F468346

General Info

Members Datasets Scaffolds Average Seq Length
604 279 604 120

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10065514|JGI25407J50210_100655141
Length 142
Sequence MLGKAQCEYVSAKWKSQSQEAVMAGVEALDFDSPDESRTPDKTRVDVIRAGGTTAARMTFEPGWKWSECVKPVVGTDSCQVRHVGVVQSGTLHVAHEDGTEAEVGPGDAYVIEPGHDAWVLGDESFVGFEFEPRSAEEYARS

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 11.59
Rhizosphere 86.59
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10131921 3300002075 Bacteria 548
2 JGI25406J46586_10006149 3300003203 Bacteria 5546
3 JGI25406J46586_10043888 3300003203 Bacteria 1552
4 rootH2_10104735 3300003320 Bacteria 1619
5 JGI25407J50210_10008961 3300003373 Bacteria 2527
6 JGI25407J50210_10065514 3300003373 Unclassified 909
7 JGI25405J52794_10083242 3300003911 Bacteria 705
8 Ga0070658_10241833 3300005327 Unclassified 1530
9 Ga0070683_100002057 3300005329 Bacteria 15877
10 Ga0070683_100031484 3300005329 Bacteria 4823
11 Ga0070683_100049127 3300005329 Bacteria 3901
12 Ga0070683_100219259 3300005329 Bacteria 1808
13 Ga0070690_100415874 3300005330 Bacteria 990
14 Ga0070670_101590914 3300005331 Bacteria 601
15 Ga0068869_100261663 3300005334 Bacteria 1385
16 Ga0070682_100013450 3300005337 Bacteria 4708
17 Ga0070682_100107240 3300005337 Bacteria 1855
18 Ga0070682_100171311 3300005337 Bacteria 1509
19 Ga0070682_100681780 3300005337 Unclassified 822
20 Ga0070682_101092975 3300005337 Bacteria 667
21 Ga0068868_100010124 3300005338 Bacteria 6813
22 Ga0068868_100191722 3300005338 Bacteria 1700
23 Ga0068868_100620130 3300005338 Bacteria 960
24 Ga0068868_101897144 3300005338 Bacteria 564
25 Ga0070660_100143502 3300005339 Bacteria 1917
26 Ga0070689_100682058 3300005340 Unclassified 896
27 Ga0070689_100758501 3300005340 Bacteria 851
28 Ga0070691_10068253 3300005341 Bacteria 1721
29 Ga0070691_10108002 3300005341 Bacteria 1389
30 Ga0070687_100290419 3300005343 Bacteria 1033
31 Ga0070692_10444885 3300005345 Unclassified 828
32 Ga0070692_10454800 3300005345 Bacteria 820
33 Ga0070669_100231351 3300005353 Bacteria 1465
34 Ga0070675_100070420 3300005354 Bacteria 2898
35 Ga0070671_100389341 3300005355 Bacteria 1192
36 Ga0070671_100882581 3300005355 Unclassified 781
37 Ga0070671_100962270 3300005355 Bacteria 747
38 Ga0070674_100210042 3300005356 Bacteria 1508
39 Ga0070673_100391751 3300005364 Bacteria 1240
40 Ga0070673_100650455 3300005364 Bacteria 965
41 Ga0070673_101127613 3300005364 Bacteria 733
42 Ga0070673_101754380 3300005364 Bacteria 588
43 Ga0070688_100361077 3300005365 Bacteria 1066
44 Ga0070659_100155253 3300005366 Bacteria 1869
45 Ga0070703_10088173 3300005406 Bacteria 1071
46 Ga0070709_10036454 3300005434 Bacteria 2996
47 Ga0070714_100003676 3300005435 Bacteria 11484
48 Ga0070714_100196843 3300005435 Bacteria 1842
49 Ga0070714_100492769 3300005435 Unclassified 1168
50 Ga0070713_100152544 3300005436 Bacteria 2057
51 Ga0070710_10033144 3300005437 Bacteria 2803
52 Ga0070710_10252632 3300005437 Bacteria 1134
53 Ga0070710_10790316 3300005437 Archaea 677
54 Ga0070710_11032835 3300005437 Unclassified 600
55 Ga0070701_10244510 3300005438 Bacteria 1081
56 Ga0070701_11298109 3300005438 Bacteria 520
57 Ga0070711_100280678 3300005439 Bacteria 1318
58 Ga0070711_100286287 3300005439 Bacteria 1306
59 Ga0070711_100628194 3300005439 Unclassified 898
60 Ga0070711_101106155 3300005439 Unclassified 683
61 Ga0070711_101877633 3300005439 Unclassified 526
62 Ga0070705_100009732 3300005440 Bacteria 4788
63 Ga0070705_100580851 3300005440 Bacteria 864
64 Ga0070700_100096545 3300005441 Bacteria 1939
65 Ga0070700_100642372 3300005441 Bacteria 837
66 Ga0070694_100245703 3300005444 Unclassified 1352
67 Ga0070708_100845712 3300005445 Unclassified 860
68 Ga0070708_102127005 3300005445 Bacteria 519
69 Ga0070678_100240157 3300005456 Bacteria 1514
70 Ga0070678_101553093 3300005456 Unclassified 621
71 Ga0070662_100034216 3300005457 Bacteria 3582
72 Ga0070681_10175648 3300005458 Bacteria 2064
73 Ga0070681_10178402 3300005458 Bacteria 2046
74 Ga0070681_10283177 3300005458 Unclassified 1568
75 Ga0068867_100000004 3300005459 Bacteria 180739
76 Ga0068867_101227418 3300005459 Unclassified 690
77 Ga0068867_101832189 3300005459 Bacteria 571
78 Ga0068867_102236548 3300005459 Bacteria 519
79 Ga0070685_10313906 3300005466 Bacteria 1060
80 Ga0070706_100598273 3300005467 Unclassified 1025
81 Ga0070707_100001787 3300005468 Bacteria 20707
82 Ga0070698_100061353 3300005471 Bacteria 3794
83 Ga0070699_100102021 3300005518 Bacteria 2515
84 Ga0070679_100086131 3300005530 Bacteria 3129
85 Ga0070679_100109351 3300005530 Bacteria 2750
86 Ga0070679_100170394 3300005530 Bacteria 2150
87 Ga0070679_100356497 3300005530 Bacteria 1410
88 Ga0070684_100005226 3300005535 Bacteria 9928
89 Ga0070684_100091306 3300005535 Bacteria 2709
90 Ga0070684_100362749 3300005535 Bacteria 1333
91 Ga0070684_100998826 3300005535 Bacteria 785
92 Ga0070684_101000682 3300005535 Unclassified 785
93 Ga0070697_100092725 3300005536 Bacteria 2500
94 Ga0068853_100583075 3300005539 Bacteria 1061
95 Ga0068853_101189669 3300005539 Bacteria 736
96 Ga0070686_100071682 3300005544 Bacteria 2269
97 Ga0070686_101900145 3300005544 Bacteria 508
98 Ga0070695_100000109 3300005545 Bacteria 36572
99 Ga0070695_100022855 3300005545 Bacteria 3838
100 Ga0070695_100627568 3300005545 Bacteria 846
101 Ga0070695_101809521 3300005545 Unclassified 512
102 Ga0070696_100163046 3300005546 Bacteria 1643
103 Ga0070693_100215334 3300005547 Bacteria 1256
104 Ga0070665_100474348 3300005548 Bacteria 1262
105 Ga0070665_100804111 3300005548 Bacteria 953
106 Ga0070665_101172831 3300005548 Bacteria 779
107 Ga0070704_100196339 3300005549 Bacteria 1626
108 Ga0070704_100320497 3300005549 Bacteria 1298
109 Ga0068855_100059770 3300005563 Bacteria 4459
110 Ga0068855_100371095 3300005563 Bacteria 1573
111 Ga0070664_100006534 3300005564 Bacteria 9400
112 Ga0068857_101483792 3300005577 Bacteria 661
113 Ga0068854_100243135 3300005578 Bacteria 1434
114 Ga0068854_100362948 3300005578 Bacteria 1189
115 Ga0068856_100323952 3300005614 Bacteria 1558
116 Ga0068856_100664080 3300005614 Bacteria 1063
117 Ga0070702_100026216 3300005615 Bacteria 3130
118 Ga0068852_100110914 3300005616 Bacteria 2494
119 Ga0068852_101035679 3300005616 Unclassified 840
120 Ga0068859_100121369 3300005617 Bacteria 2680
121 Ga0068859_102273860 3300005617 Bacteria 598
122 Ga0068861_100073818 3300005719 Bacteria 2651
123 Ga0068861_100087683 3300005719 Bacteria 2449
124 Ga0068863_101500388 3300005841 Bacteria 683
125 Ga0068860_101887120 3300005843 Bacteria 619
126 Ga0081455_10004731 3300005937 Bacteria 15132
127 Ga0081455_10096513 3300005937 Bacteria 2383
128 Ga0081455_10174712 3300005937 Unclassified 1632
129 Ga0081455_10387453 3300005937 Unclassified 974
130 Ga0081455_10747959 3300005937 Unclassified 618
131 Ga0081538_10000844 3300005981 Bacteria 33145
132 Ga0081538_10001950 3300005981 Bacteria 20667
133 Ga0081538_10064536 3300005981 Unclassified 2070
134 Ga0081540_1001398 3300005983 Bacteria 20914
135 Ga0081540_1001700 3300005983 Bacteria 18669
136 Ga0081540_1016615 3300005983 Bacteria 4595
137 Ga0081539_10000541 3300005985 Bacteria 78036
138 Ga0081539_10012571 3300005985 Bacteria 6502
139 Ga0070717_10016594 3300006028 Bacteria 5713
140 Ga0070717_10420919 3300006028 Unclassified 1201
141 Ga0075363_100115908 3300006048 Bacteria 1492
142 Ga0075432_10067454 3300006058 Bacteria 1281
143 Ga0075432_10401158 3300006058 Bacteria 592
144 Ga0070715_10016879 3300006163 Bacteria 2752
145 Ga0070712_100512557 3300006175 Unclassified 1007
146 Ga0070712_100839713 3300006175 Bacteria 790
147 Ga0097621_102341491 3300006237 Unclassified 511
148 Ga0075428_100083027 3300006844 Bacteria 3496
149 Ga0075428_100099687 3300006844 Bacteria 3167
150 Ga0075428_100425875 3300006844 Bacteria 1422
151 Ga0075428_100444246 3300006844 Bacteria 1389
152 Ga0075428_101166408 3300006844 Bacteria 812
153 Ga0075428_101379985 3300006844 Unclassified 740
154 Ga0075430_100632087 3300006846 Unclassified 883
155 Ga0075431_101493933 3300006847 Bacteria 634
156 Ga0075433_10195247 3300006852 Bacteria 1800
157 Ga0075433_10941237 3300006852 Bacteria 753
158 Ga0068865_100274030 3300006881 Bacteria 1341
159 Ga0068865_101830195 3300006881 Bacteria 549
160 Ga0075436_100140768 3300006914 Bacteria 1695
161 Ga0097620_100121370 3300006931 Bacteria 2680
162 Ga0097620_102272717 3300006931 Bacteria 598
163 Ga0105240_10020921 3300009093 Bacteria 8711
164 Ga0111539_10003257 3300009094 Bacteria 21461
165 Ga0111539_10299100 3300009094 Bacteria 1873
166 Ga0111539_10694961 3300009094 Bacteria 1184
167 Ga0111539_10722796 3300009094 Bacteria 1159
168 Ga0111539_10995765 3300009094 Bacteria 974
169 Ga0105245_10027432 3300009098 Bacteria 5017
170 Ga0105245_10036124 3300009098 Bacteria 4388
171 Ga0105245_10145081 3300009098 Unclassified 2239
172 Ga0105245_10363659 3300009098 Unclassified 1437
173 Ga0105245_10430053 3300009098 Bacteria 1325
174 Ga0105245_10634414 3300009098 Bacteria 1097
175 Ga0105245_10793740 3300009098 Bacteria 985
176 Ga0105247_10137091 3300009101 Bacteria 1600
177 Ga0105247_10691783 3300009101 Bacteria 766
178 Ga0114129_10036426 3300009147 Bacteria 6947
179 Ga0114129_10422774 3300009147 Bacteria 1752
180 Ga0114129_10482960 3300009147 Bacteria 1621
181 Ga0114129_12294990 3300009147 Bacteria 648
182 Ga0105243_10170865 3300009148 Bacteria 1882
183 Ga0105243_10422284 3300009148 Bacteria 1244
184 Ga0105243_10912407 3300009148 Bacteria 875
185 Ga0105241_10785170 3300009174 Bacteria 876
186 Ga0105242_10297217 3300009176 Bacteria 1472
187 Ga0105242_10407873 3300009176 Bacteria 1270
188 Ga0105242_10775245 3300009176 Bacteria 946
189 Ga0105242_11324828 3300009176 Bacteria 745
190 Ga0105248_10923019 3300009177 Bacteria 986
191 Ga0105248_11329930 3300009177 Bacteria 813
192 Ga0105237_10023993 3300009545 Bacteria 6240
193 Ga0105237_10886193 3300009545 Bacteria 899
194 Ga0105238_10187920 3300009551 Bacteria 2042
195 Ga0105238_10616816 3300009551 Bacteria 1093
196 Ga0105238_10672792 3300009551 Bacteria 1046
197 Ga0105249_10349955 3300009553 Bacteria 1496
198 Ga0105249_10502059 3300009553 Bacteria 1258
199 Ga0105249_10523632 3300009553 Bacteria 1233
200 Ga0105239_10046916 3300010375 Bacteria 4733
201 Ga0105239_10099601 3300010375 Bacteria 3213
202 Ga0105239_10186515 3300010375 Bacteria 2321
203 Ga0105239_10223304 3300010375 Bacteria 2113
204 Ga0105239_10370887 3300010375 Bacteria 1618
205 Ga0105239_11490029 3300010375 Bacteria 782
206 Ga0105239_11602902 3300010375 Unclassified 753
207 Ga0105239_12310292 3300010375 Unclassified 626
208 Ga0105246_10205143 3300011119 Bacteria 1535
209 Ga0105246_10599923 3300011119 Bacteria 951
210 Ga0105246_10856968 3300011119 Bacteria 811
211 Ga0105246_11053610 3300011119 Bacteria 740
212 Ga0105246_12523735 3300011119 Bacteria 506
213 Ga0157370_10341102 3300013104 Bacteria 1381
214 Ga0157369_10139402 3300013105 Bacteria 2567
215 Ga0157369_10963601 3300013105 Bacteria 874
216 Ga0157374_10061328 3300013296 Bacteria 3522
217 Ga0157374_10276519 3300013296 Bacteria 1657
218 Ga0157374_10738003 3300013296 Bacteria 999
219 Ga0157374_11779554 3300013296 Unclassified 641
220 Ga0157374_11855144 3300013296 Bacteria 628
221 Ga0157378_10070695 3300013297 Bacteria 3134
222 Ga0157378_10410908 3300013297 Bacteria 1336
223 Ga0157378_10706800 3300013297 Bacteria 1028
224 Ga0157378_10984583 3300013297 Bacteria 877
225 Ga0157378_11151190 3300013297 Bacteria 814
226 Ga0157378_13108111 3300013297 Bacteria 515
227 Ga0163162_10514617 3300013306 Bacteria 1327
228 Ga0163162_10643786 3300013306 Unclassified 1184
229 Ga0163162_11096012 3300013306 Bacteria 902
230 Ga0163162_12943525 3300013306 Bacteria 548
231 Ga0163162_13464849 3300013306 Bacteria 502
232 Ga0157372_10020130 3300013307 Bacteria 7195
233 Ga0157372_10047137 3300013307 Bacteria 4787
234 Ga0157372_11934966 3300013307 Bacteria 678
235 Ga0157372_12381172 3300013307 Bacteria 608
236 Ga0157375_10035870 3300013308 Bacteria 4738
237 Ga0157375_10620166 3300013308 Bacteria 1240
238 Ga0157375_10678796 3300013308 Unclassified 1185
239 Ga0157375_10861870 3300013308 Bacteria 1052
240 Ga0157375_11123343 3300013308 Bacteria 920
241 Ga0157375_11624088 3300013308 Bacteria 764
242 Ga0163163_10019554 3300014325 Bacteria 6362
243 Ga0163163_10066920 3300014325 Bacteria 3570
244 Ga0163163_10271349 3300014325 Bacteria 1748
245 Ga0163163_10534406 3300014325 Bacteria 1235
246 Ga0157380_12603955 3300014326 Bacteria 572
247 Ga0157377_10003357 3300014745 Bacteria 7244
248 Ga0157377_10280204 3300014745 Unclassified 1092
249 Ga0157377_10352653 3300014745 Bacteria 988
250 Ga0157379_10007039 3300014968 Bacteria 9721
251 Ga0157379_10521720 3300014968 Bacteria 1103
252 Ga0157379_11262154 3300014968 Bacteria 712
253 Ga0157376_10277561 3300014969 Unclassified 1577
254 Ga0157376_10527702 3300014969 Bacteria 1165
255 Ga0163161_10324432 3300017792 Bacteria 1218
256 Ga0163161_10615066 3300017792 Bacteria 897
257 Ga0197907_11111691 3300020069 Bacteria 627
258 Ga0206356_10497091 3300020070 Bacteria 879
259 Ga0206356_10686161 3300020070 Bacteria 638
260 Ga0206356_10749534 3300020070 Bacteria 1631
261 Ga0206356_11032976 3300020070 Bacteria 538
262 Ga0206350_10217898 3300020080 Unclassified 588
263 Ga0206354_10826892 3300020081 Bacteria 1030
264 Ga0206353_11977449 3300020082 Bacteria 1395
265 Ga0213874_10107473 3300021377 Bacteria 934
266 Ga0207653_10041429 3300025885 Bacteria 1513
267 Ga0207653_10042627 3300025885 Unclassified 1493
268 Ga0207692_10333322 3300025898 Unclassified 931
269 Ga0207692_10340235 3300025898 Bacteria 923
270 Ga0207692_10391063 3300025898 Bacteria 865
271 Ga0207692_10424878 3300025898 Unclassified 832
272 Ga0207688_10070738 3300025901 Bacteria 1979
273 Ga0207647_10133997 3300025904 Bacteria 1455
274 Ga0207685_10200000 3300025905 Bacteria 938
275 Ga0207699_10283326 3300025906 Bacteria 1152
276 Ga0207699_10757071 3300025906 Unclassified 713
277 Ga0207699_11170424 3300025906 Bacteria 569
278 Ga0207684_10230630 3300025910 Bacteria 1597
279 Ga0207654_11434343 3300025911 Bacteria 503
280 Ga0207707_10071078 3300025912 Bacteria 3032
281 Ga0207707_10191662 3300025912 Bacteria 1783
282 Ga0207707_10238231 3300025912 Bacteria 1582
283 Ga0207707_10313572 3300025912 Bacteria 1355
284 Ga0207695_10023007 3300025913 Bacteria 7056
285 Ga0207671_10044510 3300025914 Bacteria 3283
286 Ga0207693_10019121 3300025915 Bacteria 5451
287 Ga0207663_10069716 3300025916 Bacteria 2263
288 Ga0207663_10206479 3300025916 Bacteria 1421
289 Ga0207663_10579759 3300025916 Bacteria 880
290 Ga0207663_11074777 3300025916 Unclassified 646
291 Ga0207660_10455037 3300025917 Bacteria 1035
292 Ga0207662_10237963 3300025918 Bacteria 1191
293 Ga0207657_10176152 3300025919 Bacteria 1731
294 Ga0207652_10069822 3300025921 Bacteria 3050
295 Ga0207652_10333115 3300025921 Bacteria 1370
296 Ga0207652_11457285 3300025921 Bacteria 588
297 Ga0207646_10098997 3300025922 Bacteria 2613
298 Ga0207646_10151286 3300025922 Bacteria 2093
299 Ga0207646_10270519 3300025922 Bacteria 1536
300 Ga0207681_10151795 3300025923 Bacteria 1737
301 Ga0207659_10222521 3300025926 Bacteria 1518
302 Ga0207687_10034131 3300025927 Bacteria 3454
303 Ga0207687_10167507 3300025927 Bacteria 1692
304 Ga0207687_10575430 3300025927 Bacteria 947
305 Ga0207687_10659287 3300025927 Bacteria 886
306 Ga0207687_10934234 3300025927 Bacteria 743
307 Ga0207664_10366476 3300025929 Bacteria 1277
308 Ga0207664_10695496 3300025929 Unclassified 914
309 Ga0207664_11148750 3300025929 Unclassified 693
310 Ga0207644_10807354 3300025931 Unclassified 785
311 Ga0207644_10950296 3300025931 Bacteria 721
312 Ga0207644_11021997 3300025931 Bacteria 694
313 Ga0207690_10134391 3300025932 Bacteria 1814
314 Ga0207706_10192783 3300025933 Bacteria 1788
315 Ga0207706_10805940 3300025933 Bacteria 797
316 Ga0207686_10133910 3300025934 Bacteria 1703
317 Ga0207686_10284630 3300025934 Bacteria 1222
318 Ga0207686_11038832 3300025934 Bacteria 666
319 Ga0207686_11648440 3300025934 Bacteria 530
320 Ga0207709_10466253 3300025935 Bacteria 979
321 Ga0207709_11145082 3300025935 Bacteria 640
322 Ga0207670_10556162 3300025936 Bacteria 938
323 Ga0207670_10680024 3300025936 Bacteria 851
324 Ga0207669_10857138 3300025937 Bacteria 756
325 Ga0207704_10164343 3300025938 Bacteria 1583
326 Ga0207704_11320787 3300025938 Bacteria 617
327 Ga0207704_11380108 3300025938 Bacteria 603
328 Ga0207711_10198685 3300025941 Bacteria 1829
329 Ga0207711_10969521 3300025941 Bacteria 789
330 Ga0207661_10002013 3300025944 Bacteria 14010
331 Ga0207661_10059017 3300025944 Bacteria 3090
332 Ga0207661_10176336 3300025944 Unclassified 1864
333 Ga0207661_10573965 3300025944 Bacteria 1034
334 Ga0207661_10668213 3300025944 Unclassified 955
335 Ga0207679_10123885 3300025945 Bacteria 2062
336 Ga0207667_10021462 3300025949 Bacteria 7154
337 Ga0207667_10602047 3300025949 Bacteria 1108
338 Ga0207651_10464549 3300025960 Bacteria 1088
339 Ga0207651_10643406 3300025960 Bacteria 930
340 Ga0207651_10727431 3300025960 Bacteria 876
341 Ga0207651_10768123 3300025960 Unclassified 853
342 Ga0207712_10233265 3300025961 Bacteria 1478
343 Ga0207712_11842196 3300025961 Bacteria 542
344 Ga0207640_11563949 3300025981 Unclassified 594
345 Ga0207658_11504036 3300025986 Bacteria 616
346 Ga0207677_10043442 3300026023 Bacteria 2988
347 Ga0207677_10044340 3300026023 Bacteria 2963
348 Ga0207677_10868501 3300026023 Unclassified 811
349 Ga0207639_10518691 3300026041 Bacteria 1091
350 Ga0207678_10295394 3300026067 Bacteria 1392
351 Ga0207708_10003292 3300026075 Bacteria 11884
352 Ga0207708_11109095 3300026075 Unclassified 690
353 Ga0207702_10239793 3300026078 Bacteria 1698
354 Ga0207641_11297656 3300026088 Bacteria 728
355 Ga0207648_10990001 3300026089 Bacteria 787
356 Ga0207648_11032551 3300026089 Bacteria 770
357 Ga0207676_10781649 3300026095 Bacteria 930
358 Ga0207674_10403963 3300026116 Bacteria 1320
359 Ga0207675_100032878 3300026118 Bacteria 4833
360 Ga0207675_101239899 3300026118 Bacteria 766
361 Ga0207683_10112179 3300026121 Bacteria 2442
362 Ga0207683_10162136 3300026121 Bacteria 2022
363 Ga0207698_10464180 3300026142 Bacteria 1225
364 Ga0207428_10008421 3300027907 Bacteria 9313
365 Ga0207428_11070873 3300027907 Unclassified 564
366 Ga0207428_11085667 3300027907 Unclassified 560
367 Ga0268266_10423571 3300028379 Bacteria 1262
368 Ga0268266_10706216 3300028379 Bacteria 972
369 Ga0268264_10136940 3300028381 Bacteria 2178
370 Ga0307413_11040015 3300031824 Bacteria 704
371 Ga0307410_11236201 3300031852 Unclassified 652
372 Ga0307410_11767820 3300031852 Unclassified 549
373 Ga0307406_10028373 3300031901 Bacteria 3382
374 Ga0307409_100034026 3300031995 Bacteria 3717
375 Ga0307409_100318890 3300031995 Bacteria 1454
376 Ga0307409_100571668 3300031995 Bacteria 1113
377 Ga0307409_101932996 3300031995 Bacteria 619
378 Ga0307416_100112937 3300032002 Bacteria 2399
379 Ga0307416_100613010 3300032002 Bacteria 1169
380 Ga0307415_100226814 3300032126 Bacteria 1502
381 Ga0307415_101387806 3300032126 Bacteria 668
382 Ga0307415_101933639 3300032126 Bacteria 573
383 Ga0373930_0108883 3300034816 Unclassified 665
384 Ga0373958_0002748 3300034819 Bacteria 2494
385 Ga0373940_0008275 3300035088 Bacteria 2381
386 Ga0373951_0012536 3300035091 Bacteria 1906
387 Ga0373952_0112693 3300035092 Unclassified 729
388 Ga0373932_0009931 3300035112 Bacteria 2295
389 Ga0373932_0013353 3300035112 Bacteria 2041
390 Ga0373939_0054771 3300035114 Bacteria 1250
391 Ga0373941_0031939 3300035115 Bacteria 1572
392 Ga0373960_0002723 3300035121 Bacteria 3996
393 Ga0373943_0791876 3300035170 Bacteria 564
394 Ga0373942_0006145 3300035207 Bacteria 2771
395 Ga0373961_0009287 3300035241 Bacteria 2404
396 Ga0373931_0000014 3300035691 Bacteria 251374
397 Ga0373927_0921520 3300035695 Bacteria 577
398 Ga0373937_0121922 3300036401 Bacteria 2430
399 Ga0395899_0062652 3300037312 Bacteria 2738
400 Ga0395900_0033588 3300037418 Bacteria 5279
401 Ga0395900_0065008 3300037418 Bacteria 3747
402 Ga0395900_0189231 3300037418 Bacteria 2089
403 Ga0395900_0573629 3300037418 Bacteria 1071
404 Ga0395900_1115935 3300037418 Unclassified 706
405 Ga0395900_1659874 3300037418 Bacteria 550
406 Ga0395898_0019617 3300037466 Bacteria 6879
407 Ga0395898_0065885 3300037466 Bacteria 3511
408 Ga0395898_0086138 3300037466 Unclassified 3028
409 Ga0395898_0276481 3300037466 Unclassified 1602
410 Ga0395898_0424568 3300037466 Bacteria 1267
411 Ga0395898_1252902 3300037466 Bacteria 672
412 Ga0395905_0011370 3300037471 Bacteria 8605
413 Ga0395905_0157405 3300037471 Bacteria 2136
414 Ga0395905_0747483 3300037471 Bacteria 880
415 Ga0395905_0823858 3300037471 Unclassified 831
416 Ga0395905_1293645 3300037471 Unclassified 633
417 Ga0395905_1684234 3300037471 Bacteria 539
418 Ga0395901_0037323 3300038443 Bacteria 5025
419 Ga0395901_0051021 3300038443 Bacteria 4299
420 Ga0395901_0062686 3300038443 Bacteria 3869
421 Ga0395901_0333293 3300038443 Bacteria 1568
422 Ga0395901_0505097 3300038443 Bacteria 1230
423 Ga0395901_0849411 3300038443 Unclassified 898
424 Ga0395901_1469280 3300038443 Bacteria 638
425 Ga0436363_1295799 3300039450 Bacteria 11753
426 Ga0436363_1591678 3300039450 Bacteria 2623
427 Ga0436362_0176266 3300039453 Bacteria 631
428 Ga0436362_0243673 3300039453 Bacteria 1754
429 Ga0451802_0395144 3300041460 Bacteria 550
430 Ga0451835_0039234 3300041492 Bacteria 546
431 Ga0451853_2556050 3300041512 Bacteria 2334
432 Ga0439450_124556 3300042008 Bacteria 665
433 Ga0439462_0217372 3300042015 Bacteria 546
434 Ga0450915_003992 3300042119 Unclassified 858
435 Ga0439464_0029606 3300042439 Bacteria 1531
436 Ga0439460_0180202 3300042461 Unclassified 714
437 Ga0439460_0221688 3300042461 Bacteria 648
438 Ga0439440_0037739 3300042993 Bacteria 1167
439 Ga0466965_0665844 3300044683 Unclassified 595
440 Ga0466966_0149056 3300044684 Unclassified 1427
441 Ga0466963_0003984 3300044694 Bacteria 8540
442 Ga0466963_0018266 3300044694 Bacteria 4380
443 Ga0466963_0029197 3300044694 Bacteria 3547
444 Ga0466963_0045055 3300044694 Bacteria 2904
445 Ga0466963_0255492 3300044694 Unclassified 1230
446 Ga0466963_0765167 3300044694 Bacteria 681
447 Ga0466964_0005565 3300044706 Bacteria 4679
448 Ga0466964_0015083 3300044706 Unclassified 2942
449 Ga0466968_0123408 3300044735 Bacteria 1173
450 Ga0466968_0244378 3300044735 Bacteria 851
451 Ga0466968_0469030 3300044735 Unclassified 624
452 Ga0466957_0062903 3300044842 Bacteria 2280
453 Ga0466957_0102693 3300044842 Unclassified 1804
454 Ga0466957_0447903 3300044842 Bacteria 889
455 Ga0466957_0665293 3300044842 Bacteria 733
456 Ga0466960_0098131 3300044901 Bacteria 1504
457 Ga0466960_0452641 3300044901 Bacteria 746
458 Ga0466958_0149855 3300045836 Bacteria 1471
459 Ga0466958_0154256 3300045836 Unclassified 1449
460 Ga0466958_0182333 3300045836 Unclassified 1332
461 Ga0466967_0001114 3300045976 Bacteria 14905
462 Ga0466967_0005198 3300045976 Bacteria 8962
463 Ga0466967_0059074 3300045976 Bacteria 3392
464 Ga0466967_0067907 3300045976 Bacteria 3181
465 Ga0466967_0092557 3300045976 Bacteria 2749
466 Ga0466967_0104724 3300045976 Bacteria 2590
467 Ga0466967_0126445 3300045976 Bacteria 2368
468 Ga0466967_0131298 3300045976 Unclassified 2325
469 Ga0466967_0181736 3300045976 Bacteria 1984
470 Ga0495592_0016697 3300046454 Bacteria 5571
471 Ga0495603_0709778 3300046455 Bacteria 575
472 Ga0495629_0397360 3300046459 Bacteria 937
473 Ga0495582_0303212 3300046473 Bacteria 918
474 Ga0495664_0425373 3300046477 Bacteria 796
475 Ga0495594_0627282 3300046499 Bacteria 609
476 Ga0495608_0104842 3300046511 Bacteria 1821
477 Ga0495630_0555936 3300046517 Bacteria 880
478 Ga0495640_0078002 3300046533 Bacteria 2207
479 Ga0495586_0392015 3300046535 Unclassified 799
480 Ga0495621_0134014 3300046539 Bacteria 965
481 Ga0495668_0543426 3300046616 Bacteria 641
482 Ga0495668_0794564 3300046616 Bacteria 524
483 Ga0495634_0146825 3300046642 Bacteria 1494
484 Ga0495634_0223570 3300046642 Unclassified 1161
485 Ga0495635_0016834 3300046663 Bacteria 5107
486 Ga0495623_0027159 3300046679 Bacteria 3681
487 Ga0495658_0021775 3300046683 Bacteria 3383
488 Ga0495613_0050728 3300046689 Bacteria 3060
489 Ga0495613_0537698 3300046689 Unclassified 783
490 Ga0495624_0032040 3300046690 Bacteria 3411
491 Ga0495589_0458350 3300046794 Unclassified 583
492 Ga0495604_0693502 3300047317 Bacteria 647
493 Ga0495676_0697972 3300047321 Bacteria 657
494 Ga0495602_0126712 3300048088 Bacteria 2044
495 Ga0496100_0081846 3300048903 Bacteria 2182
496 Ga0496101_0036559 3300048904 Bacteria 3479
497 Ga0496101_0054957 3300048904 Bacteria 2874
498 Ga0496102_0227360 3300048905 Bacteria 1759
499 Ga0496102_0349822 3300048905 Bacteria 1391
500 Ga0496102_1177925 3300048905 Bacteria 686
501 Ga0496102_1888151 3300048905 Bacteria 514
502 Ga0496103_0453813 3300048906 Bacteria 822
503 Ga0496103_0509771 3300048906 Bacteria 769
504 Ga0496103_0586659 3300048906 Bacteria 710
505 Ga0496103_0911224 3300048906 Unclassified 550
506 Ga0496104_0004812 3300048907 Bacteria 11766
507 Ga0496104_0036967 3300048907 Bacteria 4566
508 Ga0496104_0116219 3300048907 Bacteria 2567
509 Ga0496104_0187782 3300048907 Unclassified 1977
510 Ga0496105_0006364 3300048908 Bacteria 9070
511 Ga0496105_0016095 3300048908 Bacteria 5965
512 Ga0496105_0023888 3300048908 Bacteria 4964
513 Ga0496105_0031463 3300048908 Bacteria 4350
514 Ga0496105_0265573 3300048908 Bacteria 1387
515 Ga0496106_0246525 3300048909 Bacteria 1428
516 Ga0496106_0899839 3300048909 Unclassified 699
517 Ga0496106_0914706 3300048909 Bacteria 692
518 Ga0496107_0050696 3300048910 Unclassified 2993
519 Ga0496107_0411203 3300048910 Bacteria 1006
520 Ga0496107_1306697 3300048910 Unclassified 519
521 Ga0496108_0011666 3300048911 Bacteria 7150
522 Ga0496108_0029342 3300048911 Bacteria 4554
523 Ga0496108_0073146 3300048911 Bacteria 2894
524 Ga0496108_0455283 3300048911 Bacteria 1118
525 Ga0496108_0630338 3300048911 Bacteria 933
526 Ga0496109_0114438 3300048912 Bacteria 2509
527 Ga0496109_0118187 3300048912 Bacteria 2468
528 Ga0496109_0160999 3300048912 Bacteria 2103
529 Ga0496109_0298408 3300048912 Bacteria 1519
530 Ga0496109_0361436 3300048912 Bacteria 1371
531 Ga0496109_0606578 3300048912 Bacteria 1031
532 Ga0496109_0834944 3300048912 Bacteria 859
533 Ga0496110_0171992 3300048913 Bacteria 1965
534 Ga0496110_0341483 3300048913 Bacteria 1364
535 Ga0496110_0359610 3300048913 Bacteria 1326
536 Ga0496110_0620915 3300048913 Bacteria 979
537 Ga0496111_0327511 3300048914 Bacteria 1134
538 Ga0496111_0358438 3300048914 Bacteria 1079
539 Ga0496111_0429380 3300048914 Bacteria 976
540 Ga0496111_0759505 3300048914 Unclassified 703
541 Ga0496112_0224729 3300048915 Bacteria 1833
542 Ga0496112_0267552 3300048915 Unclassified 1658
543 Ga0496112_0372247 3300048915 Bacteria 1370
544 Ga0496112_0379622 3300048915 Bacteria 1354
545 Ga0496112_0522519 3300048915 Bacteria 1121
546 Ga0496112_0601875 3300048915 Unclassified 1031
547 Ga0496112_0686469 3300048915 Unclassified 952
548 Ga0496113_0119800 3300048916 Bacteria 2057
549 Ga0496113_0173327 3300048916 Bacteria 1709
550 Ga0496113_0190806 3300048916 Bacteria 1626
551 Ga0496113_0626643 3300048916 Bacteria 861
552 Ga0496113_0855535 3300048916 Bacteria 721
553 Ga0496113_1479492 3300048916 Unclassified 524
554 Ga0496113_1581220 3300048916 Bacteria 505
555 Ga0496114_0060727 3300048917 Bacteria 3160
556 Ga0496114_0105567 3300048917 Bacteria 2410
557 Ga0496114_0111971 3300048917 Bacteria 2340
558 Ga0496114_0228174 3300048917 Bacteria 1636
559 Ga0496114_0285638 3300048917 Bacteria 1455
560 Ga0496114_0510388 3300048917 Unclassified 1063
561 Ga0496114_0760950 3300048917 Unclassified 846
562 Ga0496115_0021882 3300048918 Bacteria 4944
563 Ga0496115_0643010 3300048918 Bacteria 839
564 Ga0496119_0051473 3300048922 Bacteria 2531
565 Ga0501040_0885549 3300049576 Bacteria 646
566 Ga0501041_0310130 3300049577 Bacteria 995
567 Ga0501042_0459989 3300049578 Bacteria 923
568 Ga0501042_0486307 3300049578 Bacteria 896
569 Ga0501048_0681828 3300049582 Bacteria 738
570 Ga0501067_0174040 3300049583 Bacteria 1199
571 Ga0501067_0336659 3300049583 Bacteria 841
572 Ga0501069_0851040 3300049585 Unclassified 554
573 Ga0501072_0801176 3300049588 Bacteria 738
574 Ga0501076_0360291 3300049592 Bacteria 1195
575 Ga0501077_0811955 3300049593 Bacteria 601
576 Ga0501080_1635731 3300049742 Bacteria 545
577 Ga0501083_0310407 3300049744 Bacteria 1026
578 Ga0501045_0484426 3300049824 Bacteria 919
579 nmdc:mga03n38_181115_c1 3300050490 Bacteria 1079
580 nmdc:mga0yw44_676280_c1 3300050492 Bacteria 701
581 nmdc:mga07m45_70884_c1 3300050496 Bacteria 1983
582 nmdc:mga05p37_342432_c1 3300050507 Bacteria 1763
583 nmdc:mga05p37_397947_c1 3300050507 Bacteria 1609
584 nmdc:mga05p37_6894_c1 3300050507 Bacteria 13392
585 nmdc:mga08y16_1071917_c1 3300050511 Unclassified 782
586 nmdc:mga08y16_1166219_c1 3300050511 Unclassified 742
587 nmdc:mga08y16_117616_c1 3300050511 Bacteria 2766
588 nmdc:mga08y16_31839_c1 3300050511 Bacteria 5546
589 nmdc:mga08y16_337670_c1 3300050511 Bacteria 1549
590 nmdc:mga08y16_544786_c1 3300050511 Bacteria 1175
591 nmdc:mga0n895_1899919_c1 3300050512 Bacteria 554
592 nmdc:mga0n895_486495_c1 3300050512 Bacteria 1244
593 nmdc:mga0n895_675157_c1 3300050512 Unclassified 1030
594 nmdc:mga0n895_722753_c1 3300050512 Unclassified 991
595 nmdc:mga0rr50_97761_c1 3300050513 Bacteria 2300
596 nmdc:mga08x19_114784_c1 3300050514 Bacteria 1800
597 nmdc:mga0a205_1249822_c1 3300050515 Bacteria 590
598 nmdc:mga0a205_18451_c1 3300050515 Bacteria 5535
599 Ga0495601_0990764 3300053077 Bacteria 529
600 Ga0495612_0079647 3300053078 Bacteria 1375
601 Ga0495619_0005313 3300053085 Bacteria 8158
602 Ga0495619_0598602 3300053085 Bacteria 754
603 Ga0501084_0155218 3300054114 Bacteria 1930
604 Ga0587075_026949 3300059644 Unclassified 892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10270519 Ga0207646_102705194 113
2 3300037418 Ga0395900_1659874 Ga0395900_1659874_103_468 113
3 3300037466 Ga0395898_0424568 Ga0395898_0424568_462_827 113
4 3300038443 Ga0395901_0333293 Ga0395901_0333293_744_1109 113
5 3300009148 Ga0105243_10422284 Ga0105243_104222843 114
6 3300005548 Ga0070665_100474348 Ga0070665_1004743482 115
7 3300013306 Ga0163162_13464849 Ga0163162_134648491 115
8 3300028379 Ga0268266_10423571 Ga0268266_104235712 115
9 3300041460 Ga0451802_0395144 Ga0451802_0395144_44_397 115
10 3300042008 Ga0439450_124556 Ga0439450_124556_10_363 115
11 3300042015 Ga0439462_0217372 Ga0439462_0217372_34_390 115
12 3300044901 Ga0466960_0452641 Ga0466960_0452641_162_515 115
13 3300005355 Ga0070671_100962270 Ga0070671_1009622702 116
14 3300005364 Ga0070673_101754380 Ga0070673_1017543801 116
15 3300005530 Ga0070679_100170394 Ga0070679_1001703945 116
16 3300005563 Ga0068855_100059770 Ga0068855_1000597704 116
17 3300005843 Ga0068860_101887120 Ga0068860_1018871202 116
18 3300013297 Ga0157378_10984583 Ga0157378_109845832 116
19 3300013307 Ga0157372_12381172 Ga0157372_123811722 116
20 3300014968 Ga0157379_11262154 Ga0157379_112621542 116
21 3300025931 Ga0207644_11021997 Ga0207644_110219972 116
22 3300025933 Ga0207706_10805940 Ga0207706_108059402 116
23 3300025949 Ga0207667_10021462 Ga0207667_100214625 116
24 3300025960 Ga0207651_10727431 Ga0207651_107274311 116
25 3300028381 Ga0268264_10136940 Ga0268264_101369402 116
26 3300031852 Ga0307410_11236201 Ga0307410_112362011 116
27 3300041512 Ga0451853_2556050 Ga0451853_2556050_413_772 116
28 3300048917 Ga0496114_0111971 Ga0496114_0111971_1462_1821 116
29 3300048917 Ga0496114_0228174 Ga0496114_0228174_355_714 116
30 3300049578 Ga0501042_0459989 Ga0501042_0459989_380_736 116
31 3300006844 Ga0075428_100425875 Ga0075428_1004258752 117
32 3300009094 Ga0111539_10995765 Ga0111539_109957652 117
33 3300027907 Ga0207428_11070873 Ga0207428_110708731 117
34 3300037312 Ga0395899_0062652 Ga0395899_0062652_1936_2295 117
35 3300037418 Ga0395900_0033588 Ga0395900_0033588_3132_3491 117
36 3300037466 Ga0395898_0019617 Ga0395898_0019617_2446_2805 117
37 3300037471 Ga0395905_0011370 Ga0395905_0011370_4651_5010 117
38 3300038443 Ga0395901_0051021 Ga0395901_0051021_801_1160 117
39 3300041492 Ga0451835_0039234 Ga0451835_0039234_65_424 117
40 3300048910 Ga0496107_1306697 Ga0496107_1306697_14_376 117
41 3300048914 Ga0496111_0358438 Ga0496111_0358438_598_954 117
42 3300050511 nmdc:mga08y16_1071917_c1 nmdc:mga08y16_1071917_c1_105_464 117
43 3300053077 Ga0495601_0990764 Ga0495601_0990764_81_440 117
44 3300002075 JGI24738J21930_10131921 JGI24738J21930_101319212 118
45 3300003203 JGI25406J46586_10006149 JGI25406J46586_100061496 118
46 3300003203 JGI25406J46586_10043888 JGI25406J46586_100438881 118
47 3300003320 rootH2_10104735 rootH2_101047352 118
48 3300003373 JGI25407J50210_10008961 JGI25407J50210_100089612 118
49 3300003373 JGI25407J50210_10065514 JGI25407J50210_100655141 118
50 3300003911 JGI25405J52794_10083242 JGI25405J52794_100832422 118
51 3300005327 Ga0070658_10241833 Ga0070658_102418331 118
52 3300005329 Ga0070683_100002057 Ga0070683_1000020579 118
53 3300005329 Ga0070683_100031484 Ga0070683_1000314842 118
54 3300005329 Ga0070683_100049127 Ga0070683_1000491274 118
55 3300005329 Ga0070683_100219259 Ga0070683_1002192591 118
56 3300005330 Ga0070690_100415874 Ga0070690_1004158742 118
57 3300005331 Ga0070670_101590914 Ga0070670_1015909141 118
58 3300005334 Ga0068869_100261663 Ga0068869_1002616632 118
59 3300005337 Ga0070682_100013450 Ga0070682_1000134502 118
60 3300005337 Ga0070682_100107240 Ga0070682_1001072403 118
61 3300005337 Ga0070682_100171311 Ga0070682_1001713113 118
62 3300005337 Ga0070682_100681780 Ga0070682_1006817802 118
63 3300005337 Ga0070682_101092975 Ga0070682_1010929751 118
64 3300005338 Ga0068868_100010124 Ga0068868_1000101246 118
65 3300005338 Ga0068868_100191722 Ga0068868_1001917224 118
66 3300005338 Ga0068868_100620130 Ga0068868_1006201302 118
67 3300005338 Ga0068868_101897144 Ga0068868_1018971441 118
68 3300005339 Ga0070660_100143502 Ga0070660_1001435023 118
69 3300005340 Ga0070689_100682058 Ga0070689_1006820582 118
70 3300005340 Ga0070689_100758501 Ga0070689_1007585011 118
71 3300005341 Ga0070691_10068253 Ga0070691_100682532 118
72 3300005341 Ga0070691_10108002 Ga0070691_101080022 118
73 3300005343 Ga0070687_100290419 Ga0070687_1002904192 118
74 3300005345 Ga0070692_10444885 Ga0070692_104448851 118
75 3300005345 Ga0070692_10454800 Ga0070692_104548002 118
76 3300005353 Ga0070669_100231351 Ga0070669_1002313513 118
77 3300005354 Ga0070675_100070420 Ga0070675_1000704202 118
78 3300005355 Ga0070671_100389341 Ga0070671_1003893411 118
79 3300005355 Ga0070671_100882581 Ga0070671_1008825812 118
80 3300005356 Ga0070674_100210042 Ga0070674_1002100421 118
81 3300005364 Ga0070673_100391751 Ga0070673_1003917511 118
82 3300005364 Ga0070673_100650455 Ga0070673_1006504552 118
83 3300005364 Ga0070673_101127613 Ga0070673_1011276131 118
84 3300005365 Ga0070688_100361077 Ga0070688_1003610771 118
85 3300005366 Ga0070659_100155253 Ga0070659_1001552533 118
86 3300005406 Ga0070703_10088173 Ga0070703_100881732 118
87 3300005434 Ga0070709_10036454 Ga0070709_100364543 118
88 3300005435 Ga0070714_100003676 Ga0070714_1000036765 118
89 3300005435 Ga0070714_100196843 Ga0070714_1001968433 118
90 3300005435 Ga0070714_100492769 Ga0070714_1004927691 118
91 3300005436 Ga0070713_100152544 Ga0070713_1001525442 118
92 3300005437 Ga0070710_10033144 Ga0070710_100331442 118
93 3300005437 Ga0070710_10252632 Ga0070710_102526322 118
94 3300005437 Ga0070710_10790316 Ga0070710_107903162 118
95 3300005437 Ga0070710_11032835 Ga0070710_110328351 118
96 3300005438 Ga0070701_10244510 Ga0070701_102445102 118
97 3300005438 Ga0070701_11298109 Ga0070701_112981091 118
98 3300005439 Ga0070711_100280678 Ga0070711_1002806782 118
99 3300005439 Ga0070711_100286287 Ga0070711_1002862872 118
100 3300005439 Ga0070711_100628194 Ga0070711_1006281941 118
101 3300005439 Ga0070711_101106155 Ga0070711_1011061551 118
102 3300005439 Ga0070711_101877633 Ga0070711_1018776331 118
103 3300005440 Ga0070705_100009732 Ga0070705_1000097327 118
104 3300005440 Ga0070705_100580851 Ga0070705_1005808511 118
105 3300005441 Ga0070700_100096545 Ga0070700_1000965453 118
106 3300005441 Ga0070700_100642372 Ga0070700_1006423721 118
107 3300005444 Ga0070694_100245703 Ga0070694_1002457031 118
108 3300005445 Ga0070708_100845712 Ga0070708_1008457121 118
109 3300005445 Ga0070708_102127005 Ga0070708_1021270051 118
110 3300005456 Ga0070678_100240157 Ga0070678_1002401572 118
111 3300005456 Ga0070678_101553093 Ga0070678_1015530931 118
112 3300005457 Ga0070662_100034216 Ga0070662_1000342163 118
113 3300005458 Ga0070681_10175648 Ga0070681_101756483 118
114 3300005458 Ga0070681_10178402 Ga0070681_101784022 118
115 3300005458 Ga0070681_10283177 Ga0070681_102831772 118
116 3300005459 Ga0068867_100000004 Ga0068867_10000000467 118
117 3300005459 Ga0068867_101227418 Ga0068867_1012274181 118
118 3300005459 Ga0068867_101832189 Ga0068867_1018321891 118
119 3300005459 Ga0068867_102236548 Ga0068867_1022365481 118
120 3300005466 Ga0070685_10313906 Ga0070685_103139062 118
121 3300005467 Ga0070706_100598273 Ga0070706_1005982731 118
122 3300005468 Ga0070707_100001787 Ga0070707_1000017876 118
123 3300005471 Ga0070698_100061353 Ga0070698_1000613535 118
124 3300005518 Ga0070699_100102021 Ga0070699_1001020212 118
125 3300005530 Ga0070679_100086131 Ga0070679_1000861313 118
126 3300005530 Ga0070679_100109351 Ga0070679_1001093514 118
127 3300005530 Ga0070679_100356497 Ga0070679_1003564972 118
128 3300005535 Ga0070684_100005226 Ga0070684_1000052262 118
129 3300005535 Ga0070684_100091306 Ga0070684_1000913064 118
130 3300005535 Ga0070684_100362749 Ga0070684_1003627492 118
131 3300005535 Ga0070684_100998826 Ga0070684_1009988261 118
132 3300005535 Ga0070684_101000682 Ga0070684_1010006822 118
133 3300005536 Ga0070697_100092725 Ga0070697_1000927253 118
134 3300005539 Ga0068853_100583075 Ga0068853_1005830752 118
135 3300005539 Ga0068853_101189669 Ga0068853_1011896692 118
136 3300005544 Ga0070686_100071682 Ga0070686_1000716821 118
137 3300005544 Ga0070686_101900145 Ga0070686_1019001451 118
138 3300005545 Ga0070695_100000109 Ga0070695_1000001093 118
139 3300005545 Ga0070695_100022855 Ga0070695_1000228551 118
140 3300005545 Ga0070695_100627568 Ga0070695_1006275682 118
141 3300005545 Ga0070695_101809521 Ga0070695_1018095211 118
142 3300005546 Ga0070696_100163046 Ga0070696_1001630462 118
143 3300005547 Ga0070693_100215334 Ga0070693_1002153342 118
144 3300005548 Ga0070665_100804111 Ga0070665_1008041111 118
145 3300005548 Ga0070665_101172831 Ga0070665_1011728312 118
146 3300005549 Ga0070704_100196339 Ga0070704_1001963392 118
147 3300005549 Ga0070704_100320497 Ga0070704_1003204972 118
148 3300005563 Ga0068855_100371095 Ga0068855_1003710952 118
149 3300005564 Ga0070664_100006534 Ga0070664_1000065349 118
150 3300005577 Ga0068857_101483792 Ga0068857_1014837922 118
151 3300005578 Ga0068854_100243135 Ga0068854_1002431351 118
152 3300005578 Ga0068854_100362948 Ga0068854_1003629483 118
153 3300005614 Ga0068856_100323952 Ga0068856_1003239522 118
154 3300005614 Ga0068856_100664080 Ga0068856_1006640802 118
155 3300005615 Ga0070702_100026216 Ga0070702_1000262162 118
156 3300005616 Ga0068852_100110914 Ga0068852_1001109143 118
157 3300005616 Ga0068852_101035679 Ga0068852_1010356791 118
158 3300005617 Ga0068859_100121369 Ga0068859_1001213693 118
159 3300005617 Ga0068859_102273860 Ga0068859_1022738602 118
160 3300005719 Ga0068861_100073818 Ga0068861_1000738182 118
161 3300005719 Ga0068861_100087683 Ga0068861_1000876832 118
162 3300005841 Ga0068863_101500388 Ga0068863_1015003882 118
163 3300005937 Ga0081455_10004731 Ga0081455_100047315 118
164 3300005937 Ga0081455_10096513 Ga0081455_100965132 118
165 3300005937 Ga0081455_10174712 Ga0081455_101747123 118
166 3300005937 Ga0081455_10387453 Ga0081455_103874531 118
167 3300005937 Ga0081455_10747959 Ga0081455_107479591 118
168 3300005981 Ga0081538_10000844 Ga0081538_1000084434 118
169 3300005981 Ga0081538_10001950 Ga0081538_1000195020 118
170 3300005981 Ga0081538_10064536 Ga0081538_100645362 118
171 3300005983 Ga0081540_1001398 Ga0081540_100139815 118
172 3300005983 Ga0081540_1001700 Ga0081540_10017003 118
173 3300005983 Ga0081540_1016615 Ga0081540_10166156 118
174 3300005985 Ga0081539_10000541 Ga0081539_1000054151 118
175 3300005985 Ga0081539_10012571 Ga0081539_100125713 118
176 3300006028 Ga0070717_10016594 Ga0070717_100165944 118
177 3300006028 Ga0070717_10420919 Ga0070717_104209192 118
178 3300006048 Ga0075363_100115908 Ga0075363_1001159082 118
179 3300006058 Ga0075432_10067454 Ga0075432_100674541 118
180 3300006058 Ga0075432_10401158 Ga0075432_104011582 118
181 3300006163 Ga0070715_10016879 Ga0070715_100168794 118
182 3300006175 Ga0070712_100512557 Ga0070712_1005125571 118
183 3300006175 Ga0070712_100839713 Ga0070712_1008397132 118
184 3300006237 Ga0097621_102341491 Ga0097621_1023414911 118
185 3300006844 Ga0075428_100083027 Ga0075428_1000830272 118
186 3300006844 Ga0075428_100099687 Ga0075428_1000996873 118
187 3300006844 Ga0075428_100444246 Ga0075428_1004442462 118
188 3300006844 Ga0075428_101166408 Ga0075428_1011664082 118
189 3300006844 Ga0075428_101379985 Ga0075428_1013799852 118
190 3300006846 Ga0075430_100632087 Ga0075430_1006320872 118
191 3300006847 Ga0075431_101493933 Ga0075431_1014939331 118
192 3300006852 Ga0075433_10195247 Ga0075433_101952471 118
193 3300006852 Ga0075433_10941237 Ga0075433_109412372 118
194 3300006881 Ga0068865_100274030 Ga0068865_1002740302 118
195 3300006881 Ga0068865_101830195 Ga0068865_1018301952 118
196 3300006914 Ga0075436_100140768 Ga0075436_1001407682 118
197 3300006931 Ga0097620_100121370 Ga0097620_1001213703 118
198 3300006931 Ga0097620_102272717 Ga0097620_1022727172 118
199 3300009093 Ga0105240_10020921 Ga0105240_100209212 118
200 3300009094 Ga0111539_10003257 Ga0111539_100032576 118
201 3300009094 Ga0111539_10299100 Ga0111539_102991003 118
202 3300009094 Ga0111539_10694961 Ga0111539_106949612 118
203 3300009094 Ga0111539_10722796 Ga0111539_107227961 118
204 3300009098 Ga0105245_10027432 Ga0105245_100274327 118
205 3300009098 Ga0105245_10036124 Ga0105245_100361243 118
206 3300009098 Ga0105245_10145081 Ga0105245_101450814 118
207 3300009098 Ga0105245_10363659 Ga0105245_103636592 118
208 3300009098 Ga0105245_10430053 Ga0105245_104300532 118
209 3300009098 Ga0105245_10634414 Ga0105245_106344142 118
210 3300009098 Ga0105245_10793740 Ga0105245_107937402 118
211 3300009101 Ga0105247_10137091 Ga0105247_101370913 118
212 3300009101 Ga0105247_10691783 Ga0105247_106917832 118
213 3300009147 Ga0114129_10036426 Ga0114129_100364267 118
214 3300009147 Ga0114129_10422774 Ga0114129_104227743 118
215 3300009147 Ga0114129_10482960 Ga0114129_104829603 118
216 3300009147 Ga0114129_12294990 Ga0114129_122949902 118
217 3300009148 Ga0105243_10170865 Ga0105243_101708652 118
218 3300009148 Ga0105243_10912407 Ga0105243_109124071 118
219 3300009174 Ga0105241_10785170 Ga0105241_107851702 118
220 3300009176 Ga0105242_10297217 Ga0105242_102972172 118
221 3300009176 Ga0105242_10407873 Ga0105242_104078732 118
222 3300009176 Ga0105242_10775245 Ga0105242_107752452 118
223 3300009176 Ga0105242_11324828 Ga0105242_113248282 118
224 3300009177 Ga0105248_10923019 Ga0105248_109230192 118
225 3300009177 Ga0105248_11329930 Ga0105248_113299301 118
226 3300009545 Ga0105237_10023993 Ga0105237_100239936 118
227 3300009545 Ga0105237_10886193 Ga0105237_108861932 118
228 3300009551 Ga0105238_10187920 Ga0105238_101879203 118
229 3300009551 Ga0105238_10616816 Ga0105238_106168163 118
230 3300009551 Ga0105238_10672792 Ga0105238_106727922 118
231 3300009553 Ga0105249_10349955 Ga0105249_103499552 118
232 3300009553 Ga0105249_10502059 Ga0105249_105020593 118
233 3300009553 Ga0105249_10523632 Ga0105249_105236322 118
234 3300010375 Ga0105239_10046916 Ga0105239_100469162 118
235 3300010375 Ga0105239_10099601 Ga0105239_100996013 118
236 3300010375 Ga0105239_10186515 Ga0105239_101865152 118
237 3300010375 Ga0105239_10223304 Ga0105239_102233043 118
238 3300010375 Ga0105239_10370887 Ga0105239_103708873 118
239 3300010375 Ga0105239_11490029 Ga0105239_114900292 118
240 3300010375 Ga0105239_11602902 Ga0105239_116029022 118
241 3300010375 Ga0105239_12310292 Ga0105239_123102921 118
242 3300011119 Ga0105246_10205143 Ga0105246_102051432 118
243 3300011119 Ga0105246_10599923 Ga0105246_105999231 118
244 3300011119 Ga0105246_10856968 Ga0105246_108569682 118
245 3300011119 Ga0105246_11053610 Ga0105246_110536102 118
246 3300011119 Ga0105246_12523735 Ga0105246_125237351 118
247 3300013104 Ga0157370_10341102 Ga0157370_103411021 118
248 3300013105 Ga0157369_10139402 Ga0157369_101394021 118
249 3300013105 Ga0157369_10963601 Ga0157369_109636011 118
250 3300013296 Ga0157374_10061328 Ga0157374_100613282 118
251 3300013296 Ga0157374_10276519 Ga0157374_102765193 118
252 3300013296 Ga0157374_10738003 Ga0157374_107380032 118
253 3300013296 Ga0157374_11779554 Ga0157374_117795541 118
254 3300013296 Ga0157374_11855144 Ga0157374_118551441 118
255 3300013297 Ga0157378_10070695 Ga0157378_100706954 118
256 3300013297 Ga0157378_10410908 Ga0157378_104109082 118
257 3300013297 Ga0157378_10706800 Ga0157378_107068002 118
258 3300013297 Ga0157378_11151190 Ga0157378_111511901 118
259 3300013297 Ga0157378_13108111 Ga0157378_131081111 118
260 3300013306 Ga0163162_10514617 Ga0163162_105146172 118
261 3300013306 Ga0163162_10643786 Ga0163162_106437862 118
262 3300013306 Ga0163162_11096012 Ga0163162_110960121 118
263 3300013306 Ga0163162_12943525 Ga0163162_129435252 118
264 3300013307 Ga0157372_10020130 Ga0157372_100201302 118
265 3300013307 Ga0157372_10047137 Ga0157372_100471372 118
266 3300013307 Ga0157372_11934966 Ga0157372_119349662 118
267 3300013308 Ga0157375_10035870 Ga0157375_100358703 118
268 3300013308 Ga0157375_10620166 Ga0157375_106201662 118
269 3300013308 Ga0157375_10678796 Ga0157375_106787961 118
270 3300013308 Ga0157375_10861870 Ga0157375_108618701 118
271 3300013308 Ga0157375_11123343 Ga0157375_111233431 118
272 3300013308 Ga0157375_11624088 Ga0157375_116240881 118
273 3300014325 Ga0163163_10019554 Ga0163163_100195546 118
274 3300014325 Ga0163163_10066920 Ga0163163_100669204 118
275 3300014325 Ga0163163_10271349 Ga0163163_102713492 118
276 3300014325 Ga0163163_10534406 Ga0163163_105344062 118
277 3300014326 Ga0157380_12603955 Ga0157380_126039551 118
278 3300014745 Ga0157377_10003357 Ga0157377_100033572 118
279 3300014745 Ga0157377_10280204 Ga0157377_102802042 118
280 3300014745 Ga0157377_10352653 Ga0157377_103526532 118
281 3300014968 Ga0157379_10007039 Ga0157379_100070396 118
282 3300014968 Ga0157379_10521720 Ga0157379_105217202 118
283 3300014969 Ga0157376_10277561 Ga0157376_102775611 118
284 3300014969 Ga0157376_10527702 Ga0157376_105277022 118
285 3300017792 Ga0163161_10324432 Ga0163161_103244321 118
286 3300017792 Ga0163161_10615066 Ga0163161_106150662 118
287 3300020069 Ga0197907_11111691 Ga0197907_111116911 118
288 3300020070 Ga0206356_10497091 Ga0206356_104970911 118
289 3300020070 Ga0206356_10686161 Ga0206356_106861612 118
290 3300020070 Ga0206356_10749534 Ga0206356_107495343 118
291 3300020070 Ga0206356_11032976 Ga0206356_110329761 118
292 3300020080 Ga0206350_10217898 Ga0206350_102178981 118
293 3300020081 Ga0206354_10826892 Ga0206354_108268922 118
294 3300020082 Ga0206353_11977449 Ga0206353_119774492 118
295 3300021377 Ga0213874_10107473 Ga0213874_101074733 118
296 3300025885 Ga0207653_10041429 Ga0207653_100414292 118
297 3300025885 Ga0207653_10042627 Ga0207653_100426273 118
298 3300025898 Ga0207692_10333322 Ga0207692_103333222 118
299 3300025898 Ga0207692_10340235 Ga0207692_103402352 118
300 3300025898 Ga0207692_10391063 Ga0207692_103910631 118
301 3300025898 Ga0207692_10424878 Ga0207692_104248782 118
302 3300025901 Ga0207688_10070738 Ga0207688_100707382 118
303 3300025904 Ga0207647_10133997 Ga0207647_101339971 118
304 3300025905 Ga0207685_10200000 Ga0207685_102000002 118
305 3300025906 Ga0207699_10283326 Ga0207699_102833262 118
306 3300025906 Ga0207699_10757071 Ga0207699_107570712 118
307 3300025906 Ga0207699_11170424 Ga0207699_111704242 118
308 3300025910 Ga0207684_10230630 Ga0207684_102306302 118
309 3300025911 Ga0207654_11434343 Ga0207654_114343431 118
310 3300025912 Ga0207707_10071078 Ga0207707_100710783 118
311 3300025912 Ga0207707_10191662 Ga0207707_101916621 118
312 3300025912 Ga0207707_10238231 Ga0207707_102382313 118
313 3300025912 Ga0207707_10313572 Ga0207707_103135722 118
314 3300025913 Ga0207695_10023007 Ga0207695_100230072 118
315 3300025914 Ga0207671_10044510 Ga0207671_100445102 118
316 3300025915 Ga0207693_10019121 Ga0207693_100191212 118
317 3300025916 Ga0207663_10069716 Ga0207663_100697163 118
318 3300025916 Ga0207663_10206479 Ga0207663_102064792 118
319 3300025916 Ga0207663_10579759 Ga0207663_105797591 118
320 3300025916 Ga0207663_11074777 Ga0207663_110747772 118
321 3300025917 Ga0207660_10455037 Ga0207660_104550372 118
322 3300025918 Ga0207662_10237963 Ga0207662_102379632 118
323 3300025919 Ga0207657_10176152 Ga0207657_101761521 118
324 3300025921 Ga0207652_10069822 Ga0207652_100698225 118
325 3300025921 Ga0207652_10333115 Ga0207652_103331153 118
326 3300025921 Ga0207652_11457285 Ga0207652_114572852 118
327 3300025922 Ga0207646_10098997 Ga0207646_100989973 118
328 3300025922 Ga0207646_10151286 Ga0207646_101512862 118
329 3300025923 Ga0207681_10151795 Ga0207681_101517952 118
330 3300025926 Ga0207659_10222521 Ga0207659_102225212 118
331 3300025927 Ga0207687_10034131 Ga0207687_100341316 118
332 3300025927 Ga0207687_10167507 Ga0207687_101675072 118
333 3300025927 Ga0207687_10575430 Ga0207687_105754302 118
334 3300025927 Ga0207687_10659287 Ga0207687_106592872 118
335 3300025927 Ga0207687_10934234 Ga0207687_109342342 118
336 3300025929 Ga0207664_10366476 Ga0207664_103664761 118
337 3300025929 Ga0207664_10695496 Ga0207664_106954962 118
338 3300025929 Ga0207664_11148750 Ga0207664_111487501 118
339 3300025931 Ga0207644_10807354 Ga0207644_108073541 118
340 3300025931 Ga0207644_10950296 Ga0207644_109502961 118
341 3300025932 Ga0207690_10134391 Ga0207690_101343912 118
342 3300025933 Ga0207706_10192783 Ga0207706_101927832 118
343 3300025934 Ga0207686_10133910 Ga0207686_101339104 118
344 3300025934 Ga0207686_10284630 Ga0207686_102846301 118
345 3300025934 Ga0207686_11038832 Ga0207686_110388321 118
346 3300025934 Ga0207686_11648440 Ga0207686_116484402 118
347 3300025935 Ga0207709_10466253 Ga0207709_104662531 118
348 3300025935 Ga0207709_11145082 Ga0207709_111450822 118
349 3300025936 Ga0207670_10556162 Ga0207670_105561622 118
350 3300025936 Ga0207670_10680024 Ga0207670_106800242 118
351 3300025937 Ga0207669_10857138 Ga0207669_108571382 118
352 3300025938 Ga0207704_10164343 Ga0207704_101643432 118
353 3300025938 Ga0207704_11320787 Ga0207704_113207872 118
354 3300025938 Ga0207704_11380108 Ga0207704_113801082 118
355 3300025941 Ga0207711_10198685 Ga0207711_101986852 118
356 3300025941 Ga0207711_10969521 Ga0207711_109695211 118
357 3300025944 Ga0207661_10002013 Ga0207661_1000201313 118
358 3300025944 Ga0207661_10059017 Ga0207661_100590172 118
359 3300025944 Ga0207661_10176336 Ga0207661_101763362 118
360 3300025944 Ga0207661_10573965 Ga0207661_105739652 118
361 3300025944 Ga0207661_10668213 Ga0207661_106682131 118
362 3300025945 Ga0207679_10123885 Ga0207679_101238852 118
363 3300025949 Ga0207667_10602047 Ga0207667_106020471 118
364 3300025960 Ga0207651_10464549 Ga0207651_104645492 118
365 3300025960 Ga0207651_10643406 Ga0207651_106434061 118
366 3300025960 Ga0207651_10768123 Ga0207651_107681231 118
367 3300025961 Ga0207712_10233265 Ga0207712_102332653 118
368 3300025961 Ga0207712_11842196 Ga0207712_118421961 118
369 3300025981 Ga0207640_11563949 Ga0207640_115639492 118
370 3300025986 Ga0207658_11504036 Ga0207658_115040362 118
371 3300026023 Ga0207677_10043442 Ga0207677_100434425 118
372 3300026023 Ga0207677_10044340 Ga0207677_100443402 118
373 3300026023 Ga0207677_10868501 Ga0207677_108685012 118
374 3300026041 Ga0207639_10518691 Ga0207639_105186912 118
375 3300026067 Ga0207678_10295394 Ga0207678_102953942 118
376 3300026075 Ga0207708_10003292 Ga0207708_1000329212 118
377 3300026075 Ga0207708_11109095 Ga0207708_111090952 118
378 3300026078 Ga0207702_10239793 Ga0207702_102397931 118
379 3300026088 Ga0207641_11297656 Ga0207641_112976562 118
380 3300026089 Ga0207648_10990001 Ga0207648_109900012 118
381 3300026089 Ga0207648_11032551 Ga0207648_110325512 118
382 3300026095 Ga0207676_10781649 Ga0207676_107816492 118
383 3300026116 Ga0207674_10403963 Ga0207674_104039632 118
384 3300026118 Ga0207675_100032878 Ga0207675_1000328782 118
385 3300026118 Ga0207675_101239899 Ga0207675_1012398992 118
386 3300026121 Ga0207683_10112179 Ga0207683_101121792 118
387 3300026121 Ga0207683_10162136 Ga0207683_101621362 118
388 3300026142 Ga0207698_10464180 Ga0207698_104641801 118
389 3300027907 Ga0207428_10008421 Ga0207428_100084216 118
390 3300027907 Ga0207428_11085667 Ga0207428_110856671 118
391 3300028379 Ga0268266_10706216 Ga0268266_107062162 118
392 3300031824 Ga0307413_11040015 Ga0307413_110400152 118
393 3300031852 Ga0307410_11767820 Ga0307410_117678201 118
394 3300031901 Ga0307406_10028373 Ga0307406_100283735 118
395 3300031995 Ga0307409_100034026 Ga0307409_1000340262 118
396 3300031995 Ga0307409_100318890 Ga0307409_1003188902 118
397 3300031995 Ga0307409_100571668 Ga0307409_1005716682 118
398 3300031995 Ga0307409_101932996 Ga0307409_1019329961 118
399 3300032002 Ga0307416_100112937 Ga0307416_1001129372 118
400 3300032002 Ga0307416_100613010 Ga0307416_1006130102 118
401 3300032126 Ga0307415_100226814 Ga0307415_1002268142 118
402 3300032126 Ga0307415_101387806 Ga0307415_1013878062 118
403 3300032126 Ga0307415_101933639 Ga0307415_1019336391 118
404 3300034816 Ga0373930_0108883 Ga0373930_0108883_48_410 118
405 3300034819 Ga0373958_0002748 Ga0373958_0002748_1046_1408 118
406 3300035088 Ga0373940_0008275 Ga0373940_0008275_1124_1486 118
407 3300035091 Ga0373951_0012536 Ga0373951_0012536_716_1078 118
408 3300035092 Ga0373952_0112693 Ga0373952_0112693_53_415 118
409 3300035112 Ga0373932_0009931 Ga0373932_0009931_1281_1646 118
410 3300035112 Ga0373932_0013353 Ga0373932_0013353_1003_1365 118
411 3300035114 Ga0373939_0054771 Ga0373939_0054771_638_1000 118
412 3300035115 Ga0373941_0031939 Ga0373941_0031939_896_1258 118
413 3300035121 Ga0373960_0002723 Ga0373960_0002723_2691_3053 118
414 3300035170 Ga0373943_0791876 Ga0373943_0791876_146_511 118
415 3300035207 Ga0373942_0006145 Ga0373942_0006145_1324_1686 118
416 3300035241 Ga0373961_0009287 Ga0373961_0009287_75_437 118
417 3300035691 Ga0373931_0000014 Ga0373931_0000014_3508_3873 118
418 3300035695 Ga0373927_0921520 Ga0373927_0921520_25_390 118
419 3300036401 Ga0373937_0121922 Ga0373937_0121922_952_1317 118
420 3300037418 Ga0395900_0065008 Ga0395900_0065008_1755_2117 118
421 3300037418 Ga0395900_0189231 Ga0395900_0189231_1717_2079 118
422 3300037418 Ga0395900_0573629 Ga0395900_0573629_83_448 118
423 3300037418 Ga0395900_1115935 Ga0395900_1115935_212_574 118
424 3300037466 Ga0395898_0065885 Ga0395898_0065885_2282_2644 118
425 3300037466 Ga0395898_0086138 Ga0395898_0086138_666_1028 118
426 3300037466 Ga0395898_0276481 Ga0395898_0276481_1037_1399 118
427 3300037466 Ga0395898_1252902 Ga0395898_1252902_88_453 118
428 3300037471 Ga0395905_0157405 Ga0395905_0157405_853_1215 118
429 3300037471 Ga0395905_0747483 Ga0395905_0747483_385_741 118
430 3300037471 Ga0395905_0823858 Ga0395905_0823858_299_661 118
431 3300037471 Ga0395905_1293645 Ga0395905_1293645_228_590 118
432 3300037471 Ga0395905_1684234 Ga0395905_1684234_108_470 118
433 3300038443 Ga0395901_0037323 Ga0395901_0037323_1245_1607 118
434 3300038443 Ga0395901_0062686 Ga0395901_0062686_1352_1717 118
435 3300038443 Ga0395901_0505097 Ga0395901_0505097_814_1176 118
436 3300038443 Ga0395901_0849411 Ga0395901_0849411_219_581 118
437 3300038443 Ga0395901_1469280 Ga0395901_1469280_230_592 118
438 3300039450 Ga0436363_1295799 Ga0436363_1295799_496_858 118
439 3300039450 Ga0436363_1591678 Ga0436363_1591678_1892_2254 118
440 3300039453 Ga0436362_0176266 Ga0436362_0176266_258_620 118
441 3300039453 Ga0436362_0243673 Ga0436362_0243673_1215_1577 118
442 3300042119 Ga0450915_003992 Ga0450915_003992_162_524 118
443 3300042439 Ga0439464_0029606 Ga0439464_0029606_548_910 118
444 3300042461 Ga0439460_0180202 Ga0439460_0180202_304_666 118
445 3300042461 Ga0439460_0221688 Ga0439460_0221688_233_595 118
446 3300042993 Ga0439440_0037739 Ga0439440_0037739_65_427 118
447 3300044683 Ga0466965_0665844 Ga0466965_0665844_40_402 118
448 3300044684 Ga0466966_0149056 Ga0466966_0149056_24_386 118
449 3300044694 Ga0466963_0003984 Ga0466963_0003984_948_1313 118
450 3300044694 Ga0466963_0018266 Ga0466963_0018266_386_751 118
451 3300044694 Ga0466963_0029197 Ga0466963_0029197_3036_3401 118
452 3300044694 Ga0466963_0045055 Ga0466963_0045055_2069_2434 118
453 3300044694 Ga0466963_0255492 Ga0466963_0255492_345_707 118
454 3300044694 Ga0466963_0765167 Ga0466963_0765167_20_382 118
455 3300044706 Ga0466964_0005565 Ga0466964_0005565_575_940 118
456 3300044706 Ga0466964_0015083 Ga0466964_0015083_721_1086 118
457 3300044735 Ga0466968_0123408 Ga0466968_0123408_310_675 118
458 3300044735 Ga0466968_0244378 Ga0466968_0244378_377_739 118
459 3300044735 Ga0466968_0469030 Ga0466968_0469030_114_479 118
460 3300044842 Ga0466957_0062903 Ga0466957_0062903_462_827 118
461 3300044842 Ga0466957_0102693 Ga0466957_0102693_972_1337 118
462 3300044842 Ga0466957_0447903 Ga0466957_0447903_424_789 118
463 3300044842 Ga0466957_0665293 Ga0466957_0665293_187_552 118
464 3300044901 Ga0466960_0098131 Ga0466960_0098131_177_542 118
465 3300045836 Ga0466958_0149855 Ga0466958_0149855_443_808 118
466 3300045836 Ga0466958_0154256 Ga0466958_0154256_130_495 118
467 3300045836 Ga0466958_0182333 Ga0466958_0182333_581_943 118
468 3300045976 Ga0466967_0001114 Ga0466967_0001114_669_1031 118
469 3300045976 Ga0466967_0005198 Ga0466967_0005198_6658_7023 118
470 3300045976 Ga0466967_0059074 Ga0466967_0059074_1670_2035 118
471 3300045976 Ga0466967_0067907 Ga0466967_0067907_2024_2389 118
472 3300045976 Ga0466967_0092557 Ga0466967_0092557_2357_2713 118
473 3300045976 Ga0466967_0104724 Ga0466967_0104724_1727_2092 118
474 3300045976 Ga0466967_0126445 Ga0466967_0126445_1761_2126 118
475 3300045976 Ga0466967_0131298 Ga0466967_0131298_1814_2179 118
476 3300045976 Ga0466967_0181736 Ga0466967_0181736_1193_1558 118
477 3300046454 Ga0495592_0016697 Ga0495592_0016697_1210_1575 118
478 3300046455 Ga0495603_0709778 Ga0495603_0709778_168_533 118
479 3300046459 Ga0495629_0397360 Ga0495629_0397360_271_636 118
480 3300046473 Ga0495582_0303212 Ga0495582_0303212_283_648 118
481 3300046477 Ga0495664_0425373 Ga0495664_0425373_348_713 118
482 3300046499 Ga0495594_0627282 Ga0495594_0627282_87_452 118
483 3300046511 Ga0495608_0104842 Ga0495608_0104842_197_562 118
484 3300046517 Ga0495630_0555936 Ga0495630_0555936_319_681 118
485 3300046533 Ga0495640_0078002 Ga0495640_0078002_1316_1681 118
486 3300046535 Ga0495586_0392015 Ga0495586_0392015_382_744 118
487 3300046539 Ga0495621_0134014 Ga0495621_0134014_33_395 118
488 3300046616 Ga0495668_0543426 Ga0495668_0543426_240_602 118
489 3300046616 Ga0495668_0794564 Ga0495668_0794564_146_508 118
490 3300046642 Ga0495634_0146825 Ga0495634_0146825_489_854 118
491 3300046642 Ga0495634_0223570 Ga0495634_0223570_707_1069 118
492 3300046663 Ga0495635_0016834 Ga0495635_0016834_494_856 118
493 3300046679 Ga0495623_0027159 Ga0495623_0027159_2345_2710 118
494 3300046683 Ga0495658_0021775 Ga0495658_0021775_2174_2539 118
495 3300046689 Ga0495613_0050728 Ga0495613_0050728_679_1044 118
496 3300046689 Ga0495613_0537698 Ga0495613_0537698_94_456 118
497 3300046690 Ga0495624_0032040 Ga0495624_0032040_2533_2898 118
498 3300046794 Ga0495589_0458350 Ga0495589_0458350_151_513 118
499 3300047317 Ga0495604_0693502 Ga0495604_0693502_36_398 118
500 3300047321 Ga0495676_0697972 Ga0495676_0697972_240_605 118
501 3300048088 Ga0495602_0126712 Ga0495602_0126712_694_1059 118
502 3300048903 Ga0496100_0081846 Ga0496100_0081846_932_1288 118
503 3300048904 Ga0496101_0036559 Ga0496101_0036559_2469_2825 118
504 3300048904 Ga0496101_0054957 Ga0496101_0054957_75_437 118
505 3300048905 Ga0496102_0227360 Ga0496102_0227360_1232_1597 118
506 3300048905 Ga0496102_0349822 Ga0496102_0349822_456_812 118
507 3300048905 Ga0496102_1177925 Ga0496102_1177925_313_669 118
508 3300048905 Ga0496102_1888151 Ga0496102_1888151_47_409 118
509 3300048906 Ga0496103_0453813 Ga0496103_0453813_18_383 118
510 3300048906 Ga0496103_0509771 Ga0496103_0509771_387_743 118
511 3300048906 Ga0496103_0586659 Ga0496103_0586659_240_605 118
512 3300048906 Ga0496103_0911224 Ga0496103_0911224_86_448 118
513 3300048907 Ga0496104_0004812 Ga0496104_0004812_3665_4027 118
514 3300048907 Ga0496104_0036967 Ga0496104_0036967_2668_3024 118
515 3300048907 Ga0496104_0116219 Ga0496104_0116219_515_871 118
516 3300048907 Ga0496104_0187782 Ga0496104_0187782_1220_1582 118
517 3300048908 Ga0496105_0006364 Ga0496105_0006364_7542_7904 118
518 3300048908 Ga0496105_0016095 Ga0496105_0016095_4550_4906 118
519 3300048908 Ga0496105_0023888 Ga0496105_0023888_438_800 118
520 3300048908 Ga0496105_0031463 Ga0496105_0031463_1319_1675 118
521 3300048908 Ga0496105_0265573 Ga0496105_0265573_607_963 118
522 3300048909 Ga0496106_0246525 Ga0496106_0246525_682_1038 118
523 3300048909 Ga0496106_0899839 Ga0496106_0899839_305_670 118
524 3300048909 Ga0496106_0914706 Ga0496106_0914706_263_667 118
525 3300048910 Ga0496107_0050696 Ga0496107_0050696_2215_2619 118
526 3300048910 Ga0496107_0411203 Ga0496107_0411203_463_819 118
527 3300048911 Ga0496108_0011666 Ga0496108_0011666_1309_1671 118
528 3300048911 Ga0496108_0029342 Ga0496108_0029342_2833_3189 118
529 3300048911 Ga0496108_0073146 Ga0496108_0073146_998_1354 118
530 3300048911 Ga0496108_0455283 Ga0496108_0455283_241_597 118
531 3300048911 Ga0496108_0630338 Ga0496108_0630338_203_568 118
532 3300048912 Ga0496109_0114438 Ga0496109_0114438_350_706 118
533 3300048912 Ga0496109_0118187 Ga0496109_0118187_552_914 118
534 3300048912 Ga0496109_0160999 Ga0496109_0160999_960_1316 118
535 3300048912 Ga0496109_0298408 Ga0496109_0298408_1001_1357 118
536 3300048912 Ga0496109_0361436 Ga0496109_0361436_961_1323 118
537 3300048912 Ga0496109_0606578 Ga0496109_0606578_406_771 118
538 3300048912 Ga0496109_0834944 Ga0496109_0834944_42_404 118
539 3300048913 Ga0496110_0171992 Ga0496110_0171992_1122_1478 118
540 3300048913 Ga0496110_0341483 Ga0496110_0341483_678_1046 118
541 3300048913 Ga0496110_0359610 Ga0496110_0359610_745_1107 118
542 3300048913 Ga0496110_0620915 Ga0496110_0620915_31_387 118
543 3300048914 Ga0496111_0327511 Ga0496111_0327511_468_830 118
544 3300048914 Ga0496111_0429380 Ga0496111_0429380_18_380 118
545 3300048914 Ga0496111_0759505 Ga0496111_0759505_115_480 118
546 3300048915 Ga0496112_0224729 Ga0496112_0224729_524_886 118
547 3300048915 Ga0496112_0267552 Ga0496112_0267552_103_465 118
548 3300048915 Ga0496112_0372247 Ga0496112_0372247_490_855 118
549 3300048915 Ga0496112_0379622 Ga0496112_0379622_738_1094 118
550 3300048915 Ga0496112_0522519 Ga0496112_0522519_185_541 118
551 3300048915 Ga0496112_0601875 Ga0496112_0601875_324_689 118
552 3300048915 Ga0496112_0686469 Ga0496112_0686469_545_910 118
553 3300048916 Ga0496113_0119800 Ga0496113_0119800_784_1146 118
554 3300048916 Ga0496113_0173327 Ga0496113_0173327_657_1013 118
555 3300048916 Ga0496113_0190806 Ga0496113_0190806_1027_1383 118
556 3300048916 Ga0496113_0626643 Ga0496113_0626643_412_777 118
557 3300048916 Ga0496113_0855535 Ga0496113_0855535_33_395 118
558 3300048916 Ga0496113_1479492 Ga0496113_1479492_89_451 118
559 3300048916 Ga0496113_1581220 Ga0496113_1581220_127_492 118
560 3300048917 Ga0496114_0060727 Ga0496114_0060727_785_1141 118
561 3300048917 Ga0496114_0105567 Ga0496114_0105567_1409_1774 118
562 3300048917 Ga0496114_0285638 Ga0496114_0285638_39_401 118
563 3300048917 Ga0496114_0510388 Ga0496114_0510388_280_642 118
564 3300048917 Ga0496114_0760950 Ga0496114_0760950_300_668 118
565 3300048918 Ga0496115_0021882 Ga0496115_0021882_4115_4477 118
566 3300048918 Ga0496115_0643010 Ga0496115_0643010_155_511 118
567 3300048922 Ga0496119_0051473 Ga0496119_0051473_1966_2361 118
568 3300049576 Ga0501040_0885549 Ga0501040_0885549_113_475 118
569 3300049577 Ga0501041_0310130 Ga0501041_0310130_34_396 118
570 3300049578 Ga0501042_0486307 Ga0501042_0486307_136_498 118
571 3300049582 Ga0501048_0681828 Ga0501048_0681828_288_644 118
572 3300049583 Ga0501067_0174040 Ga0501067_0174040_132_494 118
573 3300049583 Ga0501067_0336659 Ga0501067_0336659_280_642 118
574 3300049585 Ga0501069_0851040 Ga0501069_0851040_115_477 118
575 3300049588 Ga0501072_0801176 Ga0501072_0801176_93_455 118
576 3300049592 Ga0501076_0360291 Ga0501076_0360291_334_696 118
577 3300049593 Ga0501077_0811955 Ga0501077_0811955_37_399 118
578 3300049742 Ga0501080_1635731 Ga0501080_1635731_65_448 118
579 3300049744 Ga0501083_0310407 Ga0501083_0310407_334_696 118
580 3300049824 Ga0501045_0484426 Ga0501045_0484426_13_375 118
581 3300050490 nmdc:mga03n38_181115_c1 nmdc:mga03n38_181115_c1_671_1033 118
582 3300050492 nmdc:mga0yw44_676280_c1 nmdc:mga0yw44_676280_c1_24_386 118
583 3300050496 nmdc:mga07m45_70884_c1 nmdc:mga07m45_70884_c1_1541_1909 118
584 3300050507 nmdc:mga05p37_342432_c1 nmdc:mga05p37_342432_c1_933_1295 118
585 3300050507 nmdc:mga05p37_397947_c1 nmdc:mga05p37_397947_c1_122_484 118
586 3300050507 nmdc:mga05p37_6894_c1 nmdc:mga05p37_6894_c1_7122_7484 118
587 3300050511 nmdc:mga08y16_1166219_c1 nmdc:mga08y16_1166219_c1_263_640 118
588 3300050511 nmdc:mga08y16_117616_c1 nmdc:mga08y16_117616_c1_718_1074 118
589 3300050511 nmdc:mga08y16_31839_c1 nmdc:mga08y16_31839_c1_1852_2214 118
590 3300050511 nmdc:mga08y16_337670_c1 nmdc:mga08y16_337670_c1_42_404 118
591 3300050511 nmdc:mga08y16_544786_c1 nmdc:mga08y16_544786_c1_39_401 118
592 3300050512 nmdc:mga0n895_1899919_c1 nmdc:mga0n895_1899919_c1_19_381 118
593 3300050512 nmdc:mga0n895_486495_c1 nmdc:mga0n895_486495_c1_300_656 118
594 3300050512 nmdc:mga0n895_675157_c1 nmdc:mga0n895_675157_c1_192_554 118
595 3300050512 nmdc:mga0n895_722753_c1 nmdc:mga0n895_722753_c1_580_942 118
596 3300050513 nmdc:mga0rr50_97761_c1 nmdc:mga0rr50_97761_c1_1257_1619 118
597 3300050514 nmdc:mga08x19_114784_c1 nmdc:mga08x19_114784_c1_872_1234 118
598 3300050515 nmdc:mga0a205_1249822_c1 nmdc:mga0a205_1249822_c1_165_521 118
599 3300050515 nmdc:mga0a205_18451_c1 nmdc:mga0a205_18451_c1_979_1341 118
600 3300053078 Ga0495612_0079647 Ga0495612_0079647_469_834 118
601 3300053085 Ga0495619_0005313 Ga0495619_0005313_4007_4369 118
602 3300053085 Ga0495619_0598602 Ga0495619_0598602_61_423 118
603 3300054114 Ga0501084_0155218 Ga0501084_0155218_818_1180 118
604 3300059644 Ga0587075_026949 Ga0587075_026949_304_705 118

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.7724 20 110
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.7636 4 110
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.7575 31 110
6xcv-assembly1.cif.gz_B crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7553 30 110
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.7553 30 110
ID Description Score Start End Superfamily
af_Q59WJ5_1_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7722 56 110 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7603 18 110 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.759 14 108 2.60.120.10
af_P42624_12_133_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.758 33 108 2.60.120.10
af_P0A9U6_79_184_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7535 14 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1F3X417-F1-model_v4 Cupin 0.9986 10 117
AF-A0A538EBJ9-F1-model_v4 Cupin domain-containing protein 0.9983 38 110
AF-A0A4R0KSB1-F1-model_v4 Cupin 0.9943 3 118
AF-A0A1Q7G2M2-F1-model_v4 Cupin 0.9936 4 117
AF-D0J0C6-F1-model_v4 deleted 0.9933 24 117

Feature Viewer

pLDDT pTM Quality
96.3 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map