F468402

General Info

Members Datasets Scaffolds Average Seq Length
604 342 585 250

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0043943|Ga0466963_0043943_1670_2515
Length 281
Sequence VRVLPSSPVSELVLSLRHRREGAIGMDLQLTGRRALVTGGTRGIGRAIVEQFLAEGASVAFCARDSDAVKRRQDELAAGLAAATRVVGTALDVADAGALADWVTSSAEQLGGIDIVVSNVSALAIPDELDNWTASFEVDLMAAVRLVRAAMPYLEASDAACIIAVSSVSGREIDFAAGPYGTMKAALVHYMQGLAYQLAPKGIRANAVSPGNTYFDGGVWQSIEQNQPELFATALDLNPTKRMGTPDEIARTVVFVASPASSRTSGANILVDGALSRGVQL

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
8 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
9 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
10 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
11 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
12 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
13 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
14 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
15 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
16 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
17 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
18 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
19 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
232 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.19
Metatranscriptomes 0.66
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 0.83
Rhizoplane 8.77
Rhizosphere 81.13
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10016105 3300001990 Bacteria 2414
2 rootH2_10109253 3300003320 Bacteria 3138
3 Ga0070658_10356654 3300005327 Bacteria 1252
4 Ga0070683_100082953 3300005329 Bacteria 3002
5 Ga0070683_100119571 3300005329 Bacteria 2488
6 Ga0070670_100333804 3300005331 Bacteria 1330
7 Ga0068869_100056219 3300005334 Bacteria 2869
8 Ga0068869_100078718 3300005334 Bacteria 2455
9 Ga0068869_100141222 3300005334 Bacteria 1859
10 Ga0070666_10311989 3300005335 Bacteria 1121
11 Ga0070682_100227107 3300005337 Bacteria 1332
12 Ga0070682_100402234 3300005337 Bacteria 1036
13 Ga0068868_100161719 3300005338 Bacteria 1849
14 Ga0070660_100151201 3300005339 Bacteria 1866
15 Ga0070691_10020329 3300005341 Bacteria 3068
16 Ga0070687_100071458 3300005343 Bacteria 1865
17 Ga0070661_100354554 3300005344 Bacteria 1152
18 Ga0070692_10070893 3300005345 Bacteria 1856
19 Ga0070668_100025190 3300005347 Bacteria 4510
20 Ga0070668_100073271 3300005347 Bacteria 2670
21 Ga0070668_100157039 3300005347 Bacteria 1843
22 Ga0070671_100003181 3300005355 Bacteria 12794
23 Ga0070673_100256280 3300005364 Bacteria 1527
24 Ga0070659_100048061 3300005366 Bacteria 3350
25 Ga0070667_100078297 3300005367 Bacteria 2824
26 Ga0070667_100438905 3300005367 Bacteria 1192
27 Ga0070709_10002092 3300005434 Bacteria 10808
28 Ga0070714_100001185 3300005435 Bacteria 18771
29 Ga0070714_100115010 3300005435 Bacteria 2387
30 Ga0070714_100450616 3300005435 Bacteria 1222
31 Ga0070714_100575515 3300005435 Bacteria 1080
32 Ga0070713_100001804 3300005436 Bacteria 13808
33 Ga0070713_100184129 3300005436 Bacteria 1878
34 Ga0070713_100198111 3300005436 Bacteria 1812
35 Ga0070713_100472323 3300005436 Bacteria 1181
36 Ga0070713_100674280 3300005436 Bacteria 986
37 Ga0070710_10019981 3300005437 Bacteria 3469
38 Ga0070710_10102981 3300005437 Bacteria 1703
39 Ga0070710_10205154 3300005437 Bacteria 1246
40 Ga0070711_100007080 3300005439 Bacteria 6802
41 Ga0070711_100216635 3300005439 Bacteria 1486
42 Ga0070705_100020359 3300005440 Bacteria 3509
43 Ga0070700_100101355 3300005441 Bacteria 1897
44 Ga0070694_100110753 3300005444 Bacteria 1955
45 Ga0070708_100038177 3300005445 Bacteria 4195
46 Ga0070708_100085770 3300005445 Bacteria 2859
47 Ga0070708_100525656 3300005445 Bacteria 1116
48 Ga0070663_100025673 3300005455 Bacteria 3981
49 Ga0070663_100391434 3300005455 Bacteria 1134
50 Ga0070678_100103384 3300005456 Bacteria 2213
51 Ga0070678_100341240 3300005456 Bacteria 1285
52 Ga0070678_100403105 3300005456 Bacteria 1189
53 Ga0070662_100097191 3300005457 Bacteria 2222
54 Ga0070662_100188417 3300005457 Bacteria 1630
55 Ga0070681_10192952 3300005458 Bacteria 1956
56 Ga0068867_100072537 3300005459 Bacteria 2577
57 Ga0070685_10280615 3300005466 Bacteria 1115
58 Ga0070685_10422067 3300005466 Bacteria 928
59 Ga0070707_100035129 3300005468 Bacteria 4781
60 Ga0070699_100000237 3300005518 Bacteria 53797
61 Ga0070679_100030899 3300005530 Bacteria 5291
62 Ga0070684_100076830 3300005535 Bacteria 2948
63 Ga0070684_100177777 3300005535 Bacteria 1935
64 Ga0070684_100894413 3300005535 Bacteria 832
65 Ga0070697_100003854 3300005536 Bacteria 11521
66 Ga0068853_100139895 3300005539 Bacteria 2173
67 Ga0070672_100405247 3300005543 Bacteria 1169
68 Ga0070693_100127901 3300005547 Bacteria 1584
69 Ga0070665_100015743 3300005548 Bacteria 7598
70 Ga0070665_100141219 3300005548 Bacteria 2411
71 Ga0070665_100401019 3300005548 Bacteria 1379
72 Ga0068855_100084353 3300005563 Bacteria 3678
73 Ga0068855_100208300 3300005563 Bacteria 2199
74 Ga0070664_100164090 3300005564 Bacteria 1967
75 Ga0068857_100081360 3300005577 Bacteria 2892
76 Ga0068857_100231619 3300005577 Bacteria 1689
77 Ga0068854_100080106 3300005578 Bacteria 2409
78 Ga0068856_100054377 3300005614 Bacteria 3948
79 Ga0070702_100004665 3300005615 Bacteria 6286
80 Ga0070702_100116505 3300005615 Bacteria 1666
81 Ga0070702_100186383 3300005615 Bacteria 1362
82 Ga0068852_100511999 3300005616 Bacteria 1196
83 Ga0068859_100289242 3300005617 Bacteria 1732
84 Ga0068864_100655511 3300005618 Bacteria 1022
85 Ga0068864_100821475 3300005618 Bacteria 914
86 Ga0068861_100075641 3300005719 Bacteria 2622
87 Ga0068851_10009856 3300005834 Bacteria 4450
88 Ga0068870_10195462 3300005840 Bacteria 1223
89 Ga0068870_10360697 3300005840 Bacteria 935
90 Ga0068863_100000320 3300005841 Bacteria 48819
91 Ga0068863_100063341 3300005841 Bacteria 3497
92 Ga0068863_100537142 3300005841 Bacteria 1154
93 Ga0068858_100214516 3300005842 Bacteria 1822
94 Ga0068858_100439294 3300005842 Bacteria 1257
95 Ga0068860_100145979 3300005843 Bacteria 2277
96 Ga0068860_100379301 3300005843 Bacteria 1395
97 Ga0081455_10013471 3300005937 Bacteria 8077
98 Ga0081455_10222990 3300005937 Bacteria 1396
99 Ga0081538_10065032 3300005981 Bacteria 2057
100 Ga0081540_1030190 3300005983 Bacteria 3006
101 Ga0081540_1047338 3300005983 Bacteria 2163
102 Ga0070717_10018722 3300006028 Bacteria 5415
103 Ga0070717_10029509 3300006028 Bacteria 4400
104 Ga0070717_10139184 3300006028 Bacteria 2092
105 Ga0075365_10065250 3300006038 Bacteria 2440
106 Ga0075363_100094975 3300006048 Bacteria 1644
107 Ga0075364_10019596 3300006051 Bacteria 4246
108 Ga0075364_10062636 3300006051 Bacteria 2441
109 Ga0070716_100081181 3300006173 Bacteria 1935
110 Ga0070712_100014211 3300006175 Bacteria 5109
111 Ga0070712_100278544 3300006175 Bacteria 1346
112 Ga0075362_10234190 3300006177 Bacteria 900
113 Ga0075369_10004933 3300006186 Bacteria 4961
114 Ga0075369_10005201 3300006186 Bacteria 4846
115 Ga0075369_10034553 3300006186 Bacteria 2146
116 Ga0097621_100141378 3300006237 Bacteria 2057
117 Ga0075370_10045509 3300006353 Bacteria 2482
118 Ga0068871_100233012 3300006358 Bacteria 1599
119 Ga0075428_100442141 3300006844 Bacteria 1393
120 Ga0075430_100109919 3300006846 Bacteria 2299
121 Ga0075431_100302135 3300006847 Bacteria 1617
122 Ga0075434_100081295 3300006871 Bacteria 3237
123 Ga0075429_100303347 3300006880 Bacteria 1398
124 Ga0075436_100026820 3300006914 Bacteria 3966
125 Ga0097620_100289238 3300006931 Bacteria 1732
126 Ga0075435_100017648 3300007076 Bacteria 5407
127 Ga0105251_10000902 3300009011 Bacteria 26630
128 Ga0105251_10027728 3300009011 Bacteria 2867
129 Ga0105244_10032435 3300009036 Bacteria 2765
130 Ga0105244_10124038 3300009036 Bacteria 1249
131 Ga0105240_10058935 3300009093 Bacteria 4793
132 Ga0105240_10844755 3300009093 Bacteria 989
133 Ga0111539_10033925 3300009094 Bacteria 6193
134 Ga0111539_10072207 3300009094 Bacteria 4070
135 Ga0111539_10082922 3300009094 Bacteria 3771
136 Ga0111539_11061190 3300009094 Bacteria 942
137 Ga0105245_10033190 3300009098 Bacteria 4573
138 Ga0105245_10085728 3300009098 Bacteria 2888
139 Ga0105247_10077192 3300009101 Bacteria 2093
140 Ga0105243_10071575 3300009148 Bacteria 2804
141 Ga0105241_10334246 3300009174 Bacteria 1310
142 Ga0105242_10692930 3300009176 Bacteria 996
143 Ga0105248_10177217 3300009177 Bacteria 2402
144 Ga0105248_11051674 3300009177 Bacteria 920
145 Ga0105237_10086252 3300009545 Bacteria 3129
146 Ga0105237_10429198 3300009545 Bacteria 1327
147 Ga0105238_10111356 3300009551 Bacteria 2718
148 Ga0105238_10116795 3300009551 Bacteria 2648
149 Ga0105238_10135373 3300009551 Bacteria 2442
150 Ga0105249_10114196 3300009553 Bacteria 2557
151 Ga0105249_10252977 3300009553 Bacteria 1747
152 Ga0105239_10033883 3300010375 Bacteria 5606
153 Ga0105239_10041196 3300010375 Bacteria 5061
154 Ga0105239_10694977 3300010375 Bacteria 1163
155 Ga0105246_10064761 3300011119 Bacteria 2554
156 Ga0105246_10122539 3300011119 Bacteria 1929
157 Ga0105246_10396758 3300011119 Bacteria 1144
158 Ga0105246_10625588 3300011119 Bacteria 934
159 Ga0157370_10018423 3300013104 Bacteria 7021
160 Ga0157369_10096818 3300013105 Bacteria 3148
161 Ga0157369_10506337 3300013105 Bacteria 1249
162 Ga0157374_10096969 3300013296 Bacteria 2820
163 Ga0157378_10229363 3300013297 Bacteria 1769
164 Ga0163162_10002167 3300013306 Bacteria 18428
165 Ga0163162_10166125 3300013306 Bacteria 2331
166 Ga0163162_10506486 3300013306 Bacteria 1337
167 Ga0163162_10513047 3300013306 Bacteria 1329
168 Ga0157372_10032275 3300013307 Bacteria 5741
169 Ga0157372_10048710 3300013307 Bacteria 4710
170 Ga0157372_10898565 3300013307 Bacteria 1028
171 Ga0157375_10011549 3300013308 Bacteria 7800
172 Ga0157375_10198382 3300013308 Bacteria 2162
173 Ga0157375_10250147 3300013308 Bacteria 1933
174 Ga0157375_10694031 3300013308 Bacteria 1172
175 Ga0157375_10800285 3300013308 Bacteria 1091
176 Ga0163163_10417551 3300014325 Bacteria 1400
177 Ga0157377_10134231 3300014745 Bacteria 1515
178 Ga0157379_10172659 3300014968 Bacteria 1951
179 Ga0157379_10509829 3300014968 Bacteria 1116
180 Ga0157376_10470653 3300014969 Bacteria 1229
181 Ga0157376_10473912 3300014969 Bacteria 1225
182 Ga0183361_10004 3300016635 Bacteria 484183
183 Ga0163161_10026821 3300017792 Bacteria 4084
184 Ga0163161_10230005 3300017792 Bacteria 1439
185 Ga0206351_10719505 3300020077 Bacteria 810
186 Ga0206354_10719664 3300020081 Bacteria 1539
187 Ga0206353_10101519 3300020082 Bacteria 1016
188 Ga0213875_10002693 3300021388 Bacteria 10486
189 Ga0224712_10084796 3300022467 Bacteria 1315
190 Ga0224572_1010853 3300024225 Bacteria 1718
191 Ga0209759_1000130 3300025256 Bacteria 130638
192 Ga0207426_1001241 3300025302 Bacteria 22421
193 Ga0209051_1001907 3300025303 Bacteria 16242
194 Ga0209051_1002547 3300025303 Bacteria 12872
195 Ga0209051_1012164 3300025303 Bacteria 4179
196 Ga0209051_1023549 3300025303 Bacteria 2556
197 Ga0207655_1038919 3300025728 Bacteria 2072
198 Ga0207713_1002952 3300025735 Bacteria 11889
199 Ga0207713_1024454 3300025735 Bacteria 2817
200 Ga0207692_10088344 3300025898 Bacteria 1675
201 Ga0207642_10197446 3300025899 Bacteria 1109
202 Ga0207710_10214137 3300025900 Bacteria 955
203 Ga0207688_10006956 3300025901 Bacteria 6155
204 Ga0207688_10100635 3300025901 Bacteria 1669
205 Ga0207688_10191398 3300025901 Bacteria 1224
206 Ga0207647_10021916 3300025904 Bacteria 4253
207 Ga0207699_10309899 3300025906 Bacteria 1104
208 Ga0207699_10389317 3300025906 Bacteria 991
209 Ga0207705_10286833 3300025909 Bacteria 1261
210 Ga0207684_10018224 3300025910 Bacteria 6014
211 Ga0207654_10211947 3300025911 Bacteria 1281
212 Ga0207654_10258287 3300025911 Bacteria 1170
213 Ga0207654_10288108 3300025911 Bacteria 1113
214 Ga0207671_10097575 3300025914 Bacteria 2222
215 Ga0207693_10002076 3300025915 Bacteria 17507
216 Ga0207693_10074595 3300025915 Bacteria 2657
217 Ga0207693_10263939 3300025915 Bacteria 1350
218 Ga0207663_10053772 3300025916 Bacteria 2517
219 Ga0207663_10233145 3300025916 Bacteria 1346
220 Ga0207663_10349658 3300025916 Bacteria 1119
221 Ga0207657_10125487 3300025919 Bacteria 2108
222 Ga0207652_10019581 3300025921 Bacteria 5568
223 Ga0207646_10070221 3300025922 Bacteria 3128
224 Ga0207681_10038738 3300025923 Bacteria 3161
225 Ga0207694_10061792 3300025924 Bacteria 2916
226 Ga0207687_10051953 3300025927 Bacteria 2859
227 Ga0207687_10487138 3300025927 Bacteria 1028
228 Ga0207700_10021197 3300025928 Bacteria 4431
229 Ga0207700_10061437 3300025928 Bacteria 2849
230 Ga0207700_10066166 3300025928 Bacteria 2761
231 Ga0207700_10238913 3300025928 Bacteria 1548
232 Ga0207700_10378001 3300025928 Bacteria 1238
233 Ga0207664_10042292 3300025929 Bacteria 3556
234 Ga0207664_10096404 3300025929 Bacteria 2434
235 Ga0207664_10099851 3300025929 Bacteria 2396
236 Ga0207664_10132215 3300025929 Bacteria 2102
237 Ga0207644_10011665 3300025931 Bacteria 5820
238 Ga0207690_10034738 3300025932 Bacteria 3250
239 Ga0207709_10073548 3300025935 Bacteria 2178
240 Ga0207709_10238266 3300025935 Bacteria 1322
241 Ga0207670_10085351 3300025936 Bacteria 2219
242 Ga0207669_10049241 3300025937 Bacteria 2510
243 Ga0207704_10177122 3300025938 Bacteria 1537
244 Ga0207665_10000414 3300025939 Bacteria 29429
245 Ga0207691_10516658 3300025940 Bacteria 1013
246 Ga0207711_10117197 3300025941 Bacteria 2375
247 Ga0207711_10223608 3300025941 Bacteria 1723
248 Ga0207711_10302704 3300025941 Bacteria 1475
249 Ga0207689_10293646 3300025942 Bacteria 1347
250 Ga0207661_10159207 3300025944 Bacteria 1958
251 Ga0207679_10875081 3300025945 Bacteria 821
252 Ga0207667_10187380 3300025949 Bacteria 2123
253 Ga0207651_10119302 3300025960 Bacteria 1997
254 Ga0207712_10026482 3300025961 Bacteria 3864
255 Ga0207712_10043019 3300025961 Bacteria 3113
256 Ga0207712_10090400 3300025961 Bacteria 2253
257 Ga0207668_10017140 3300025972 Bacteria 4533
258 Ga0207668_10089646 3300025972 Bacteria 2255
259 Ga0207668_10421938 3300025972 Bacteria 1132
260 Ga0207640_10048055 3300025981 Bacteria 2756
261 Ga0207640_10061175 3300025981 Bacteria 2493
262 Ga0207640_10275810 3300025981 Bacteria 1318
263 Ga0207658_10061822 3300025986 Bacteria 2800
264 Ga0207677_10286223 3300026023 Bacteria 1355
265 Ga0207677_10453876 3300026023 Bacteria 1099
266 Ga0207703_10161545 3300026035 Bacteria 1963
267 Ga0207639_10145589 3300026041 Bacteria 1979
268 Ga0207678_10026393 3300026067 Bacteria 5067
269 Ga0207678_10028607 3300026067 Bacteria 4863
270 Ga0207678_10096133 3300026067 Bacteria 2531
271 Ga0207678_10100179 3300026067 Bacteria 2475
272 Ga0207678_10550602 3300026067 Bacteria 1009
273 Ga0207708_10029199 3300026075 Bacteria 4179
274 Ga0207708_10052679 3300026075 Bacteria 3100
275 Ga0207702_10445456 3300026078 Bacteria 1256
276 Ga0207702_10989848 3300026078 Bacteria 834
277 Ga0207641_10003778 3300026088 Bacteria 13291
278 Ga0207641_10178611 3300026088 Bacteria 1943
279 Ga0207676_10195292 3300026095 Bacteria 1784
280 Ga0207676_10231117 3300026095 Bacteria 1653
281 Ga0207676_10303552 3300026095 Bacteria 1458
282 Ga0207674_10107378 3300026116 Bacteria 2768
283 Ga0207675_100010336 3300026118 Bacteria 8746
284 Ga0207683_10039903 3300026121 Bacteria 4095
285 Ga0207683_10047866 3300026121 Bacteria 3744
286 Ga0207683_10152687 3300026121 Bacteria 2084
287 Ga0207683_10619361 3300026121 Bacteria 1002
288 Ga0207428_10065580 3300027907 Bacteria 2864
289 Ga0207428_10151493 3300027907 Bacteria 1765
290 Ga0207428_10247983 3300027907 Bacteria 1329
291 Ga0268266_10098914 3300028379 Bacteria 2567
292 Ga0268266_10119028 3300028379 Bacteria 2348
293 Ga0268266_10226306 3300028379 Bacteria 1721
294 Ga0268266_10265125 3300028379 Bacteria 1593
295 Ga0268266_10543405 3300028379 Bacteria 1113
296 Ga0268265_10115172 3300028380 Bacteria 2203
297 Ga0268264_10286878 3300028381 Bacteria 1544
298 Ga0268264_10583328 3300028381 Bacteria 1100
299 Ga0265319_1002788 3300028563 Bacteria 9375
300 Ga0265334_10007367 3300028573 Bacteria 4720
301 Ga0265322_10015169 3300028654 Bacteria 2228
302 Ga0265338_10001289 3300028800 Bacteria 41134
303 Ga0265324_10003207 3300029957 Bacteria 7910
304 Ga0265332_10002488 3300031238 Bacteria 9375
305 Ga0265320_10021590 3300031240 Bacteria 3458
306 Ga0265339_10019095 3300031249 Bacteria 4028
307 Ga0265316_10138018 3300031344 Bacteria 1833
308 Ga0307408_100004673 3300031548 Bacteria 9252
309 Ga0265313_10020870 3300031595 Bacteria 3599
310 Ga0265314_10273180 3300031711 Bacteria 959
311 Ga0265342_10006091 3300031712 Bacteria 9048
312 Ga0307405_10019951 3300031731 Bacteria 3735
313 Ga0307410_10252692 3300031852 Bacteria 1371
314 Ga0307410_10273666 3300031852 Bacteria 1322
315 Ga0307406_10122425 3300031901 Bacteria 1811
316 Ga0307412_10036248 3300031911 Bacteria 3158
317 Ga0307416_100080927 3300032002 Bacteria 2744
318 Ga0307411_10136856 3300032005 Bacteria 1800
319 Ga0307411_10252807 3300032005 Bacteria 1387
320 Ga0373930_0002507 3300034816 Bacteria 2845
321 Ga0373939_0001572 3300035114 Bacteria 5525
322 Ga0373941_0001653 3300035115 Bacteria 4767
323 Ga0373960_0009273 3300035121 Bacteria 2379
324 Ga0373942_0006729 3300035207 Bacteria 2656
325 Ga0373962_0087105 3300035242 Bacteria 957
326 Ga0316574_0023165 3300035398 Bacteria 3706
327 Ga0373931_0006681 3300035691 Bacteria 5406
328 Ga0373935_0129525 3300035692 Bacteria 1694
329 Ga0373935_0133067 3300035692 Bacteria 1673
330 Ga0373933_0172526 3300035724 Bacteria 1377
331 Ga0373947_0226159 3300035725 Bacteria 1231
332 Ga0373947_0544322 3300035725 Bacteria 790
333 Ga0373937_0139628 3300036401 Bacteria 2266
334 Ga0373925_0106141 3300037068 Bacteria 2165
335 Ga0395905_0044417 3300037471 Bacteria 4171
336 Ga0436364_0324998 3300037853 Bacteria 20353
337 Ga0436365_0428073 3300039437 Bacteria 1151
338 Ga0436365_0659902 3300039437 Bacteria 1154
339 Ga0436365_1432981 3300039437 Bacteria 1444
340 Ga0436362_0843181 3300039453 Bacteria 7832
341 Ga0439466_0011317 3300041411 Bacteria 3302
342 Ga0439465_0021859 3300041413 Bacteria 2008
343 Ga0439431_0014813 3300041997 Bacteria 1810
344 Ga0439442_055461 3300042002 Bacteria 838
345 Ga0439450_016451 3300042008 Bacteria 1530
346 Ga0451577_0011794 3300042876 Bacteria 8247
347 Ga0451577_0378210 3300042876 Bacteria 1285
348 Ga0466961_0136827 3300044693 Bacteria 1535
349 Ga0466963_0000820 3300044694 Bacteria 15535
350 Ga0466963_0033591 3300044694 Bacteria 3333
351 Ga0466963_0043943 3300044694 Bacteria 2940
352 Ga0453684_0170855 3300044712 Bacteria 2562
353 Ga0453684_0817112 3300044712 Bacteria 1004
354 Ga0466970_0155951 3300044765 Bacteria 1262
355 Ga0466957_0200434 3300044842 Bacteria 1311
356 Ga0466959_0115730 3300045049 Bacteria 1910
357 Ga0451576_0113444 3300045051 Bacteria 2821
358 Ga0466958_0057561 3300045836 Bacteria 2362
359 Ga0466967_0030783 3300045976 Bacteria 4507
360 Ga0466967_0049170 3300045976 Bacteria 3687
361 Ga0466967_0158852 3300045976 Bacteria 2120
362 Ga0466967_0190374 3300045976 Bacteria 1938
363 Ga0466967_0282195 3300045976 Bacteria 1594
364 Ga0466967_0424557 3300045976 Bacteria 1296
365 Ga0495592_0005032 3300046454 Bacteria 9722
366 Ga0495592_0078911 3300046454 Bacteria 2384
367 Ga0495603_0023699 3300046455 Bacteria 3713
368 Ga0495603_0217355 3300046455 Bacteria 1103
369 Ga0495590_0001075 3300046457 Bacteria 12028
370 Ga0495590_0006611 3300046457 Bacteria 4518
371 Ga0495591_000630 3300046458 Bacteria 26156
372 Ga0495591_071276 3300046458 Bacteria 902
373 Ga0495629_0001892 3300046459 Bacteria 16301
374 Ga0495629_0004420 3300046459 Bacteria 10532
375 Ga0495629_0073542 3300046459 Bacteria 2386
376 Ga0495638_0003764 3300046460 Bacteria 11793
377 Ga0495638_0005628 3300046460 Bacteria 9241
378 Ga0495641_0022941 3300046461 Bacteria 3112
379 Ga0495651_0000569 3300046462 Bacteria 28595
380 Ga0495653_0029572 3300046463 Bacteria 4372
381 Ga0495653_0237896 3300046463 Bacteria 1215
382 Ga0495580_0000889 3300046472 Bacteria 25974
383 Ga0495580_0004799 3300046472 Bacteria 11322
384 Ga0495580_0049018 3300046472 Bacteria 2988
385 Ga0495582_0076703 3300046473 Bacteria 1853
386 Ga0495605_0002296 3300046474 Bacteria 11924
387 Ga0495605_0078190 3300046474 Bacteria 1551
388 Ga0495605_0122949 3300046474 Bacteria 1175
389 Ga0495662_0039389 3300046476 Bacteria 2283
390 Ga0495664_0003070 3300046477 Bacteria 9048
391 Ga0495664_0019767 3300046477 Bacteria 3877
392 Ga0495596_0009370 3300046500 Bacteria 4307
393 Ga0495596_0075667 3300046500 Bacteria 1308
394 Ga0495607_0006590 3300046501 Bacteria 8151
395 Ga0495607_0246863 3300046501 Bacteria 861
396 Ga0495583_0004834 3300046506 Bacteria 9428
397 Ga0495606_0134456 3300046507 Bacteria 1466
398 Ga0495608_0001673 3300046511 Bacteria 15948
399 Ga0495608_0151602 3300046511 Bacteria 1477
400 Ga0495616_0219706 3300046513 Bacteria 828
401 Ga0495618_0206167 3300046514 Bacteria 1243
402 Ga0495620_0048889 3300046515 Bacteria 1813
403 Ga0495628_0028776 3300046516 Bacteria 4512
404 Ga0495628_0043558 3300046516 Bacteria 3573
405 Ga0495628_0048363 3300046516 Bacteria 3371
406 Ga0495628_0203979 3300046516 Bacteria 1489
407 Ga0495630_0054576 3300046517 Bacteria 2993
408 Ga0495630_0177780 3300046517 Bacteria 1622
409 Ga0495631_0139050 3300046518 Bacteria 1043
410 Ga0495644_0025944 3300046523 Bacteria 2224
411 Ga0495648_0006835 3300046524 Bacteria 9211
412 Ga0495648_0020754 3300046524 Bacteria 4570
413 Ga0495648_0021191 3300046524 Bacteria 4508
414 Ga0495648_0042187 3300046524 Bacteria 2873
415 Ga0495666_0003783 3300046526 Bacteria 7651
416 Ga0495666_0030226 3300046526 Bacteria 2661
417 Ga0495642_0015321 3300046528 Bacteria 2979
418 Ga0495652_0004265 3300046529 Bacteria 13734
419 Ga0495652_0021421 3300046529 Bacteria 5747
420 Ga0495652_0308960 3300046529 Bacteria 1146
421 Ga0495665_0039793 3300046531 Bacteria 2503
422 Ga0495665_0104725 3300046531 Bacteria 1484
423 Ga0495640_0057415 3300046533 Bacteria 2656
424 Ga0495640_0215281 3300046533 Bacteria 1213
425 Ga0495586_0006562 3300046535 Bacteria 6217
426 Ga0495586_0132771 3300046535 Bacteria 1394
427 Ga0495586_0450966 3300046535 Bacteria 741
428 Ga0495587_0054121 3300046536 Bacteria 2365
429 Ga0495597_0003843 3300046542 Bacteria 8528
430 Ga0495645_0005345 3300046543 Bacteria 8801
431 Ga0495645_0032852 3300046543 Bacteria 3785
432 Ga0495667_0027842 3300046559 Bacteria 3806
433 Ga0495667_0116493 3300046559 Bacteria 1726
434 Ga0495611_0077346 3300046648 Bacteria 1526
435 Ga0495611_0113257 3300046648 Bacteria 1263
436 Ga0495625_0086052 3300046660 Bacteria 2181
437 Ga0495635_0218194 3300046663 Bacteria 1290
438 Ga0495661_0044842 3300046665 Bacteria 2707
439 Ga0495661_0051976 3300046665 Bacteria 2471
440 Ga0495599_0010836 3300046678 Bacteria 5586
441 Ga0495599_0066384 3300046678 Bacteria 2253
442 Ga0495599_0107325 3300046678 Bacteria 1740
443 Ga0495599_0271809 3300046678 Bacteria 1028
444 Ga0495623_0002549 3300046679 Bacteria 12047
445 Ga0495623_0009365 3300046679 Bacteria 6363
446 Ga0495623_0047090 3300046679 Bacteria 2737
447 Ga0495646_0036757 3300046680 Bacteria 3032
448 Ga0495646_0052827 3300046680 Bacteria 2452
449 Ga0495646_0053918 3300046680 Bacteria 2421
450 Ga0495646_0194727 3300046680 Bacteria 1106
451 Ga0495624_0001835 3300046690 Bacteria 16213
452 Ga0495624_0007211 3300046690 Bacteria 7815
453 Ga0495624_0007632 3300046690 Bacteria 7593
454 Ga0495624_0046131 3300046690 Bacteria 2771
455 Ga0495624_0185128 3300046690 Bacteria 1268
456 Ga0495671_0043647 3300046692 Bacteria 2250
457 Ga0495649_0015797 3300046694 Bacteria 4292
458 Ga0495589_0004936 3300046794 Bacteria 7070
459 Ga0495589_0041963 3300046794 Bacteria 2281
460 Ga0495589_0272616 3300046794 Bacteria 787
461 Ga0495660_0088867 3300046810 Bacteria 1609
462 Ga0495604_0006195 3300047317 Bacteria 9496
463 Ga0495604_0022967 3300047317 Bacteria 4978
464 Ga0495604_0054452 3300047317 Bacteria 3086
465 Ga0495604_0329986 3300047317 Bacteria 1018
466 Ga0495674_0003086 3300047319 Bacteria 16194
467 Ga0495674_0089728 3300047319 Bacteria 2627
468 Ga0495674_0123546 3300047319 Bacteria 2185
469 Ga0495674_0282842 3300047319 Bacteria 1358
470 Ga0495672_0042143 3300047320 Bacteria 2754
471 Ga0495672_0106176 3300047320 Bacteria 1514
472 Ga0495676_0188857 3300047321 Bacteria 1438
473 Ga0495680_0022210 3300047322 Bacteria 5294
474 Ga0495680_0041319 3300047322 Bacteria 3668
475 Ga0495680_0166581 3300047322 Bacteria 1597
476 Ga0495683_0002778 3300047323 Bacteria 10423
477 Ga0495683_0018269 3300047323 Bacteria 3627
478 Ga0495683_0024999 3300047323 Bacteria 3062
479 Ga0495683_0040475 3300047323 Bacteria 2354
480 Ga0495679_000069 3300047446 Bacteria 99286
481 Ga0495679_005819 3300047446 Bacteria 5423
482 Ga0495679_036132 3300047446 Bacteria 1561
483 Ga0495673_0012297 3300047469 Bacteria 4549
484 Ga0495673_0024129 3300047469 Bacteria 2945
485 Ga0495681_0008254 3300047470 Bacteria 6543
486 Ga0495681_0048514 3300047470 Bacteria 2012
487 Ga0495684_0020901 3300047471 Bacteria 5043
488 Ga0495684_0037263 3300047471 Bacteria 3730
489 Ga0495686_0000048 3300047472 Bacteria 278044
490 Ga0495686_0002817 3300047472 Bacteria 15762
491 Ga0495686_0132599 3300047472 Bacteria 1476
492 Ga0495686_0274444 3300047472 Bacteria 939
493 Ga0495593_0001498 3300047673 Bacteria 13736
494 Ga0495593_0029529 3300047673 Bacteria 3006
495 Ga0495593_0107578 3300047673 Bacteria 1425
496 Ga0495602_0056072 3300048088 Bacteria 3467
497 Ga0495602_0064400 3300048088 Bacteria 3169
498 Ga0495602_0115864 3300048088 Bacteria 2166
499 Ga0496100_0000113 3300048903 Bacteria 46589
500 Ga0496100_0006352 3300048903 Bacteria 6440
501 Ga0496101_0000363 3300048904 Bacteria 30086
502 Ga0496101_0011523 3300048904 Bacteria 5870
503 Ga0496101_0070727 3300048904 Bacteria 2556
504 Ga0496101_0199918 3300048904 Bacteria 1545
505 Ga0496102_0092435 3300048905 Bacteria 2801
506 Ga0496102_0143444 3300048905 Bacteria 2240
507 Ga0496102_0389809 3300048905 Bacteria 1310
508 Ga0496103_0001462 3300048906 Bacteria 15822
509 Ga0496103_0297690 3300048906 Bacteria 1038
510 Ga0496104_0009123 3300048907 Bacteria 8820
511 Ga0496104_0034035 3300048907 Bacteria 4749
512 Ga0496104_0063350 3300048907 Bacteria 3506
513 Ga0496104_0122114 3300048907 Bacteria 2501
514 Ga0496104_0316203 3300048907 Bacteria 1474
515 Ga0496105_0007018 3300048908 Bacteria 8676
516 Ga0496105_0225948 3300048908 Bacteria 1522
517 Ga0496106_0075297 3300048909 Bacteria 2585
518 Ga0496106_0152345 3300048909 Bacteria 1824
519 Ga0496106_0220430 3300048909 Bacteria 1513
520 Ga0496107_0001890 3300048910 Bacteria 13265
521 Ga0496107_0067422 3300048910 Bacteria 2596
522 Ga0496107_0071745 3300048910 Bacteria 2517
523 Ga0496108_0005802 3300048911 Bacteria 10008
524 Ga0496108_0014994 3300048911 Bacteria 6325
525 Ga0496108_0036994 3300048911 Bacteria 4064
526 Ga0496108_0310321 3300048911 Bacteria 1374
527 Ga0496108_0559784 3300048911 Bacteria 997
528 Ga0496109_0015999 3300048912 Bacteria 6555
529 Ga0496109_0021547 3300048912 Bacteria 5701
530 Ga0496109_0079671 3300048912 Bacteria 3018
531 Ga0496109_0345610 3300048912 Bacteria 1405
532 Ga0496109_0531009 3300048912 Bacteria 1110
533 Ga0496110_0187267 3300048913 Bacteria 1879
534 Ga0496111_0107357 3300048914 Bacteria 2055
535 Ga0496112_0003887 3300048915 Bacteria 12493
536 Ga0496112_0024759 3300048915 Bacteria 5755
537 Ga0496112_0112235 3300048915 Bacteria 2695
538 Ga0496112_0442212 3300048915 Bacteria 1238
539 Ga0496113_0048282 3300048916 Bacteria 3167
540 Ga0496113_0049790 3300048916 Bacteria 3121
541 Ga0496113_0115675 3300048916 Bacteria 2092
542 Ga0496114_0001090 3300048917 Bacteria 20470
543 Ga0496114_0164549 3300048917 Bacteria 1930
544 Ga0496114_0372622 3300048917 Bacteria 1264
545 Ga0496114_0409087 3300048917 Bacteria 1201
546 Ga0496115_0006794 3300048918 Bacteria 8392
547 Ga0496115_0059594 3300048918 Bacteria 3074
548 Ga0496115_0065658 3300048918 Bacteria 2931
549 Ga0496115_0095218 3300048918 Bacteria 2437
550 Ga0496115_0134411 3300048918 Bacteria 2039
551 Ga0496115_0184268 3300048918 Bacteria 1725
552 Ga0496116_0004565 3300048919 Bacteria 13133
553 Ga0496119_0001657 3300048922 Bacteria 26171
554 Ga0496121_0023936 3300048924 Bacteria 5856
555 Ga0496121_0119125 3300048924 Bacteria 1997
556 Ga0496122_0000380 3300048925 Bacteria 95108
557 Ga0496122_0006381 3300048925 Bacteria 13555
558 Ga0496123_0000246 3300048926 Bacteria 109397
559 Ga0496123_0010425 3300048926 Bacteria 8215
560 Ga0496124_0011385 3300048927 Bacteria 8895
561 Ga0496124_0185311 3300048927 Bacteria 1598
562 Ga0496125_0004295 3300048928 Bacteria 16544
563 Ga0496125_0373205 3300048928 Bacteria 843
564 Ga0496126_0000196 3300048929 Bacteria 134394
565 Ga0496126_0039177 3300048929 Bacteria 4400
566 Ga0495682_0065720 3300049460 Bacteria 1307
567 Ga0501047_0052386 3300049581 Bacteria 3945
568 nmdc:mga03683_198085_c1 3300050489 Bacteria 921
569 nmdc:mga03683_40724_c1 3300050489 Bacteria 1906
570 nmdc:mga00v17_281619_c1 3300050491 Bacteria 1079
571 nmdc:mga00v17_344773_c1 3300050491 Bacteria 968
572 nmdc:mga00v17_3911_c1 3300050491 Bacteria 7683
573 nmdc:mga07m45_49417_c1 3300050496 Bacteria 2367
574 nmdc:mga0qj67_48287_c1 3300050509 Bacteria 3362
575 nmdc:mga08y16_189044_c1 3300050511 Bacteria 2136
576 nmdc:mga08y16_342139_c1 3300050511 Unclassified 1538
577 nmdc:mga0n895_74802_c1 3300050512 Bacteria 3366
578 nmdc:mga0rr50_66397_c1 3300050513 Bacteria 2737
579 nmdc:mga08x19_375944_c1 3300050514 Bacteria 995
580 nmdc:mga0a205_3532_c1 3300050515 Bacteria 13972
581 nmdc:mga0sz30_1805_c1 3300050516 Bacteria 7610
582 nmdc:mga0sz30_224576_c1 3300050516 Bacteria 835
583 nmdc:mga0sz30_74973_c1 3300050516 Bacteria 1460
584 Ga0500556_0004611 3300053104 Bacteria 3916
585 Ga0466962_0107786 3300061719 Bacteria 1340

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100575515 Ga0070714_1005755151 214
2 3300025945 Ga0207679_10875081 Ga0207679_108750812 220
3 3300005436 Ga0070713_100674280 Ga0070713_1006742802 222
4 3300047320 Ga0495672_0106176 Ga0495672_0106176_25_795 225
5 3300046501 Ga0495607_0246863 Ga0495607_0246863_67_837 226
6 3300046648 Ga0495611_0113257 Ga0495611_0113257_376_1146 226
7 3300047323 Ga0495683_0040475 Ga0495683_0040475_425_1195 226
8 3300045049 Ga0466959_0115730 Ga0466959_0115730_1014_1697 227
9 3300046459 Ga0495629_0004420 Ga0495629_0004420_9414_10184 227
10 3300046461 Ga0495641_0022941 Ga0495641_0022941_1916_2686 227
11 3300046472 Ga0495580_0000889 Ga0495580_0000889_13075_13845 227
12 3300046476 Ga0495662_0039389 Ga0495662_0039389_352_1122 227
13 3300046477 Ga0495664_0003070 Ga0495664_0003070_6132_6902 227
14 3300046514 Ga0495618_0206167 Ga0495618_0206167_337_1107 227
15 3300046516 Ga0495628_0043558 Ga0495628_0043558_2375_3145 227
16 3300046529 Ga0495652_0004265 Ga0495652_0004265_4002_4772 227
17 3300046531 Ga0495665_0039793 Ga0495665_0039793_619_1389 227
18 3300046535 Ga0495586_0006562 Ga0495586_0006562_3648_4418 227
19 3300046543 Ga0495645_0005345 Ga0495645_0005345_1794_2564 227
20 3300046665 Ga0495661_0044842 Ga0495661_0044842_588_1358 227
21 3300046679 Ga0495623_0009365 Ga0495623_0009365_604_1374 227
22 3300046680 Ga0495646_0052827 Ga0495646_0052827_587_1357 227
23 3300046690 Ga0495624_0046131 Ga0495624_0046131_1701_2471 227
24 3300047319 Ga0495674_0123546 Ga0495674_0123546_1115_1885 227
25 3300047322 Ga0495680_0041319 Ga0495680_0041319_524_1294 227
26 3300047446 Ga0495679_005819 Ga0495679_005819_4035_4805 227
27 3300047470 Ga0495681_0048514 Ga0495681_0048514_143_913 227
28 3300047471 Ga0495684_0020901 Ga0495684_0020901_2817_3587 227
29 3300035725 Ga0373947_0544322 Ga0373947_0544322_35_727 230
30 3300046507 Ga0495606_0134456 Ga0495606_0134456_70_840 230
31 3300046526 Ga0495666_0003783 Ga0495666_0003783_6947_7639 230
32 3300046533 Ga0495640_0215281 Ga0495640_0215281_316_1008 230
33 3300046535 Ga0495586_0132771 Ga0495586_0132771_509_1201 230
34 3300046535 Ga0495586_0450966 Ga0495586_0450966_35_727 230
35 3300046678 Ga0495599_0271809 Ga0495599_0271809_314_1006 230
36 3300048915 Ga0496112_0024759 Ga0496112_0024759_11_703 230
37 3300005445 Ga0070708_100038177 Ga0070708_1000381773 231
38 3300005468 Ga0070707_100035129 Ga0070707_1000351292 231
39 3300005518 Ga0070699_100000237 Ga0070699_1000002377 231
40 3300005536 Ga0070697_100003854 Ga0070697_1000038547 231
41 3300006028 Ga0070717_10029509 Ga0070717_100295092 231
42 3300025910 Ga0207684_10018224 Ga0207684_100182246 231
43 3300025922 Ga0207646_10070221 Ga0207646_100702213 231
44 3300046511 Ga0495608_0151602 Ga0495608_0151602_612_1310 232
45 3300047323 Ga0495683_0018269 Ga0495683_0018269_1699_2469 233
46 3300005937 Ga0081455_10222990 Ga0081455_102229902 234
47 3300046457 Ga0495590_0006611 Ga0495590_0006611_3263_4033 234
48 3300047446 Ga0495679_000069 Ga0495679_000069_31390_32160 234
49 3300046460 Ga0495638_0003764 Ga0495638_0003764_955_1725 235
50 3300046506 Ga0495583_0004834 Ga0495583_0004834_6696_7466 235
51 3300049460 Ga0495682_0065720 Ga0495682_0065720_63_833 235
52 3300046472 Ga0495580_0049018 Ga0495580_0049018_370_1140 236
53 3300046524 Ga0495648_0020754 Ga0495648_0020754_417_1187 236
54 3300046692 Ga0495671_0043647 Ga0495671_0043647_266_1036 236
55 3300046694 Ga0495649_0015797 Ga0495649_0015797_3384_4154 236
56 3300047320 Ga0495672_0042143 Ga0495672_0042143_489_1259 236
57 3300047469 Ga0495673_0012297 Ga0495673_0012297_3641_4411 236
58 3300005564 Ga0070664_100164090 Ga0070664_1001640902 237
59 3300009094 Ga0111539_11061190 Ga0111539_110611902 237
60 3300011119 Ga0105246_10122539 Ga0105246_101225392 237
61 3300013308 Ga0157375_10694031 Ga0157375_106940312 237
62 3300014968 Ga0157379_10509829 Ga0157379_105098292 237
63 3300026067 Ga0207678_10096133 Ga0207678_100961333 237
64 3300046474 Ga0495605_0122949 Ga0495605_0122949_153_923 237
65 3300050511 nmdc:mga08y16_189044_c1 nmdc:mga08y16_189044_c1_120_878 237
66 3300050489 nmdc:mga03683_40724_c1 nmdc:mga03683_40724_c1_300_1028 238
67 3300046679 Ga0495623_0047090 Ga0495623_0047090_755_1519 240
68 3300048916 Ga0496113_0048282 Ga0496113_0048282_276_1034 240
69 iso_pu_bacteria 2643221687 2644486073 241
70 iso_pu_bacteria 2902837492 2902840586 241
71 3300005981 Ga0081538_10065032 Ga0081538_100650322 242
72 3300046794 Ga0495589_0272616 Ga0495589_0272616_14_751 242
73 3300006051 Ga0075364_10062636 Ga0075364_100626362 245
74 3300006177 Ga0075362_10234190 Ga0075362_102341902 245
75 3300006186 Ga0075369_10005201 Ga0075369_100052014 245
76 3300006353 Ga0075370_10045509 Ga0075370_100455092 245
77 3300025303 Ga0209051_1001907 Ga0209051_100190715 245
78 3300025303 Ga0209051_1002547 Ga0209051_10025475 245
79 3300025303 Ga0209051_1012164 Ga0209051_10121642 245
80 3300025303 Ga0209051_1023549 Ga0209051_10235492 245
81 3300050489 nmdc:mga03683_198085_c1 nmdc:mga03683_198085_c1_159_896 245
82 3300050491 nmdc:mga00v17_281619_c1 nmdc:mga00v17_281619_c1_134_871 245
83 3300050496 nmdc:mga07m45_49417_c1 nmdc:mga07m45_49417_c1_327_1064 245
84 3300050516 nmdc:mga0sz30_224576_c1 nmdc:mga0sz30_224576_c1_41_778 245
85 3300050516 nmdc:mga0sz30_74973_c1 nmdc:mga0sz30_74973_c1_633_1370 245
86 iso_pu_bacteria 2643221715 2644639304 246
87 iso_pu_bacteria 2902810491 2902816136 246
88 3300025981 Ga0207640_10275810 Ga0207640_102758102 248
89 3300045976 Ga0466967_0282195 Ga0466967_0282195_785_1546 248
90 iso_pu_bacteria 2816332139 2816509355 248
91 iso_pu_bacteria 2501025501 2501072184 249
92 iso_pu_bacteria 2501025504 2501408873 249
93 iso_pu_bacteria 2510917014 2511098578 249
94 iso_pu_bacteria 2510917015 2511106394 249
95 iso_pu_bacteria 2513237166 2514053552 249
96 iso_pu_bacteria 2562617112 2563064824 249
97 iso_pu_bacteria 2711768613 2713482187 249
98 iso_pu_bacteria 2842134933 2842139770 249
99 iso_pu_bacteria 2842324504 2842325670 249
100 iso_pu_bacteria 2842333319 2842338091 249
101 iso_pu_bacteria 2842348783 2842349949 249
102 iso_pu_bacteria 2870782633 2870784935 249
103 iso_pu_bacteria 2917554339 2917555935 249
104 iso_pu_bacteria 2929212328 2929213553 249
105 3300006051 Ga0075364_10019596 Ga0075364_100195963 250
106 3300006186 Ga0075369_10034553 Ga0075369_100345532 250
107 3300031852 Ga0307410_10252692 Ga0307410_102526921 250
108 3300031901 Ga0307406_10122425 Ga0307406_101224252 250
109 3300041997 Ga0439431_0014813 Ga0439431_0014813_319_1071 250
110 3300042002 Ga0439442_055461 Ga0439442_055461_68_820 250
111 3300050491 nmdc:mga00v17_3911_c1 nmdc:mga00v17_3911_c1_5399_6151 250
112 3300005347 Ga0070668_100073271 Ga0070668_1000732712 251
113 3300005355 Ga0070671_100003181 Ga0070671_1000031818 251
114 3300005548 Ga0070665_100015743 Ga0070665_1000157433 251
115 3300005841 Ga0068863_100063341 Ga0068863_1000633412 251
116 3300025906 Ga0207699_10389317 Ga0207699_103893171 251
117 3300025931 Ga0207644_10011665 Ga0207644_100116652 251
118 3300025972 Ga0207668_10089646 Ga0207668_100896462 251
119 3300028379 Ga0268266_10098914 Ga0268266_100989143 251
120 3300046454 Ga0495592_0005032 Ga0495592_0005032_7172_7942 251
121 3300046458 Ga0495591_000630 Ga0495591_000630_5287_6057 251
122 3300046459 Ga0495629_0073542 Ga0495629_0073542_1114_1884 251
123 3300046462 Ga0495651_0000569 Ga0495651_0000569_4567_5337 251
124 3300046500 Ga0495596_0009370 Ga0495596_0009370_3326_4096 251
125 3300046511 Ga0495608_0001673 Ga0495608_0001673_6384_7154 251
126 3300046513 Ga0495616_0219706 Ga0495616_0219706_18_788 251
127 3300046516 Ga0495628_0028776 Ga0495628_0028776_3454_4224 251
128 3300046524 Ga0495648_0021191 Ga0495648_0021191_2670_3440 251
129 3300046533 Ga0495640_0057415 Ga0495640_0057415_1742_2512 251
130 3300046536 Ga0495587_0054121 Ga0495587_0054121_482_1252 251
131 3300046559 Ga0495667_0027842 Ga0495667_0027842_842_1612 251
132 3300046663 Ga0495635_0218194 Ga0495635_0218194_418_1188 251
133 3300046665 Ga0495661_0051976 Ga0495661_0051976_588_1358 251
134 3300046678 Ga0495599_0066384 Ga0495599_0066384_482_1252 251
135 3300046680 Ga0495646_0036757 Ga0495646_0036757_807_1577 251
136 3300046690 Ga0495624_0007211 Ga0495624_0007211_7009_7779 251
137 3300047317 Ga0495604_0054452 Ga0495604_0054452_1248_2018 251
138 3300047319 Ga0495674_0282842 Ga0495674_0282842_37_807 251
139 3300047321 Ga0495676_0188857 Ga0495676_0188857_91_861 251
140 3300047322 Ga0495680_0166581 Ga0495680_0166581_503_1273 251
141 3300047323 Ga0495683_0024999 Ga0495683_0024999_2182_2952 251
142 3300047446 Ga0495679_036132 Ga0495679_036132_256_1026 251
143 3300047469 Ga0495673_0024129 Ga0495673_0024129_374_1144 251
144 3300047673 Ga0495593_0107578 Ga0495593_0107578_619_1389 251
145 3300048088 Ga0495602_0064400 Ga0495602_0064400_1781_2551 251
146 3300005329 Ga0070683_100082953 Ga0070683_1000829534 252
147 3300005329 Ga0070683_100119571 Ga0070683_1001195712 252
148 3300005331 Ga0070670_100333804 Ga0070670_1003338041 252
149 3300005334 Ga0068869_100078718 Ga0068869_1000787182 252
150 3300005334 Ga0068869_100141222 Ga0068869_1001412223 252
151 3300005337 Ga0070682_100402234 Ga0070682_1004022341 252
152 3300005344 Ga0070661_100354554 Ga0070661_1003545541 252
153 3300005347 Ga0070668_100157039 Ga0070668_1001570392 252
154 3300005367 Ga0070667_100438905 Ga0070667_1004389052 252
155 3300005435 Ga0070714_100001185 Ga0070714_10000118510 252
156 3300005436 Ga0070713_100001804 Ga0070713_10000180412 252
157 3300005436 Ga0070713_100198111 Ga0070713_1001981112 252
158 3300005439 Ga0070711_100216635 Ga0070711_1002166352 252
159 3300005441 Ga0070700_100101355 Ga0070700_1001013552 252
160 3300005455 Ga0070663_100391434 Ga0070663_1003914342 252
161 3300005457 Ga0070662_100188417 Ga0070662_1001884172 252
162 3300005458 Ga0070681_10192952 Ga0070681_101929522 252
163 3300005459 Ga0068867_100072537 Ga0068867_1000725372 252
164 3300005466 Ga0070685_10280615 Ga0070685_102806151 252
165 3300005530 Ga0070679_100030899 Ga0070679_1000308994 252
166 3300005535 Ga0070684_100076830 Ga0070684_1000768302 252
167 3300005535 Ga0070684_100177777 Ga0070684_1001777772 252
168 3300005535 Ga0070684_100894413 Ga0070684_1008944131 252
169 3300005543 Ga0070672_100405247 Ga0070672_1004052472 252
170 3300005547 Ga0070693_100127901 Ga0070693_1001279012 252
171 3300005548 Ga0070665_100141219 Ga0070665_1001412192 252
172 3300005563 Ga0068855_100208300 Ga0068855_1002083002 252
173 3300005577 Ga0068857_100081360 Ga0068857_1000813602 252
174 3300005615 Ga0070702_100116505 Ga0070702_1001165051 252
175 3300005616 Ga0068852_100511999 Ga0068852_1005119992 252
176 3300005618 Ga0068864_100821475 Ga0068864_1008214752 252
177 3300005834 Ga0068851_10009856 Ga0068851_100098562 252
178 3300005840 Ga0068870_10195462 Ga0068870_101954622 252
179 3300005842 Ga0068858_100439294 Ga0068858_1004392942 252
180 3300005843 Ga0068860_100145979 Ga0068860_1001459793 252
181 3300006028 Ga0070717_10139184 Ga0070717_101391842 252
182 3300006880 Ga0075429_100303347 Ga0075429_1003033472 252
183 3300009093 Ga0105240_10844755 Ga0105240_108447552 252
184 3300009148 Ga0105243_10071575 Ga0105243_100715753 252
185 3300009176 Ga0105242_10692930 Ga0105242_106929302 252
186 3300009551 Ga0105238_10135373 Ga0105238_101353733 252
187 3300009553 Ga0105249_10252977 Ga0105249_102529772 252
188 3300010375 Ga0105239_10041196 Ga0105239_100411964 252
189 3300010375 Ga0105239_10694977 Ga0105239_106949771 252
190 3300013307 Ga0157372_10048710 Ga0157372_100487102 252
191 3300014745 Ga0157377_10134231 Ga0157377_101342312 252
192 3300017792 Ga0163161_10230005 Ga0163161_102300052 252
193 3300020077 Ga0206351_10719505 Ga0206351_107195051 252
194 3300020081 Ga0206354_10719664 Ga0206354_107196641 252
195 3300020082 Ga0206353_10101519 Ga0206353_101015191 252
196 3300022467 Ga0224712_10084796 Ga0224712_100847962 252
197 3300025901 Ga0207688_10100635 Ga0207688_101006351 252
198 3300025906 Ga0207699_10309899 Ga0207699_103098992 252
199 3300025915 Ga0207693_10074595 Ga0207693_100745953 252
200 3300025916 Ga0207663_10233145 Ga0207663_102331452 252
201 3300025919 Ga0207657_10125487 Ga0207657_101254872 252
202 3300025921 Ga0207652_10019581 Ga0207652_100195813 252
203 3300025923 Ga0207681_10038738 Ga0207681_100387382 252
204 3300025928 Ga0207700_10021197 Ga0207700_100211972 252
205 3300025928 Ga0207700_10238913 Ga0207700_102389131 252
206 3300025929 Ga0207664_10096404 Ga0207664_100964043 252
207 3300025929 Ga0207664_10099851 Ga0207664_100998513 252
208 3300025935 Ga0207709_10238266 Ga0207709_102382661 252
209 3300025937 Ga0207669_10049241 Ga0207669_100492414 252
210 3300025938 Ga0207704_10177122 Ga0207704_101771221 252
211 3300025940 Ga0207691_10516658 Ga0207691_105166581 252
212 3300025941 Ga0207711_10223608 Ga0207711_102236082 252
213 3300025944 Ga0207661_10159207 Ga0207661_101592073 252
214 3300025961 Ga0207712_10090400 Ga0207712_100904002 252
215 3300025972 Ga0207668_10421938 Ga0207668_104219382 252
216 3300025981 Ga0207640_10061175 Ga0207640_100611752 252
217 3300026023 Ga0207677_10453876 Ga0207677_104538762 252
218 3300026067 Ga0207678_10100179 Ga0207678_101001792 252
219 3300026067 Ga0207678_10550602 Ga0207678_105506022 252
220 3300026075 Ga0207708_10029199 Ga0207708_100291993 252
221 3300026078 Ga0207702_10989848 Ga0207702_109898481 252
222 3300026095 Ga0207676_10231117 Ga0207676_102311172 252
223 3300026116 Ga0207674_10107378 Ga0207674_101073782 252
224 3300027907 Ga0207428_10247983 Ga0207428_102479832 252
225 3300028379 Ga0268266_10119028 Ga0268266_101190283 252
226 3300028380 Ga0268265_10115172 Ga0268265_101151722 252
227 3300028381 Ga0268264_10286878 Ga0268264_102868782 252
228 3300028563 Ga0265319_1002788 Ga0265319_10027885 252
229 3300028573 Ga0265334_10007367 Ga0265334_100073672 252
230 3300028654 Ga0265322_10015169 Ga0265322_100151692 252
231 3300028800 Ga0265338_10001289 Ga0265338_100012893 252
232 3300029957 Ga0265324_10003207 Ga0265324_100032074 252
233 3300031238 Ga0265332_10002488 Ga0265332_100024884 252
234 3300031240 Ga0265320_10021590 Ga0265320_100215903 252
235 3300031249 Ga0265339_10019095 Ga0265339_100190953 252
236 3300031344 Ga0265316_10138018 Ga0265316_101380182 252
237 3300031595 Ga0265313_10020870 Ga0265313_100208703 252
238 3300031711 Ga0265314_10273180 Ga0265314_102731802 252
239 3300031712 Ga0265342_10006091 Ga0265342_100060914 252
240 3300039437 Ga0436365_0428073 Ga0436365_0428073_228_986 252
241 3300039437 Ga0436365_1432981 Ga0436365_1432981_426_1184 252
242 3300044694 Ga0466963_0033591 Ga0466963_0033591_1779_2537 252
243 3300045976 Ga0466967_0158852 Ga0466967_0158852_1135_1893 252
244 3300045976 Ga0466967_0424557 Ga0466967_0424557_394_1152 252
245 3300046515 Ga0495620_0048889 Ga0495620_0048889_411_1169 252
246 3300048904 Ga0496101_0199918 Ga0496101_0199918_737_1495 252
247 3300048911 Ga0496108_0559784 Ga0496108_0559784_212_970 252
248 3300048917 Ga0496114_0372622 Ga0496114_0372622_382_1140 252
249 3300048918 Ga0496115_0184268 Ga0496115_0184268_524_1282 252
250 3300048929 Ga0496126_0039177 Ga0496126_0039177_92_850 252
251 3300061719 Ga0466962_0107786 Ga0466962_0107786_546_1304 252
252 3300001990 JGI24737J22298_10016105 JGI24737J22298_100161052 253
253 3300003320 rootH2_10109253 rootH2_101092533 253
254 3300005327 Ga0070658_10356654 Ga0070658_103566541 253
255 3300005334 Ga0068869_100056219 Ga0068869_1000562193 253
256 3300005335 Ga0070666_10311989 Ga0070666_103119892 253
257 3300005337 Ga0070682_100227107 Ga0070682_1002271072 253
258 3300005338 Ga0068868_100161719 Ga0068868_1001617192 253
259 3300005339 Ga0070660_100151201 Ga0070660_1001512012 253
260 3300005341 Ga0070691_10020329 Ga0070691_100203292 253
261 3300005343 Ga0070687_100071458 Ga0070687_1000714582 253
262 3300005345 Ga0070692_10070893 Ga0070692_100708931 253
263 3300005347 Ga0070668_100025190 Ga0070668_1000251904 253
264 3300005364 Ga0070673_100256280 Ga0070673_1002562801 253
265 3300005366 Ga0070659_100048061 Ga0070659_1000480612 253
266 3300005367 Ga0070667_100078297 Ga0070667_1000782973 253
267 3300005434 Ga0070709_10002092 Ga0070709_100020924 253
268 3300005435 Ga0070714_100115010 Ga0070714_1001150103 253
269 3300005435 Ga0070714_100450616 Ga0070714_1004506162 253
270 3300005436 Ga0070713_100184129 Ga0070713_1001841292 253
271 3300005436 Ga0070713_100472323 Ga0070713_1004723231 253
272 3300005437 Ga0070710_10019981 Ga0070710_100199813 253
273 3300005437 Ga0070710_10102981 Ga0070710_101029813 253
274 3300005437 Ga0070710_10205154 Ga0070710_102051542 253
275 3300005439 Ga0070711_100007080 Ga0070711_1000070803 253
276 3300005440 Ga0070705_100020359 Ga0070705_1000203591 253
277 3300005444 Ga0070694_100110753 Ga0070694_1001107531 253
278 3300005445 Ga0070708_100085770 Ga0070708_1000857702 253
279 3300005445 Ga0070708_100525656 Ga0070708_1005256562 253
280 3300005455 Ga0070663_100025673 Ga0070663_1000256733 253
281 3300005456 Ga0070678_100103384 Ga0070678_1001033842 253
282 3300005456 Ga0070678_100341240 Ga0070678_1003412401 253
283 3300005456 Ga0070678_100403105 Ga0070678_1004031051 253
284 3300005457 Ga0070662_100097191 Ga0070662_1000971913 253
285 3300005466 Ga0070685_10422067 Ga0070685_104220671 253
286 3300005539 Ga0068853_100139895 Ga0068853_1001398952 253
287 3300005548 Ga0070665_100401019 Ga0070665_1004010192 253
288 3300005563 Ga0068855_100084353 Ga0068855_1000843532 253
289 3300005577 Ga0068857_100231619 Ga0068857_1002316191 253
290 3300005578 Ga0068854_100080106 Ga0068854_1000801062 253
291 3300005614 Ga0068856_100054377 Ga0068856_1000543773 253
292 3300005615 Ga0070702_100004665 Ga0070702_1000046651 253
293 3300005615 Ga0070702_100186383 Ga0070702_1001863832 253
294 3300005617 Ga0068859_100289242 Ga0068859_1002892421 253
295 3300005618 Ga0068864_100655511 Ga0068864_1006555112 253
296 3300005719 Ga0068861_100075641 Ga0068861_1000756413 253
297 3300005840 Ga0068870_10360697 Ga0068870_103606971 253
298 3300005841 Ga0068863_100000320 Ga0068863_1000003205 253
299 3300005841 Ga0068863_100537142 Ga0068863_1005371422 253
300 3300005842 Ga0068858_100214516 Ga0068858_1002145163 253
301 3300005843 Ga0068860_100379301 Ga0068860_1003793012 253
302 3300005937 Ga0081455_10013471 Ga0081455_100134714 253
303 3300005983 Ga0081540_1030190 Ga0081540_10301903 253
304 3300005983 Ga0081540_1047338 Ga0081540_10473381 253
305 3300006028 Ga0070717_10018722 Ga0070717_100187225 253
306 3300006038 Ga0075365_10065250 Ga0075365_100652501 253
307 3300006048 Ga0075363_100094975 Ga0075363_1000949752 253
308 3300006173 Ga0070716_100081181 Ga0070716_1000811811 253
309 3300006175 Ga0070712_100014211 Ga0070712_1000142114 253
310 3300006175 Ga0070712_100278544 Ga0070712_1002785442 253
311 3300006186 Ga0075369_10004933 Ga0075369_100049334 253
312 3300006237 Ga0097621_100141378 Ga0097621_1001413782 253
313 3300006358 Ga0068871_100233012 Ga0068871_1002330122 253
314 3300006844 Ga0075428_100442141 Ga0075428_1004421412 253
315 3300006846 Ga0075430_100109919 Ga0075430_1001099192 253
316 3300006847 Ga0075431_100302135 Ga0075431_1003021352 253
317 3300006871 Ga0075434_100081295 Ga0075434_1000812952 253
318 3300006914 Ga0075436_100026820 Ga0075436_1000268202 253
319 3300006931 Ga0097620_100289238 Ga0097620_1002892383 253
320 3300007076 Ga0075435_100017648 Ga0075435_1000176484 253
321 3300009011 Ga0105251_10000902 Ga0105251_1000090215 253
322 3300009011 Ga0105251_10027728 Ga0105251_100277282 253
323 3300009036 Ga0105244_10032435 Ga0105244_100324354 253
324 3300009036 Ga0105244_10124038 Ga0105244_101240381 253
325 3300009093 Ga0105240_10058935 Ga0105240_100589354 253
326 3300009094 Ga0111539_10033925 Ga0111539_100339252 253
327 3300009094 Ga0111539_10072207 Ga0111539_100722073 253
328 3300009094 Ga0111539_10082922 Ga0111539_100829221 253
329 3300009098 Ga0105245_10033190 Ga0105245_100331903 253
330 3300009098 Ga0105245_10085728 Ga0105245_100857282 253
331 3300009101 Ga0105247_10077192 Ga0105247_100771922 253
332 3300009174 Ga0105241_10334246 Ga0105241_103342461 253
333 3300009177 Ga0105248_10177217 Ga0105248_101772172 253
334 3300009177 Ga0105248_11051674 Ga0105248_110516742 253
335 3300009545 Ga0105237_10086252 Ga0105237_100862522 253
336 3300009545 Ga0105237_10429198 Ga0105237_104291982 253
337 3300009551 Ga0105238_10111356 Ga0105238_101113562 253
338 3300009551 Ga0105238_10116795 Ga0105238_101167952 253
339 3300009553 Ga0105249_10114196 Ga0105249_101141962 253
340 3300010375 Ga0105239_10033883 Ga0105239_100338837 253
341 3300011119 Ga0105246_10064761 Ga0105246_100647613 253
342 3300011119 Ga0105246_10396758 Ga0105246_103967581 253
343 3300011119 Ga0105246_10625588 Ga0105246_106255881 253
344 3300013104 Ga0157370_10018423 Ga0157370_100184232 253
345 3300013105 Ga0157369_10096818 Ga0157369_100968183 253
346 3300013105 Ga0157369_10506337 Ga0157369_105063372 253
347 3300013296 Ga0157374_10096969 Ga0157374_100969692 253
348 3300013297 Ga0157378_10229363 Ga0157378_102293632 253
349 3300013306 Ga0163162_10002167 Ga0163162_100021676 253
350 3300013306 Ga0163162_10166125 Ga0163162_101661253 253
351 3300013306 Ga0163162_10506486 Ga0163162_105064862 253
352 3300013306 Ga0163162_10513047 Ga0163162_105130472 253
353 3300013307 Ga0157372_10032275 Ga0157372_100322754 253
354 3300013307 Ga0157372_10898565 Ga0157372_108985651 253
355 3300013308 Ga0157375_10011549 Ga0157375_100115497 253
356 3300013308 Ga0157375_10198382 Ga0157375_101983822 253
357 3300013308 Ga0157375_10250147 Ga0157375_102501472 253
358 3300013308 Ga0157375_10800285 Ga0157375_108002852 253
359 3300014325 Ga0163163_10417551 Ga0163163_104175512 253
360 3300014968 Ga0157379_10172659 Ga0157379_101726592 253
361 3300014969 Ga0157376_10470653 Ga0157376_104706532 253
362 3300014969 Ga0157376_10473912 Ga0157376_104739122 253
363 3300016635 Ga0183361_10004 Ga0183361_10004281 253
364 3300017792 Ga0163161_10026821 Ga0163161_100268213 253
365 3300021388 Ga0213875_10002693 Ga0213875_1000269310 253
366 3300024225 Ga0224572_1010853 Ga0224572_10108532 253
367 3300025256 Ga0209759_1000130 Ga0209759_1000130122 253
368 3300025302 Ga0207426_1001241 Ga0207426_100124110 253
369 3300025728 Ga0207655_1038919 Ga0207655_10389192 253
370 3300025735 Ga0207713_1002952 Ga0207713_10029527 253
371 3300025735 Ga0207713_1024454 Ga0207713_10244543 253
372 3300025898 Ga0207692_10088344 Ga0207692_100883443 253
373 3300025899 Ga0207642_10197446 Ga0207642_101974462 253
374 3300025900 Ga0207710_10214137 Ga0207710_102141371 253
375 3300025901 Ga0207688_10006956 Ga0207688_100069564 253
376 3300025901 Ga0207688_10191398 Ga0207688_101913981 253
377 3300025904 Ga0207647_10021916 Ga0207647_100219162 253
378 3300025909 Ga0207705_10286833 Ga0207705_102868332 253
379 3300025911 Ga0207654_10211947 Ga0207654_102119472 253
380 3300025911 Ga0207654_10258287 Ga0207654_102582872 253
381 3300025911 Ga0207654_10288108 Ga0207654_102881082 253
382 3300025914 Ga0207671_10097575 Ga0207671_100975752 253
383 3300025915 Ga0207693_10002076 Ga0207693_1000207610 253
384 3300025915 Ga0207693_10263939 Ga0207693_102639392 253
385 3300025916 Ga0207663_10053772 Ga0207663_100537723 253
386 3300025916 Ga0207663_10349658 Ga0207663_103496582 253
387 3300025924 Ga0207694_10061792 Ga0207694_100617924 253
388 3300025927 Ga0207687_10051953 Ga0207687_100519532 253
389 3300025927 Ga0207687_10487138 Ga0207687_104871381 253
390 3300025928 Ga0207700_10061437 Ga0207700_100614373 253
391 3300025928 Ga0207700_10066166 Ga0207700_100661662 253
392 3300025928 Ga0207700_10378001 Ga0207700_103780012 253
393 3300025929 Ga0207664_10042292 Ga0207664_100422923 253
394 3300025929 Ga0207664_10132215 Ga0207664_101322152 253
395 3300025932 Ga0207690_10034738 Ga0207690_100347382 253
396 3300025935 Ga0207709_10073548 Ga0207709_100735482 253
397 3300025936 Ga0207670_10085351 Ga0207670_100853512 253
398 3300025939 Ga0207665_10000414 Ga0207665_1000041416 253
399 3300025941 Ga0207711_10117197 Ga0207711_101171972 253
400 3300025941 Ga0207711_10302704 Ga0207711_103027042 253
401 3300025942 Ga0207689_10293646 Ga0207689_102936461 253
402 3300025949 Ga0207667_10187380 Ga0207667_101873802 253
403 3300025960 Ga0207651_10119302 Ga0207651_101193022 253
404 3300025961 Ga0207712_10026482 Ga0207712_100264822 253
405 3300025961 Ga0207712_10043019 Ga0207712_100430194 253
406 3300025972 Ga0207668_10017140 Ga0207668_100171403 253
407 3300025981 Ga0207640_10048055 Ga0207640_100480552 253
408 3300025986 Ga0207658_10061822 Ga0207658_100618223 253
409 3300026023 Ga0207677_10286223 Ga0207677_102862232 253
410 3300026035 Ga0207703_10161545 Ga0207703_101615451 253
411 3300026041 Ga0207639_10145589 Ga0207639_101455892 253
412 3300026067 Ga0207678_10026393 Ga0207678_100263934 253
413 3300026067 Ga0207678_10028607 Ga0207678_100286073 253
414 3300026075 Ga0207708_10052679 Ga0207708_100526793 253
415 3300026078 Ga0207702_10445456 Ga0207702_104454561 253
416 3300026088 Ga0207641_10003778 Ga0207641_1000377810 253
417 3300026088 Ga0207641_10178611 Ga0207641_101786113 253
418 3300026095 Ga0207676_10195292 Ga0207676_101952922 253
419 3300026095 Ga0207676_10303552 Ga0207676_103035522 253
420 3300026118 Ga0207675_100010336 Ga0207675_1000103363 253
421 3300026121 Ga0207683_10039903 Ga0207683_100399031 253
422 3300026121 Ga0207683_10047866 Ga0207683_100478662 253
423 3300026121 Ga0207683_10152687 Ga0207683_101526872 253
424 3300026121 Ga0207683_10619361 Ga0207683_106193611 253
425 3300027907 Ga0207428_10065580 Ga0207428_100655802 253
426 3300027907 Ga0207428_10151493 Ga0207428_101514932 253
427 3300028379 Ga0268266_10226306 Ga0268266_102263061 253
428 3300028379 Ga0268266_10265125 Ga0268266_102651251 253
429 3300028379 Ga0268266_10543405 Ga0268266_105434051 253
430 3300028381 Ga0268264_10583328 Ga0268264_105833281 253
431 3300031548 Ga0307408_100004673 Ga0307408_1000046735 253
432 3300031731 Ga0307405_10019951 Ga0307405_100199512 253
433 3300031852 Ga0307410_10273666 Ga0307410_102736662 253
434 3300031911 Ga0307412_10036248 Ga0307412_100362484 253
435 3300032002 Ga0307416_100080927 Ga0307416_1000809272 253
436 3300032005 Ga0307411_10136856 Ga0307411_101368562 253
437 3300032005 Ga0307411_10252807 Ga0307411_102528072 253
438 3300034816 Ga0373930_0002507 Ga0373930_0002507_1560_2321 253
439 3300035114 Ga0373939_0001572 Ga0373939_0001572_545_1306 253
440 3300035115 Ga0373941_0001653 Ga0373941_0001653_214_975 253
441 3300035121 Ga0373960_0009273 Ga0373960_0009273_962_1723 253
442 3300035207 Ga0373942_0006729 Ga0373942_0006729_729_1490 253
443 3300035242 Ga0373962_0087105 Ga0373962_0087105_37_798 253
444 3300035398 Ga0316574_0023165 Ga0316574_0023165_369_1130 253
445 3300035691 Ga0373931_0006681 Ga0373931_0006681_2569_3330 253
446 3300035692 Ga0373935_0129525 Ga0373935_0129525_417_1178 253
447 3300035692 Ga0373935_0133067 Ga0373935_0133067_600_1361 253
448 3300035724 Ga0373933_0172526 Ga0373933_0172526_293_1054 253
449 3300035725 Ga0373947_0226159 Ga0373947_0226159_136_897 253
450 3300036401 Ga0373937_0139628 Ga0373937_0139628_342_1130 253
451 3300037068 Ga0373925_0106141 Ga0373925_0106141_900_1661 253
452 3300037471 Ga0395905_0044417 Ga0395905_0044417_550_1314 253
453 3300037853 Ga0436364_0324998 Ga0436364_0324998_18855_19616 253
454 3300039437 Ga0436365_0659902 Ga0436365_0659902_145_906 253
455 3300039453 Ga0436362_0843181 Ga0436362_0843181_984_1745 253
456 3300041411 Ga0439466_0011317 Ga0439466_0011317_1408_2169 253
457 3300041413 Ga0439465_0021859 Ga0439465_0021859_307_1068 253
458 3300042008 Ga0439450_016451 Ga0439450_016451_60_821 253
459 3300042876 Ga0451577_0011794 Ga0451577_0011794_6955_7740 253
460 3300042876 Ga0451577_0378210 Ga0451577_0378210_371_1132 253
461 3300044693 Ga0466961_0136827 Ga0466961_0136827_717_1487 253
462 3300044694 Ga0466963_0000820 Ga0466963_0000820_6815_7576 253
463 3300044694 Ga0466963_0043943 Ga0466963_0043943_1670_2515 253
464 3300044712 Ga0453684_0170855 Ga0453684_0170855_440_1225 253
465 3300044712 Ga0453684_0817112 Ga0453684_0817112_100_861 253
466 3300044765 Ga0466970_0155951 Ga0466970_0155951_71_841 253
467 3300044842 Ga0466957_0200434 Ga0466957_0200434_135_905 253
468 3300045051 Ga0451576_0113444 Ga0451576_0113444_1871_2632 253
469 3300045836 Ga0466958_0057561 Ga0466958_0057561_163_933 253
470 3300045976 Ga0466967_0030783 Ga0466967_0030783_2029_2790 253
471 3300045976 Ga0466967_0049170 Ga0466967_0049170_1847_2692 253
472 3300045976 Ga0466967_0190374 Ga0466967_0190374_777_1538 253
473 3300046454 Ga0495592_0078911 Ga0495592_0078911_1133_1894 253
474 3300046455 Ga0495603_0023699 Ga0495603_0023699_1423_2193 253
475 3300046455 Ga0495603_0217355 Ga0495603_0217355_246_1007 253
476 3300046457 Ga0495590_0001075 Ga0495590_0001075_6952_7716 253
477 3300046458 Ga0495591_071276 Ga0495591_071276_48_818 253
478 3300046459 Ga0495629_0001892 Ga0495629_0001892_6574_7344 253
479 3300046460 Ga0495638_0005628 Ga0495638_0005628_5193_5963 253
480 3300046463 Ga0495653_0029572 Ga0495653_0029572_529_1299 253
481 3300046463 Ga0495653_0237896 Ga0495653_0237896_295_1056 253
482 3300046472 Ga0495580_0004799 Ga0495580_0004799_1581_2351 253
483 3300046473 Ga0495582_0076703 Ga0495582_0076703_45_815 253
484 3300046474 Ga0495605_0002296 Ga0495605_0002296_10488_11258 253
485 3300046474 Ga0495605_0078190 Ga0495605_0078190_40_804 253
486 3300046477 Ga0495664_0019767 Ga0495664_0019767_2134_2895 253
487 3300046500 Ga0495596_0075667 Ga0495596_0075667_130_900 253
488 3300046501 Ga0495607_0006590 Ga0495607_0006590_2137_2907 253
489 3300046516 Ga0495628_0048363 Ga0495628_0048363_2172_2936 253
490 3300046516 Ga0495628_0203979 Ga0495628_0203979_147_908 253
491 3300046517 Ga0495630_0054576 Ga0495630_0054576_1082_1846 253
492 3300046517 Ga0495630_0177780 Ga0495630_0177780_301_1062 253
493 3300046518 Ga0495631_0139050 Ga0495631_0139050_231_1001 253
494 3300046523 Ga0495644_0025944 Ga0495644_0025944_851_1621 253
495 3300046524 Ga0495648_0006835 Ga0495648_0006835_8025_8795 253
496 3300046524 Ga0495648_0042187 Ga0495648_0042187_199_969 253
497 3300046526 Ga0495666_0030226 Ga0495666_0030226_389_1153 253
498 3300046528 Ga0495642_0015321 Ga0495642_0015321_1233_2003 253
499 3300046529 Ga0495652_0021421 Ga0495652_0021421_2430_3194 253
500 3300046529 Ga0495652_0308960 Ga0495652_0308960_268_1029 253
501 3300046531 Ga0495665_0104725 Ga0495665_0104725_327_1097 253
502 3300046542 Ga0495597_0003843 Ga0495597_0003843_4204_4968 253
503 3300046543 Ga0495645_0032852 Ga0495645_0032852_939_1700 253
504 3300046559 Ga0495667_0116493 Ga0495667_0116493_193_954 253
505 3300046648 Ga0495611_0077346 Ga0495611_0077346_745_1515 253
506 3300046660 Ga0495625_0086052 Ga0495625_0086052_1040_1810 253
507 3300046678 Ga0495599_0010836 Ga0495599_0010836_1994_2758 253
508 3300046678 Ga0495599_0107325 Ga0495599_0107325_405_1166 253
509 3300046679 Ga0495623_0002549 Ga0495623_0002549_7153_7923 253
510 3300046680 Ga0495646_0053918 Ga0495646_0053918_419_1183 253
511 3300046680 Ga0495646_0194727 Ga0495646_0194727_327_1088 253
512 3300046690 Ga0495624_0001835 Ga0495624_0001835_6487_7257 253
513 3300046690 Ga0495624_0007632 Ga0495624_0007632_2732_3496 253
514 3300046690 Ga0495624_0185128 Ga0495624_0185128_151_912 253
515 3300046794 Ga0495589_0004936 Ga0495589_0004936_3079_3849 253
516 3300046794 Ga0495589_0041963 Ga0495589_0041963_568_1332 253
517 3300046810 Ga0495660_0088867 Ga0495660_0088867_388_1158 253
518 3300047317 Ga0495604_0006195 Ga0495604_0006195_2380_3144 253
519 3300047317 Ga0495604_0022967 Ga0495604_0022967_187_957 253
520 3300047317 Ga0495604_0329986 Ga0495604_0329986_174_935 253
521 3300047319 Ga0495674_0003086 Ga0495674_0003086_6479_7249 253
522 3300047319 Ga0495674_0089728 Ga0495674_0089728_247_1008 253
523 3300047322 Ga0495680_0022210 Ga0495680_0022210_119_883 253
524 3300047323 Ga0495683_0002778 Ga0495683_0002778_2653_3417 253
525 3300047470 Ga0495681_0008254 Ga0495681_0008254_3147_3917 253
526 3300047471 Ga0495684_0037263 Ga0495684_0037263_1514_2278 253
527 3300047472 Ga0495686_0000048 Ga0495686_0000048_139615_140379 253
528 3300047472 Ga0495686_0002817 Ga0495686_0002817_4546_5307 253
529 3300047472 Ga0495686_0132599 Ga0495686_0132599_340_1101 253
530 3300047472 Ga0495686_0274444 Ga0495686_0274444_37_807 253
531 3300047673 Ga0495593_0001498 Ga0495593_0001498_8987_9757 253
532 3300047673 Ga0495593_0029529 Ga0495593_0029529_372_1136 253
533 3300048088 Ga0495602_0056072 Ga0495602_0056072_382_1152 253
534 3300048088 Ga0495602_0115864 Ga0495602_0115864_669_1433 253
535 3300048903 Ga0496100_0000113 Ga0496100_0000113_4312_5073 253
536 3300048903 Ga0496100_0006352 Ga0496100_0006352_4172_4942 253
537 3300048904 Ga0496101_0000363 Ga0496101_0000363_11043_11804 253
538 3300048904 Ga0496101_0011523 Ga0496101_0011523_114_878 253
539 3300048904 Ga0496101_0070727 Ga0496101_0070727_1657_2418 253
540 3300048905 Ga0496102_0092435 Ga0496102_0092435_1017_1781 253
541 3300048905 Ga0496102_0143444 Ga0496102_0143444_795_1556 253
542 3300048905 Ga0496102_0389809 Ga0496102_0389809_423_1193 253
543 3300048906 Ga0496103_0001462 Ga0496103_0001462_6896_7660 253
544 3300048906 Ga0496103_0297690 Ga0496103_0297690_161_922 253
545 3300048907 Ga0496104_0009123 Ga0496104_0009123_4854_5615 253
546 3300048907 Ga0496104_0034035 Ga0496104_0034035_1870_2634 253
547 3300048907 Ga0496104_0063350 Ga0496104_0063350_1693_2454 253
548 3300048907 Ga0496104_0122114 Ga0496104_0122114_1330_2091 253
549 3300048907 Ga0496104_0316203 Ga0496104_0316203_339_1100 253
550 3300048908 Ga0496105_0007018 Ga0496105_0007018_1320_2081 253
551 3300048908 Ga0496105_0225948 Ga0496105_0225948_649_1410 253
552 3300048909 Ga0496106_0075297 Ga0496106_0075297_668_1438 253
553 3300048909 Ga0496106_0152345 Ga0496106_0152345_935_1696 253
554 3300048909 Ga0496106_0220430 Ga0496106_0220430_123_884 253
555 3300048910 Ga0496107_0001890 Ga0496107_0001890_8376_9137 253
556 3300048910 Ga0496107_0067422 Ga0496107_0067422_188_952 253
557 3300048910 Ga0496107_0071745 Ga0496107_0071745_1137_1898 253
558 3300048911 Ga0496108_0005802 Ga0496108_0005802_7704_8465 253
559 3300048911 Ga0496108_0014994 Ga0496108_0014994_2896_3657 253
560 3300048911 Ga0496108_0036994 Ga0496108_0036994_182_943 253
561 3300048911 Ga0496108_0310321 Ga0496108_0310321_427_1188 253
562 3300048912 Ga0496109_0015999 Ga0496109_0015999_1374_2135 253
563 3300048912 Ga0496109_0021547 Ga0496109_0021547_2695_3456 253
564 3300048912 Ga0496109_0079671 Ga0496109_0079671_1905_2669 253
565 3300048912 Ga0496109_0345610 Ga0496109_0345610_632_1393 253
566 3300048912 Ga0496109_0531009 Ga0496109_0531009_13_774 253
567 3300048913 Ga0496110_0187267 Ga0496110_0187267_162_923 253
568 3300048914 Ga0496111_0107357 Ga0496111_0107357_316_1077 253
569 3300048915 Ga0496112_0003887 Ga0496112_0003887_10749_11513 253
570 3300048915 Ga0496112_0112235 Ga0496112_0112235_700_1461 253
571 3300048915 Ga0496112_0442212 Ga0496112_0442212_316_1077 253
572 3300048916 Ga0496113_0049790 Ga0496113_0049790_1614_2378 253
573 3300048916 Ga0496113_0115675 Ga0496113_0115675_1264_2025 253
574 3300048917 Ga0496114_0001090 Ga0496114_0001090_18231_18992 253
575 3300048917 Ga0496114_0164549 Ga0496114_0164549_248_1009 253
576 3300048917 Ga0496114_0409087 Ga0496114_0409087_285_1055 253
577 3300048918 Ga0496115_0006794 Ga0496115_0006794_3008_3769 253
578 3300048918 Ga0496115_0059594 Ga0496115_0059594_101_862 253
579 3300048918 Ga0496115_0065658 Ga0496115_0065658_259_1020 253
580 3300048918 Ga0496115_0095218 Ga0496115_0095218_343_1104 253
581 3300048918 Ga0496115_0134411 Ga0496115_0134411_1259_2023 253
582 3300048919 Ga0496116_0004565 Ga0496116_0004565_4907_5671 253
583 3300048922 Ga0496119_0001657 Ga0496119_0001657_12261_13022 253
584 3300048924 Ga0496121_0023936 Ga0496121_0023936_4947_5711 253
585 3300048924 Ga0496121_0119125 Ga0496121_0119125_975_1745 253
586 3300048925 Ga0496122_0000380 Ga0496122_0000380_77591_78352 253
587 3300048925 Ga0496122_0006381 Ga0496122_0006381_4740_5504 253
588 3300048926 Ga0496123_0000246 Ga0496123_0000246_22231_22992 253
589 3300048926 Ga0496123_0010425 Ga0496123_0010425_450_1214 253
590 3300048927 Ga0496124_0011385 Ga0496124_0011385_5573_6337 253
591 3300048927 Ga0496124_0185311 Ga0496124_0185311_516_1277 253
592 3300048928 Ga0496125_0004295 Ga0496125_0004295_12905_13669 253
593 3300048928 Ga0496125_0373205 Ga0496125_0373205_45_806 253
594 3300048929 Ga0496126_0000196 Ga0496126_0000196_103868_104632 253
595 3300049581 Ga0501047_0052386 Ga0501047_0052386_2113_2874 253
596 3300050491 nmdc:mga00v17_344773_c1 nmdc:mga00v17_344773_c1_53_814 253
597 3300050509 nmdc:mga0qj67_48287_c1 nmdc:mga0qj67_48287_c1_985_1746 253
598 3300050511 nmdc:mga08y16_342139_c1 nmdc:mga08y16_342139_c1_366_1127 253
599 3300050512 nmdc:mga0n895_74802_c1 nmdc:mga0n895_74802_c1_1107_1868 253
600 3300050513 nmdc:mga0rr50_66397_c1 nmdc:mga0rr50_66397_c1_658_1419 253
601 3300050514 nmdc:mga08x19_375944_c1 nmdc:mga08x19_375944_c1_161_922 253
602 3300050515 nmdc:mga0a205_3532_c1 nmdc:mga0a205_3532_c1_10830_11591 253
603 3300050516 nmdc:mga0sz30_1805_c1 nmdc:mga0sz30_1805_c1_786_1547 253
604 3300053104 Ga0500556_0004611 Ga0500556_0004611_2348_3109 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

227

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

39

276

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

35

222

0.73

PF08659

KR

KR domain

34

213

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grp-assembly1.cif.gz_C 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9433 1 248
3grp-assembly1.cif.gz_C 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.939 1 248
4i08-assembly1.cif.gz_B-2 crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph 0.9357 3 245
3rsh-assembly1.cif.gz_B-2 structure of 3-ketoacyl-(acyl-carrier-protein)reductase (fabg) from vibrio cholerae o1 complexed with nadp+ (space group p62) 0.9339 3 245
6y4d-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase (sdr) from zephyranthes treatiae in complex with nadp+ 0.9338 6 251
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9433 1 248 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.939 1 248 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.939 5 63 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9304 2 83 3.40.50.720
3tzcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9272 3 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L5F9L6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9862 1 222 GO:0016491
AF-A0A6L5F9L6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9774 1 222 GO:0016491
AF-A0A2S8M7Y1-F1-model_v4 deleted 0.9764 1 184
AF-A0A537SD98-F1-model_v4 SDR family oxidoreductase 0.975 1 251 GO:0016491
AF-A0A537QXV5-F1-model_v4 SDR family oxidoreductase 0.9749 1 251 GO:0016491

Feature Viewer

pLDDT pTM Quality
92.13 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map