |
| 280 | 3300005455 | Ga0070663_100025673 | Ga0070663_1000256733 | 253 |
| 281 | 3300005456 | Ga0070678_100103384 | Ga0070678_1001033842 | 253 |
| 282 | 3300005456 | Ga0070678_100341240 | Ga0070678_1003412401 | 253 |
| 283 | 3300005456 | Ga0070678_100403105 | Ga0070678_1004031051 | 253 |
| 284 | 3300005457 | Ga0070662_100097191 | Ga0070662_1000971913 | 253 |
| 285 | 3300005466 | Ga0070685_10422067 | Ga0070685_104220671 | 253 |
| 286 | 3300005539 | Ga0068853_100139895 | Ga0068853_1001398952 | 253 |
| 287 | 3300005548 | Ga0070665_100401019 | Ga0070665_1004010192 | 253 |
| 288 | 3300005563 | Ga0068855_100084353 | Ga0068855_1000843532 | 253 |
| 289 | 3300005577 | Ga0068857_100231619 | Ga0068857_1002316191 | 253 |
| 290 | 3300005578 | Ga0068854_100080106 | Ga0068854_1000801062 | 253 |
| 291 | 3300005614 | Ga0068856_100054377 | Ga0068856_1000543773 | 253 |
| 292 | 3300005615 | Ga0070702_100004665 | Ga0070702_1000046651 | 253 |
| 293 | 3300005615 | Ga0070702_100186383 | Ga0070702_1001863832 | 253 |
| 294 | 3300005617 | Ga0068859_100289242 | Ga0068859_1002892421 | 253 |
| 295 | 3300005618 | Ga0068864_100655511 | Ga0068864_1006555112 | 253 |
| 296 | 3300005719 | Ga0068861_100075641 | Ga0068861_1000756413 | 253 |
| 297 | 3300005840 | Ga0068870_10360697 | Ga0068870_103606971 | 253 |
| 298 | 3300005841 | Ga0068863_100000320 | Ga0068863_1000003205 | 253 |
| 299 | 3300005841 | Ga0068863_100537142 | Ga0068863_1005371422 | 253 |
| 300 | 3300005842 | Ga0068858_100214516 | Ga0068858_1002145163 | 253 |
| 301 | 3300005843 | Ga0068860_100379301 | Ga0068860_1003793012 | 253 |
| 302 | 3300005937 | Ga0081455_10013471 | Ga0081455_100134714 | 253 |
| 303 | 3300005983 | Ga0081540_1030190 | Ga0081540_10301903 | 253 |
| 304 | 3300005983 | Ga0081540_1047338 | Ga0081540_10473381 | 253 |
| 305 | 3300006028 | Ga0070717_10018722 | Ga0070717_100187225 | 253 |
| 306 | 3300006038 | Ga0075365_10065250 | Ga0075365_100652501 | 253 |
| 307 | 3300006048 | Ga0075363_100094975 | Ga0075363_1000949752 | 253 |
| 308 | 3300006173 | Ga0070716_100081181 | Ga0070716_1000811811 | 253 |
| 309 | 3300006175 | Ga0070712_100014211 | Ga0070712_1000142114 | 253 |
| 310 | 3300006175 | Ga0070712_100278544 | Ga0070712_1002785442 | 253 |
| 311 | 3300006186 | Ga0075369_10004933 | Ga0075369_100049334 | 253 |
| 312 | 3300006237 | Ga0097621_100141378 | Ga0097621_1001413782 | 253 |
| 313 | 3300006358 | Ga0068871_100233012 | Ga0068871_1002330122 | 253 |
| 314 | 3300006844 | Ga0075428_100442141 | Ga0075428_1004421412 | 253 |
| 315 | 3300006846 | Ga0075430_100109919 | Ga0075430_1001099192 | 253 |
| 316 | 3300006847 | Ga0075431_100302135 | Ga0075431_1003021352 | 253 |
| 317 | 3300006871 | Ga0075434_100081295 | Ga0075434_1000812952 | 253 |
| 318 | 3300006914 | Ga0075436_100026820 | Ga0075436_1000268202 | 253 |
| 319 | 3300006931 | Ga0097620_100289238 | Ga0097620_1002892383 | 253 |
| 320 | 3300007076 | Ga0075435_100017648 | Ga0075435_1000176484 | 253 |
| 321 | 3300009011 | Ga0105251_10000902 | Ga0105251_1000090215 | 253 |
| 322 | 3300009011 | Ga0105251_10027728 | Ga0105251_100277282 | 253 |
| 323 | 3300009036 | Ga0105244_10032435 | Ga0105244_100324354 | 253 |
| 324 | 3300009036 | Ga0105244_10124038 | Ga0105244_101240381 | 253 |
| 325 | 3300009093 | Ga0105240_10058935 | Ga0105240_100589354 | 253 |
| 326 | 3300009094 | Ga0111539_10033925 | Ga0111539_100339252 | 253 |
| 327 | 3300009094 | Ga0111539_10072207 | Ga0111539_100722073 | 253 |
| 328 | 3300009094 | Ga0111539_10082922 | Ga0111539_100829221 | 253 |
| 329 | 3300009098 | Ga0105245_10033190 | Ga0105245_100331903 | 253 |
| 330 | 3300009098 | Ga0105245_10085728 | Ga0105245_100857282 | 253 |
| 331 | 3300009101 | Ga0105247_10077192 | Ga0105247_100771922 | 253 |
| 332 | 3300009174 | Ga0105241_10334246 | Ga0105241_103342461 | 253 |
| 333 | 3300009177 | Ga0105248_10177217 | Ga0105248_101772172 | 253 |
| 334 | 3300009177 | Ga0105248_11051674 | Ga0105248_110516742 | 253 |
| 335 | 3300009545 | Ga0105237_10086252 | Ga0105237_100862522 | 253 |
| 336 | 3300009545 | Ga0105237_10429198 | Ga0105237_104291982 | 253 |
| 337 | 3300009551 | Ga0105238_10111356 | Ga0105238_101113562 | 253 |
| 338 | 3300009551 | Ga0105238_10116795 | Ga0105238_101167952 | 253 |
| 339 | 3300009553 | Ga0105249_10114196 | Ga0105249_101141962 | 253 |
| 340 | 3300010375 | Ga0105239_10033883 | Ga0105239_100338837 | 253 |
| 341 | 3300011119 | Ga0105246_10064761 | Ga0105246_100647613 | 253 |
| 342 | 3300011119 | Ga0105246_10396758 | Ga0105246_103967581 | 253 |
| 343 | 3300011119 | Ga0105246_10625588 | Ga0105246_106255881 | 253 |
| 344 | 3300013104 | Ga0157370_10018423 | Ga0157370_100184232 | 253 |
| 345 | 3300013105 | Ga0157369_10096818 | Ga0157369_100968183 | 253 |
| 346 | 3300013105 | Ga0157369_10506337 | Ga0157369_105063372 | 253 |
| 347 | 3300013296 | Ga0157374_10096969 | Ga0157374_100969692 | 253 |
| 348 | 3300013297 | Ga0157378_10229363 | Ga0157378_102293632 | 253 |
| 349 | 3300013306 | Ga0163162_10002167 | Ga0163162_100021676 | 253 |
| 350 | 3300013306 | Ga0163162_10166125 | Ga0163162_101661253 | 253 |
| 351 | 3300013306 | Ga0163162_10506486 | Ga0163162_105064862 | 253 |
| 352 | 3300013306 | Ga0163162_10513047 | Ga0163162_105130472 | 253 |
| 353 | 3300013307 | Ga0157372_10032275 | Ga0157372_100322754 | 253 |
| 354 | 3300013307 | Ga0157372_10898565 | Ga0157372_108985651 | 253 |
| 355 | 3300013308 | Ga0157375_10011549 | Ga0157375_100115497 | 253 |
| 356 | 3300013308 | Ga0157375_10198382 | Ga0157375_101983822 | 253 |
| 357 | 3300013308 | Ga0157375_10250147 | Ga0157375_102501472 | 253 |
| 358 | 3300013308 | Ga0157375_10800285 | Ga0157375_108002852 | 253 |
| 359 | 3300014325 | Ga0163163_10417551 | Ga0163163_104175512 | 253 |
| 360 | 3300014968 | Ga0157379_10172659 | Ga0157379_101726592 | 253 |
| 361 | 3300014969 | Ga0157376_10470653 | Ga0157376_104706532 | 253 |
| 362 | 3300014969 | Ga0157376_10473912 | Ga0157376_104739122 | 253 |
| 363 | 3300016635 | Ga0183361_10004 | Ga0183361_10004281 | 253 |
| 364 | 3300017792 | Ga0163161_10026821 | Ga0163161_100268213 | 253 |
| 365 | 3300021388 | Ga0213875_10002693 | Ga0213875_1000269310 | 253 |
| 366 | 3300024225 | Ga0224572_1010853 | Ga0224572_10108532 | 253 |
| 367 | 3300025256 | Ga0209759_1000130 | Ga0209759_1000130122 | 253 |
| 368 | 3300025302 | Ga0207426_1001241 | Ga0207426_100124110 | 253 |
| 369 | 3300025728 | Ga0207655_1038919 | Ga0207655_10389192 | 253 |
| 370 | 3300025735 | Ga0207713_1002952 | Ga0207713_10029527 | 253 |
| 371 | 3300025735 | Ga0207713_1024454 | Ga0207713_10244543 | 253 |
| 372 | 3300025898 | Ga0207692_10088344 | Ga0207692_100883443 | 253 |
| 373 | 3300025899 | Ga0207642_10197446 | Ga0207642_101974462 | 253 |
| 374 | 3300025900 | Ga0207710_10214137 | Ga0207710_102141371 | 253 |
| 375 | 3300025901 | Ga0207688_10006956 | Ga0207688_100069564 | 253 |
| 376 | 3300025901 | Ga0207688_10191398 | Ga0207688_101913981 | 253 |
| 377 | 3300025904 | Ga0207647_10021916 | Ga0207647_100219162 | 253 |
| 378 | 3300025909 | Ga0207705_10286833 | Ga0207705_102868332 | 253 |
| 379 | 3300025911 | Ga0207654_10211947 | Ga0207654_102119472 | 253 |
| 380 | 3300025911 | Ga0207654_10258287 | Ga0207654_102582872 | 253 |
| 381 | 3300025911 | Ga0207654_10288108 | Ga0207654_102881082 | 253 |
| 382 | 3300025914 | Ga0207671_10097575 | Ga0207671_100975752 | 253 |
| 383 | 3300025915 | Ga0207693_10002076 | Ga0207693_1000207610 | 253 |
| 384 | 3300025915 | Ga0207693_10263939 | Ga0207693_102639392 | 253 |
| 385 | 3300025916 | Ga0207663_10053772 | Ga0207663_100537723 | 253 |
| 386 | 3300025916 | Ga0207663_10349658 | Ga0207663_103496582 | 253 |
| 387 | 3300025924 | Ga0207694_10061792 | Ga0207694_100617924 | 253 |
| 388 | 3300025927 | Ga0207687_10051953 | Ga0207687_100519532 | 253 |
| 389 | 3300025927 | Ga0207687_10487138 | Ga0207687_104871381 | 253 |
| 390 | 3300025928 | Ga0207700_10061437 | Ga0207700_100614373 | 253 |
| 391 | 3300025928 | Ga0207700_10066166 | Ga0207700_100661662 | 253 |
| 392 | 3300025928 | Ga0207700_10378001 | Ga0207700_103780012 | 253 |
| 393 | 3300025929 | Ga0207664_10042292 | Ga0207664_100422923 | 253 |
| 394 | 3300025929 | Ga0207664_10132215 | Ga0207664_101322152 | 253 |
| 395 | 3300025932 | Ga0207690_10034738 | Ga0207690_100347382 | 253 |
| 396 | 3300025935 | Ga0207709_10073548 | Ga0207709_100735482 | 253 |
| 397 | 3300025936 | Ga0207670_10085351 | Ga0207670_100853512 | 253 |
| 398 | 3300025939 | Ga0207665_10000414 | Ga0207665_1000041416 | 253 |
| 399 | 3300025941 | Ga0207711_10117197 | Ga0207711_101171972 | 253 |
| 400 | 3300025941 | Ga0207711_10302704 | Ga0207711_103027042 | 253 |
| 401 | 3300025942 | Ga0207689_10293646 | Ga0207689_102936461 | 253 |
| 402 | 3300025949 | Ga0207667_10187380 | Ga0207667_101873802 | 253 |
| 403 | 3300025960 | Ga0207651_10119302 | Ga0207651_101193022 | 253 |
| 404 | 3300025961 | Ga0207712_10026482 | Ga0207712_100264822 | 253 |
| 405 | 3300025961 | Ga0207712_10043019 | Ga0207712_100430194 | 253 |
| 406 | 3300025972 | Ga0207668_10017140 | Ga0207668_100171403 | 253 |
| 407 | 3300025981 | Ga0207640_10048055 | Ga0207640_100480552 | 253 |
| 408 | 3300025986 | Ga0207658_10061822 | Ga0207658_100618223 | 253 |
| 409 | 3300026023 | Ga0207677_10286223 | Ga0207677_102862232 | 253 |
| 410 | 3300026035 | Ga0207703_10161545 | Ga0207703_101615451 | 253 |
| 411 | 3300026041 | Ga0207639_10145589 | Ga0207639_101455892 | 253 |
| 412 | 3300026067 | Ga0207678_10026393 | Ga0207678_100263934 | 253 |
| 413 | 3300026067 | Ga0207678_10028607 | Ga0207678_100286073 | 253 |
| 414 | 3300026075 | Ga0207708_10052679 | Ga0207708_100526793 | 253 |
| 415 | 3300026078 | Ga0207702_10445456 | Ga0207702_104454561 | 253 |
| 416 | 3300026088 | Ga0207641_10003778 | Ga0207641_1000377810 | 253 |
| 417 | 3300026088 | Ga0207641_10178611 | Ga0207641_101786113 | 253 |
| 418 | 3300026095 | Ga0207676_10195292 | Ga0207676_101952922 | 253 |
| 419 | 3300026095 | Ga0207676_10303552 | Ga0207676_103035522 | 253 |
| 420 | 3300026118 | Ga0207675_100010336 | Ga0207675_1000103363 | 253 |
| 421 | 3300026121 | Ga0207683_10039903 | Ga0207683_100399031 | 253 |
| 422 | 3300026121 | Ga0207683_10047866 | Ga0207683_100478662 | 253 |
| 423 | 3300026121 | Ga0207683_10152687 | Ga0207683_101526872 | 253 |
| 424 | 3300026121 | Ga0207683_10619361 | Ga0207683_106193611 | 253 |
| 425 | 3300027907 | Ga0207428_10065580 | Ga0207428_100655802 | 253 |
| 426 | 3300027907 | Ga0207428_10151493 | Ga0207428_101514932 | 253 |
| 427 | 3300028379 | Ga0268266_10226306 | Ga0268266_102263061 | 253 |
| 428 | 3300028379 | Ga0268266_10265125 | Ga0268266_102651251 | 253 |
| 429 | 3300028379 | Ga0268266_10543405 | Ga0268266_105434051 | 253 |
| 430 | 3300028381 | Ga0268264_10583328 | Ga0268264_105833281 | 253 |
| 431 | 3300031548 | Ga0307408_100004673 | Ga0307408_1000046735 | 253 |
| 432 | 3300031731 | Ga0307405_10019951 | Ga0307405_100199512 | 253 |
| 433 | 3300031852 | Ga0307410_10273666 | Ga0307410_102736662 | 253 |
| 434 | 3300031911 | Ga0307412_10036248 | Ga0307412_100362484 | 253 |
| 435 | 3300032002 | Ga0307416_100080927 | Ga0307416_1000809272 | 253 |
| 436 | 3300032005 | Ga0307411_10136856 | Ga0307411_101368562 | 253 |
| 437 | 3300032005 | Ga0307411_10252807 | Ga0307411_102528072 | 253 |
| 438 | 3300034816 | Ga0373930_0002507 | Ga0373930_0002507_1560_2321 | 253 |
| 439 | 3300035114 | Ga0373939_0001572 | Ga0373939_0001572_545_1306 | 253 |
| 440 | 3300035115 | Ga0373941_0001653 | Ga0373941_0001653_214_975 | 253 |
| 441 | 3300035121 | Ga0373960_0009273 | Ga0373960_0009273_962_1723 | 253 |
| 442 | 3300035207 | Ga0373942_0006729 | Ga0373942_0006729_729_1490 | 253 |
| 443 | 3300035242 | Ga0373962_0087105 | Ga0373962_0087105_37_798 | 253 |
| 444 | 3300035398 | Ga0316574_0023165 | Ga0316574_0023165_369_1130 | 253 |
| 445 | 3300035691 | Ga0373931_0006681 | Ga0373931_0006681_2569_3330 | 253 |
| 446 | 3300035692 | Ga0373935_0129525 | Ga0373935_0129525_417_1178 | 253 |
| 447 | 3300035692 | Ga0373935_0133067 | Ga0373935_0133067_600_1361 | 253 |
| 448 | 3300035724 | Ga0373933_0172526 | Ga0373933_0172526_293_1054 | 253 |
| 449 | 3300035725 | Ga0373947_0226159 | Ga0373947_0226159_136_897 | 253 |
| 450 | 3300036401 | Ga0373937_0139628 | Ga0373937_0139628_342_1130 | 253 |
| 451 | 3300037068 | Ga0373925_0106141 | Ga0373925_0106141_900_1661 | 253 |
| 452 | 3300037471 | Ga0395905_0044417 | Ga0395905_0044417_550_1314 | 253 |
| 453 | 3300037853 | Ga0436364_0324998 | Ga0436364_0324998_18855_19616 | 253 |
| 454 | 3300039437 | Ga0436365_0659902 | Ga0436365_0659902_145_906 | 253 |
| 455 | 3300039453 | Ga0436362_0843181 | Ga0436362_0843181_984_1745 | 253 |
| 456 | 3300041411 | Ga0439466_0011317 | Ga0439466_0011317_1408_2169 | 253 |
| 457 | 3300041413 | Ga0439465_0021859 | Ga0439465_0021859_307_1068 | 253 |
| 458 | 3300042008 | Ga0439450_016451 | Ga0439450_016451_60_821 | 253 |
| 459 | 3300042876 | Ga0451577_0011794 | Ga0451577_0011794_6955_7740 | 253 |
| 460 | 3300042876 | Ga0451577_0378210 | Ga0451577_0378210_371_1132 | 253 |
| 461 | 3300044693 | Ga0466961_0136827 | Ga0466961_0136827_717_1487 | 253 |
| 462 | 3300044694 | Ga0466963_0000820 | Ga0466963_0000820_6815_7576 | 253 |
| 463 | 3300044694 | Ga0466963_0043943 | Ga0466963_0043943_1670_2515 | 253 |
| 464 | 3300044712 | Ga0453684_0170855 | Ga0453684_0170855_440_1225 | 253 |
| 465 | 3300044712 | Ga0453684_0817112 | Ga0453684_0817112_100_861 | 253 |
| 466 | 3300044765 | Ga0466970_0155951 | Ga0466970_0155951_71_841 | 253 |
| 467 | 3300044842 | Ga0466957_0200434 | Ga0466957_0200434_135_905 | 253 |
| 468 | 3300045051 | Ga0451576_0113444 | Ga0451576_0113444_1871_2632 | 253 |
| 469 | 3300045836 | Ga0466958_0057561 | Ga0466958_0057561_163_933 | 253 |
| 470 | 3300045976 | Ga0466967_0030783 | Ga0466967_0030783_2029_2790 | 253 |
| 471 | 3300045976 | Ga0466967_0049170 | Ga0466967_0049170_1847_2692 | 253 |
| 472 | 3300045976 | Ga0466967_0190374 | Ga0466967_0190374_777_1538 | 253 |
| 473 | 3300046454 | Ga0495592_0078911 | Ga0495592_0078911_1133_1894 | 253 |
| 474 | 3300046455 | Ga0495603_0023699 | Ga0495603_0023699_1423_2193 | 253 |
| 475 | 3300046455 | Ga0495603_0217355 | Ga0495603_0217355_246_1007 | 253 |
| 476 | 3300046457 | Ga0495590_0001075 | Ga0495590_0001075_6952_7716 | 253 |
| 477 | 3300046458 | Ga0495591_071276 | Ga0495591_071276_48_818 | 253 |
| 478 | 3300046459 | Ga0495629_0001892 | Ga0495629_0001892_6574_7344 | 253 |
| 479 | 3300046460 | Ga0495638_0005628 | Ga0495638_0005628_5193_5963 | 253 |
| 480 | 3300046463 | Ga0495653_0029572 | Ga0495653_0029572_529_1299 | 253 |
| 481 | 3300046463 | Ga0495653_0237896 | Ga0495653_0237896_295_1056 | 253 |
| 482 | 3300046472 | Ga0495580_0004799 | Ga0495580_0004799_1581_2351 | 253 |
| 483 | 3300046473 | Ga0495582_0076703 | Ga0495582_0076703_45_815 | 253 |
| 484 | 3300046474 | Ga0495605_0002296 | Ga0495605_0002296_10488_11258 | 253 |
| 485 | 3300046474 | Ga0495605_0078190 | Ga0495605_0078190_40_804 | 253 |
| 486 | 3300046477 | Ga0495664_0019767 | Ga0495664_0019767_2134_2895 | 253 |
| 487 | 3300046500 | Ga0495596_0075667 | Ga0495596_0075667_130_900 | 253 |
| 488 | 3300046501 | Ga0495607_0006590 | Ga0495607_0006590_2137_2907 | 253 |
| 489 | 3300046516 | Ga0495628_0048363 | Ga0495628_0048363_2172_2936 | 253 |
| 490 | 3300046516 | Ga0495628_0203979 | Ga0495628_0203979_147_908 | 253 |
| 491 | 3300046517 | Ga0495630_0054576 | Ga0495630_0054576_1082_1846 | 253 |
| 492 | 3300046517 | Ga0495630_0177780 | Ga0495630_0177780_301_1062 | 253 |
| 493 | 3300046518 | Ga0495631_0139050 | Ga0495631_0139050_231_1001 | 253 |
| 494 | 3300046523 | Ga0495644_0025944 | Ga0495644_0025944_851_1621 | 253 |
| 495 | 3300046524 | Ga0495648_0006835 | Ga0495648_0006835_8025_8795 | 253 |
| 496 | 3300046524 | Ga0495648_0042187 | Ga0495648_0042187_199_969 | 253 |
| 497 | 3300046526 | Ga0495666_0030226 | Ga0495666_0030226_389_1153 | 253 |
| 498 | 3300046528 | Ga0495642_0015321 | Ga0495642_0015321_1233_2003 | 253 |
| 499 | 3300046529 | Ga0495652_0021421 | Ga0495652_0021421_2430_3194 | 253 |
| 500 | 3300046529 | Ga0495652_0308960 | Ga0495652_0308960_268_1029 | 253 |
| 501 | 3300046531 | Ga0495665_0104725 | Ga0495665_0104725_327_1097 | 253 |
| 502 | 3300046542 | Ga0495597_0003843 | Ga0495597_0003843_4204_4968 | 253 |
| 503 | 3300046543 | Ga0495645_0032852 | Ga0495645_0032852_939_1700 | 253 |
| 504 | 3300046559 | Ga0495667_0116493 | Ga0495667_0116493_193_954 | 253 |
| 505 | 3300046648 | Ga0495611_0077346 | Ga0495611_0077346_745_1515 | 253 |
| 506 | 3300046660 | Ga0495625_0086052 | Ga0495625_0086052_1040_1810 | 253 |
| 507 | 3300046678 | Ga0495599_0010836 | Ga0495599_0010836_1994_2758 | 253 |
| 508 | 3300046678 | Ga0495599_0107325 | Ga0495599_0107325_405_1166 | 253 |
| 509 | 3300046679 | Ga0495623_0002549 | Ga0495623_0002549_7153_7923 | 253 |
| 510 | 3300046680 | Ga0495646_0053918 | Ga0495646_0053918_419_1183 | 253 |
| 511 | 3300046680 | Ga0495646_0194727 | Ga0495646_0194727_327_1088 | 253 |
| 512 | 3300046690 | Ga0495624_0001835 | Ga0495624_0001835_6487_7257 | 253 |
| 513 | 3300046690 | Ga0495624_0007632 | Ga0495624_0007632_2732_3496 | 253 |
| 514 | 3300046690 | Ga0495624_0185128 | Ga0495624_0185128_151_912 | 253 |
| 515 | 3300046794 | Ga0495589_0004936 | Ga0495589_0004936_3079_3849 | 253 |
| 516 | 3300046794 | Ga0495589_0041963 | Ga0495589_0041963_568_1332 | 253 |
| 517 | 3300046810 | Ga0495660_0088867 | Ga0495660_0088867_388_1158 | 253 |
| 518 | 3300047317 | Ga0495604_0006195 | Ga0495604_0006195_2380_3144 | 253 |
| 519 | 3300047317 | Ga0495604_0022967 | Ga0495604_0022967_187_957 | 253 |
| 520 | 3300047317 | Ga0495604_0329986 | Ga0495604_0329986_174_935 | 253 |
| 521 | 3300047319 | Ga0495674_0003086 | Ga0495674_0003086_6479_7249 | 253 |
| 522 | 3300047319 | Ga0495674_0089728 | Ga0495674_0089728_247_1008 | 253 |
| 523 | 3300047322 | Ga0495680_0022210 | Ga0495680_0022210_119_883 | 253 |
| 524 | 3300047323 | Ga0495683_0002778 | Ga0495683_0002778_2653_3417 | 253 |
| 525 | 3300047470 | Ga0495681_0008254 | Ga0495681_0008254_3147_3917 | 253 |
| 526 | 3300047471 | Ga0495684_0037263 | Ga0495684_0037263_1514_2278 | 253 |
| 527 | 3300047472 | Ga0495686_0000048 | Ga0495686_0000048_139615_140379 | 253 |
| 528 | 3300047472 | Ga0495686_0002817 | Ga0495686_0002817_4546_5307 | 253 |
| 529 | 3300047472 | Ga0495686_0132599 | Ga0495686_0132599_340_1101 | 253 |
| 530 | 3300047472 | Ga0495686_0274444 | Ga0495686_0274444_37_807 | 253 |
| 531 | 3300047673 | Ga0495593_0001498 | Ga0495593_0001498_8987_9757 | 253 |
| 532 | 3300047673 | Ga0495593_0029529 | Ga0495593_0029529_372_1136 | 253 |
| 533 | 3300048088 | Ga0495602_0056072 | Ga0495602_0056072_382_1152 | 253 |
| 534 | 3300048088 | Ga0495602_0115864 | Ga0495602_0115864_669_1433 | 253 |
| 535 | 3300048903 | Ga0496100_0000113 | Ga0496100_0000113_4312_5073 | 253 |
| 536 | 3300048903 | Ga0496100_0006352 | Ga0496100_0006352_4172_4942 | 253 |
| 537 | 3300048904 | Ga0496101_0000363 | Ga0496101_0000363_11043_11804 | 253 |
| 538 | 3300048904 | Ga0496101_0011523 | Ga0496101_0011523_114_878 | 253 |
| 539 | 3300048904 | Ga0496101_0070727 | Ga0496101_0070727_1657_2418 | 253 |
| 540 | 3300048905 | Ga0496102_0092435 | Ga0496102_0092435_1017_1781 | 253 |
| 541 | 3300048905 | Ga0496102_0143444 | Ga0496102_0143444_795_1556 | 253 |
| 542 | 3300048905 | Ga0496102_0389809 | Ga0496102_0389809_423_1193 | 253 |
| 543 | 3300048906 | Ga0496103_0001462 | Ga0496103_0001462_6896_7660 | 253 |
| 544 | 3300048906 | Ga0496103_0297690 | Ga0496103_0297690_161_922 | 253 |
| 545 | 3300048907 | Ga0496104_0009123 | Ga0496104_0009123_4854_5615 | 253 |
| 546 | 3300048907 | Ga0496104_0034035 | Ga0496104_0034035_1870_2634 | 253 |
| 547 | 3300048907 | Ga0496104_0063350 | Ga0496104_0063350_1693_2454 | 253 |
| 548 | 3300048907 | Ga0496104_0122114 | Ga0496104_0122114_1330_2091 | 253 |
| 549 | 3300048907 | Ga0496104_0316203 | Ga0496104_0316203_339_1100 | 253 |
| 550 | 3300048908 | Ga0496105_0007018 | Ga0496105_0007018_1320_2081 | 253 |
| 551 | 3300048908 | Ga0496105_0225948 | Ga0496105_0225948_649_1410 | 253 |
| 552 | 3300048909 | Ga0496106_0075297 | Ga0496106_0075297_668_1438 | 253 |
| 553 | 3300048909 | Ga0496106_0152345 | Ga0496106_0152345_935_1696 | 253 |
| 554 | 3300048909 | Ga0496106_0220430 | Ga0496106_0220430_123_884 | 253 |
| 555 | 3300048910 | Ga0496107_0001890 | Ga0496107_0001890_8376_9137 | 253 |
| 556 | 3300048910 | Ga0496107_0067422 | Ga0496107_0067422_188_952 | 253 |
| 557 | 3300048910 | Ga0496107_0071745 | Ga0496107_0071745_1137_1898 | 253 |
| 558 | 3300048911 | Ga0496108_0005802 | Ga0496108_0005802_7704_8465 | 253 |
| 559 | 3300048911 | Ga0496108_0014994 | Ga0496108_0014994_2896_3657 | 253 |
| 560 | 3300048911 | Ga0496108_0036994 | Ga0496108_0036994_182_943 | 253 |
| 561 | 3300048911 | Ga0496108_0310321 | Ga0496108_0310321_427_1188 | 253 |
| 562 | 3300048912 | Ga0496109_0015999 | Ga0496109_0015999_1374_2135 | 253 |
| 563 | 3300048912 | Ga0496109_0021547 | Ga0496109_0021547_2695_3456 | 253 |
| 564 | 3300048912 | Ga0496109_0079671 | Ga0496109_0079671_1905_2669 | 253 |
| 565 | 3300048912 | Ga0496109_0345610 | Ga0496109_0345610_632_1393 | 253 |
| 566 | 3300048912 | Ga0496109_0531009 | Ga0496109_0531009_13_774 | 253 |
| 567 | 3300048913 | Ga0496110_0187267 | Ga0496110_0187267_162_923 | 253 |
| 568 | 3300048914 | Ga0496111_0107357 | Ga0496111_0107357_316_1077 | 253 |
| 569 | 3300048915 | Ga0496112_0003887 | Ga0496112_0003887_10749_11513 | 253 |
| 570 | 3300048915 | Ga0496112_0112235 | Ga0496112_0112235_700_1461 | 253 |
| 571 | 3300048915 | Ga0496112_0442212 | Ga0496112_0442212_316_1077 | 253 |
| 572 | 3300048916 | Ga0496113_0049790 | Ga0496113_0049790_1614_2378 | 253 |
| 573 | 3300048916 | Ga0496113_0115675 | Ga0496113_0115675_1264_2025 | 253 |
| 574 | 3300048917 | Ga0496114_0001090 | Ga0496114_0001090_18231_18992 | 253 |
| 575 | 3300048917 | Ga0496114_0164549 | Ga0496114_0164549_248_1009 | 253 |
| 576 | 3300048917 | Ga0496114_0409087 | Ga0496114_0409087_285_1055 | 253 |
| 577 | 3300048918 | Ga0496115_0006794 | Ga0496115_0006794_3008_3769 | 253 |
| 578 | 3300048918 | Ga0496115_0059594 | Ga0496115_0059594_101_862 | 253 |
| 579 | 3300048918 | Ga0496115_0065658 | Ga0496115_0065658_259_1020 | 253 |
| 580 | 3300048918 | Ga0496115_0095218 | Ga0496115_0095218_343_1104 | 253 |
| 581 | 3300048918 | Ga0496115_0134411 | Ga0496115_0134411_1259_2023 | 253 |
| 582 | 3300048919 | Ga0496116_0004565 | Ga0496116_0004565_4907_5671 | 253 |
| 583 | 3300048922 | Ga0496119_0001657 | Ga0496119_0001657_12261_13022 | 253 |
| 584 | 3300048924 | Ga0496121_0023936 | Ga0496121_0023936_4947_5711 | 253 |
| 585 | 3300048924 | Ga0496121_0119125 | Ga0496121_0119125_975_1745 | 253 |
| 586 | 3300048925 | Ga0496122_0000380 | Ga0496122_0000380_77591_78352 | 253 |
| 587 | 3300048925 | Ga0496122_0006381 | Ga0496122_0006381_4740_5504 | 253 |
| 588 | 3300048926 | Ga0496123_0000246 | Ga0496123_0000246_22231_22992 | 253 |
| 589 | 3300048926 | Ga0496123_0010425 | Ga0496123_0010425_450_1214 | 253 |
| 590 | 3300048927 | Ga0496124_0011385 | Ga0496124_0011385_5573_6337 | 253 |
| 591 | 3300048927 | Ga0496124_0185311 | Ga0496124_0185311_516_1277 | 253 |
| 592 | 3300048928 | Ga0496125_0004295 | Ga0496125_0004295_12905_13669 | 253 |
| 593 | 3300048928 | Ga0496125_0373205 | Ga0496125_0373205_45_806 | 253 |
| 594 | 3300048929 | Ga0496126_0000196 | Ga0496126_0000196_103868_104632 | 253 |
| 595 | 3300049581 | Ga0501047_0052386 | Ga0501047_0052386_2113_2874 | 253 |
| 596 | 3300050491 | nmdc:mga00v17_344773_c1 | nmdc:mga00v17_344773_c1_53_814 | 253 |
| 597 | 3300050509 | nmdc:mga0qj67_48287_c1 | nmdc:mga0qj67_48287_c1_985_1746 | 253 |
| 598 | 3300050511 | nmdc:mga08y16_342139_c1 | nmdc:mga08y16_342139_c1_366_1127 | 253 |
| 599 | 3300050512 | nmdc:mga0n895_74802_c1 | nmdc:mga0n895_74802_c1_1107_1868 | 253 |
| 600 | 3300050513 | nmdc:mga0rr50_66397_c1 | nmdc:mga0rr50_66397_c1_658_1419 | 253 |
| 601 | 3300050514 | nmdc:mga08x19_375944_c1 | nmdc:mga08x19_375944_c1_161_922 | 253 |
| 602 | 3300050515 | nmdc:mga0a205_3532_c1 | nmdc:mga0a205_3532_c1_10830_11591 | 253 |
| 603 | 3300050516 | nmdc:mga0sz30_1805_c1 | nmdc:mga0sz30_1805_c1_786_1547 | 253 |
| 604 | 3300053104 | Ga0500556_0004611 | Ga0500556_0004611_2348_3109 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3grp-assembly1.cif.gz_C | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9433 | 1 | 248 |
| 3grp-assembly1.cif.gz_C | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.939 | 1 | 248 |
| 4i08-assembly1.cif.gz_B-2 | crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph | 0.9357 | 3 | 245 |
| 3rsh-assembly1.cif.gz_B-2 | structure of 3-ketoacyl-(acyl-carrier-protein)reductase (fabg) from vibrio cholerae o1 complexed with nadp+ (space group p62) | 0.9339 | 3 | 245 |
| 6y4d-assembly1.cif.gz_A | crystal structure of a short-chain dehydrogenase/reductase (sdr) from zephyranthes treatiae in complex with nadp+ | 0.9338 | 6 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9433 | 1 | 248 | 3.40.50.720 |
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.939 | 1 | 248 | 3.40.50.720 |
| af_Q0JEC9_1_74_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.939 | 5 | 63 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9304 | 2 | 83 | 3.40.50.720 |
| 3tzcB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9272 | 3 | 247 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5F9L6-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9862 | 1 | 222 |
GO:0016491
|
| AF-A0A6L5F9L6-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9774 | 1 | 222 |
GO:0016491
|
| AF-A0A2S8M7Y1-F1-model_v4 | deleted | 0.9764 | 1 | 184 |
|
| AF-A0A537SD98-F1-model_v4 | SDR family oxidoreductase | 0.975 | 1 | 251 |
GO:0016491
|
| AF-A0A537QXV5-F1-model_v4 | SDR family oxidoreductase | 0.9749 | 1 | 251 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar