F468342

General Info

Members Datasets Scaffolds Average Seq Length
604 231 1208 91

Family's Representative Sequence

Representative Sequence 3300001978|JGI24747J21853_1010384|JGI24747J21853_10103842
Length 105
Sequence MPSPSWPSSRKHDRRVRIDRFLFFIRLVKSRTIAQXVIDEGHVRIDGRRVGKSSEEVRVGSVVALPLRGEVRILRVLGLPARRGPAGEARACYEELTEANPRPSE

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
195 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
196 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
197 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 3.81
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1010384 3300001978 Bacteria 931
2 JGI24740J21852_10002524 3300001979 Bacteria 8262
3 JGI24740J21852_10011151 3300001979 Bacteria 3431
4 JGI24739J22299_10012202 3300001989 Bacteria 3154
5 JGI24739J22299_10146310 3300001989 Bacteria 699
6 JGI24737J22298_10000287 3300001990 Bacteria 16786
7 JGI24737J22298_10168072 3300001990 Bacteria 647
8 JGI24743J22301_10044473 3300001991 Bacteria 896
9 JGI24743J22301_10154285 3300001991 Unclassified 516
10 JGI24735J21928_10111578 3300002067 Bacteria 787
11 JGI24750J21931_1023521 3300002070 Bacteria 875
12 JGI24745J21846_1015157 3300002073 Bacteria 892
13 JGI24738J21930_10001143 3300002075 Bacteria 7487
14 JGI24738J21930_10002981 3300002075 Bacteria 4326
15 JGI24738J21930_10064519 3300002075 Bacteria 754
16 JGI24744J21845_10000108 3300002077 Bacteria 11169
17 JGI24744J21845_10016891 3300002077 Bacteria 1451
18 JGI24035J26624_1010412 3300002126 Bacteria 924
19 JGI24034J26672_10011752 3300002239 Bacteria 1315
20 JGI24742J22300_10042822 3300002244 Bacteria 809
21 Ga0065712_10222415 3300005290 Bacteria 1037
22 Ga0065715_10288954 3300005293 Bacteria 1068
23 Ga0065715_10602275 3300005293 Bacteria 690
24 Ga0070658_10123077 3300005327 Bacteria 2156
25 Ga0070658_10325669 3300005327 Bacteria 1312
26 Ga0070676_10010897 3300005328 Bacteria 4937
27 Ga0070676_10668795 3300005328 Bacteria 755
28 Ga0070676_11084188 3300005328 Bacteria 605
29 Ga0070683_100310551 3300005329 Bacteria 1500
30 Ga0070683_101795326 3300005329 Bacteria 589
31 Ga0070690_100004002 3300005330 Bacteria 8152
32 Ga0070690_100004780 3300005330 Bacteria 7554
33 Ga0070690_101121419 3300005330 Bacteria 625
34 Ga0070690_101231156 3300005330 Bacteria 598
35 Ga0070670_100008058 3300005331 Bacteria 8963
36 Ga0070670_100009600 3300005331 Bacteria 8259
37 Ga0070670_100041316 3300005331 Bacteria 3964
38 Ga0070670_100103950 3300005331 Bacteria 2447
39 Ga0070670_100193758 3300005331 Bacteria 1765
40 Ga0070677_10500220 3300005333 Bacteria 659
41 Ga0068869_100021006 3300005334 Bacteria 4487
42 Ga0068869_100090194 3300005334 Bacteria 2303
43 Ga0068869_101734385 3300005334 Bacteria 558
44 Ga0070666_10004110 3300005335 Bacteria 8831
45 Ga0070666_10026484 3300005335 Bacteria 3789
46 Ga0070666_10031644 3300005335 Bacteria 3493
47 Ga0070666_10872541 3300005335 Bacteria 665
48 Ga0070680_100000367 3300005336 Bacteria 30338
49 Ga0070682_100211111 3300005337 Bacteria 1376
50 Ga0068868_100000259 3300005338 Bacteria 36003
51 Ga0068868_100080745 3300005338 Bacteria 2606
52 Ga0068868_100619528 3300005338 Bacteria 961
53 Ga0068868_102097171 3300005338 Bacteria 538
54 Ga0070660_100003560 3300005339 Bacteria 10754
55 Ga0070660_100022446 3300005339 Bacteria 4667
56 Ga0070660_100117962 3300005339 Bacteria 2116
57 Ga0070660_100282036 3300005339 Bacteria 1359
58 Ga0070660_100402093 3300005339 Bacteria 1133
59 Ga0070660_100416200 3300005339 Bacteria 1112
60 Ga0070689_100100634 3300005340 Bacteria 2287
61 Ga0070689_100827181 3300005340 Bacteria 816
62 Ga0070687_100086138 3300005343 Bacteria 1726
63 Ga0070687_100280333 3300005343 Bacteria 1049
64 Ga0070687_100444727 3300005343 Bacteria 861
65 Ga0070687_101087824 3300005343 Unclassified 584
66 Ga0070687_101244375 3300005343 Bacteria 551
67 Ga0070661_100016752 3300005344 Bacteria 5188
68 Ga0070661_100027518 3300005344 Bacteria 4095
69 Ga0070661_100033750 3300005344 Bacteria 3709
70 Ga0070661_100099576 3300005344 Bacteria 2160
71 Ga0070661_100237404 3300005344 Bacteria 1403
72 Ga0070661_100568956 3300005344 Bacteria 914
73 Ga0070668_100009183 3300005347 Bacteria 7332
74 Ga0070668_101041667 3300005347 Bacteria 737
75 Ga0070669_100000174 3300005353 Bacteria 56290
76 Ga0070669_100163621 3300005353 Bacteria 1731
77 Ga0070669_100732679 3300005353 Bacteria 837
78 Ga0070675_100020924 3300005354 Bacteria 5224
79 Ga0070675_100120485 3300005354 Bacteria 2229
80 Ga0070675_100217577 3300005354 Bacteria 1662
81 Ga0070675_100404177 3300005354 Bacteria 1219
82 Ga0070675_100481105 3300005354 Bacteria 1117
83 Ga0070671_100014703 3300005355 Bacteria 6325
84 Ga0070671_100122509 3300005355 Bacteria 2188
85 Ga0070671_100150577 3300005355 Bacteria 1964
86 Ga0070671_101401149 3300005355 Bacteria 617
87 Ga0070674_100037685 3300005356 Bacteria 3253
88 Ga0070674_100086021 3300005356 Bacteria 2257
89 Ga0070674_100106771 3300005356 Bacteria 2049
90 Ga0070673_100000163 3300005364 Bacteria 32129
91 Ga0070673_100001364 3300005364 Bacteria 14272
92 Ga0070673_100011759 3300005364 Bacteria 5986
93 Ga0070673_100433907 3300005364 Bacteria 1180
94 Ga0070688_100414489 3300005365 Bacteria 1000
95 Ga0070659_100001133 3300005366 Bacteria 19443
96 Ga0070659_100023608 3300005366 Bacteria 4709
97 Ga0070659_100104008 3300005366 Bacteria 2287
98 Ga0070659_100608623 3300005366 Bacteria 939
99 Ga0070659_100694527 3300005366 Bacteria 879
100 Ga0070659_100705848 3300005366 Bacteria 872
101 Ga0070659_101281336 3300005366 Bacteria 650
102 Ga0070667_100002428 3300005367 Bacteria 16297
103 Ga0070667_100002967 3300005367 Bacteria 14582
104 Ga0070667_100019816 3300005367 Bacteria 5581
105 Ga0070667_100024019 3300005367 Bacteria 5063
106 Ga0070714_100875069 3300005435 Bacteria 872
107 Ga0070713_100362033 3300005436 Bacteria 1348
108 Ga0070710_11158530 3300005437 Bacteria 570
109 Ga0070663_100099559 3300005455 Bacteria 2167
110 Ga0070663_100134176 3300005455 Bacteria 1883
111 Ga0070663_100152380 3300005455 Bacteria 1773
112 Ga0070663_100285906 3300005455 Bacteria 1316
113 Ga0070663_101012896 3300005455 Bacteria 723
114 Ga0070678_100018388 3300005456 Bacteria 4528
115 Ga0070678_100066517 3300005456 Bacteria 2679
116 Ga0070662_100000478 3300005457 Bacteria 23734
117 Ga0070662_100000764 3300005457 Bacteria 19778
118 Ga0070662_100002675 3300005457 Bacteria 11001
119 Ga0070662_100086450 3300005457 Bacteria 2345
120 Ga0070662_100543884 3300005457 Bacteria 972
121 Ga0070662_100873404 3300005457 Bacteria 766
122 Ga0070681_11068920 3300005458 Bacteria 728
123 Ga0068867_100002891 3300005459 Bacteria 12082
124 Ga0068867_100025034 3300005459 Bacteria 4280
125 Ga0068867_102136855 3300005459 Bacteria 531
126 Ga0070685_11143381 3300005466 Bacteria 590
127 Ga0070679_100394102 3300005530 Bacteria 1331
128 Ga0070679_100606907 3300005530 Bacteria 1037
129 Ga0070679_100698339 3300005530 Bacteria 957
130 Ga0070684_100006144 3300005535 Bacteria 9259
131 Ga0070684_100941452 3300005535 Bacteria 810
132 Ga0068853_100000404 3300005539 Bacteria 29662
133 Ga0068853_100086191 3300005539 Bacteria 2754
134 Ga0068853_100238209 3300005539 Bacteria 1667
135 Ga0070672_100001335 3300005543 Bacteria 15211
136 Ga0070672_100005799 3300005543 Bacteria 8237
137 Ga0070672_100123870 3300005543 Bacteria 2119
138 Ga0070672_100745166 3300005543 Bacteria 859
139 Ga0070672_101852814 3300005543 Bacteria 543
140 Ga0070686_100111343 3300005544 Bacteria 1866
141 Ga0070686_100308194 3300005544 Bacteria 1177
142 Ga0070696_100003860 3300005546 Bacteria 10007
143 Ga0070696_100192740 3300005546 Bacteria 1517
144 Ga0070693_100049023 3300005547 Bacteria 2407
145 Ga0070693_100159150 3300005547 Bacteria 1437
146 Ga0070665_100061283 3300005548 Bacteria 3771
147 Ga0070665_100096941 3300005548 Bacteria 2954
148 Ga0070665_100208145 3300005548 Bacteria 1957
149 Ga0070704_101130449 3300005549 Unclassified 712
150 Ga0068855_100002608 3300005563 Bacteria 22213
151 Ga0068855_100078173 3300005563 Bacteria 3839
152 Ga0068855_100397347 3300005563 Bacteria 1511
153 Ga0070664_100015659 3300005564 Bacteria 6205
154 Ga0070664_100041274 3300005564 Bacteria 3893
155 Ga0070664_100310205 3300005564 Bacteria 1427
156 Ga0070664_101431306 3300005564 Bacteria 653
157 Ga0068857_100012569 3300005577 Bacteria 7374
158 Ga0068857_100124996 3300005577 Bacteria 2317
159 Ga0068857_100180788 3300005577 Bacteria 1919
160 Ga0068857_100475545 3300005577 Bacteria 1170
161 Ga0068857_101627494 3300005577 Bacteria 631
162 Ga0068854_100002515 3300005578 Bacteria 11375
163 Ga0068854_100045872 3300005578 Bacteria 3110
164 Ga0068854_100049682 3300005578 Bacteria 2997
165 Ga0068854_100175219 3300005578 Bacteria 1671
166 Ga0068854_101343588 3300005578 Bacteria 644
167 Ga0068856_100052611 3300005614 Bacteria 4016
168 Ga0068856_101219194 3300005614 Bacteria 769
169 Ga0068856_101514184 3300005614 Bacteria 685
170 Ga0068856_101819132 3300005614 Bacteria 621
171 Ga0068852_100019729 3300005616 Bacteria 5344
172 Ga0068852_100057101 3300005616 Bacteria 3376
173 Ga0068852_100074829 3300005616 Bacteria 2984
174 Ga0068852_100963223 3300005616 Bacteria 871
175 Ga0068852_101287494 3300005616 Bacteria 753
176 Ga0068852_101893324 3300005616 Bacteria 619
177 Ga0068859_100001530 3300005617 Bacteria 23586
178 Ga0068859_100016966 3300005617 Bacteria 7308
179 Ga0068864_100000174 3300005618 Bacteria 59338
180 Ga0068864_100006777 3300005618 Bacteria 9377
181 Ga0068864_100060290 3300005618 Bacteria 3285
182 Ga0068866_10061939 3300005718 Bacteria 1945
183 Ga0068866_10340517 3300005718 Bacteria 950
184 Ga0068861_100472667 3300005719 Bacteria 1128
185 Ga0068851_10019850 3300005834 Bacteria 3248
186 Ga0068851_10035969 3300005834 Bacteria 2478
187 Ga0068851_10218545 3300005834 Bacteria 1070
188 Ga0068870_10316862 3300005840 Bacteria 990
189 Ga0068870_10752532 3300005840 Unclassified 677
190 Ga0068870_10914659 3300005840 Bacteria 621
191 Ga0068863_100001532 3300005841 Bacteria 22851
192 Ga0068863_100003026 3300005841 Bacteria 16622
193 Ga0068863_100023513 3300005841 Bacteria 5883
194 Ga0068863_100639516 3300005841 Bacteria 1054
195 Ga0068863_101187358 3300005841 Bacteria 769
196 Ga0068858_100000600 3300005842 Bacteria 37662
197 Ga0068858_100012586 3300005842 Bacteria 7975
198 Ga0068858_100036867 3300005842 Bacteria 4533
199 Ga0068858_100590920 3300005842 Bacteria 1076
200 Ga0068858_101197023 3300005842 Bacteria 747
201 Ga0068860_100015621 3300005843 Bacteria 7414
202 Ga0068860_100126264 3300005843 Bacteria 2452
203 Ga0068860_100194268 3300005843 Bacteria 1965
204 Ga0068862_100041957 3300005844 Bacteria 3895
205 Ga0068862_100102117 3300005844 Bacteria 2510
206 Ga0070717_10140099 3300006028 Bacteria 2086
207 Ga0070717_11422497 3300006028 Bacteria 630
208 Ga0075364_10784667 3300006051 Bacteria 650
209 Ga0070716_100435760 3300006173 Bacteria 951
210 Ga0070712_100032575 3300006175 Bacteria 3520
211 Ga0097621_100010641 3300006237 Bacteria 6741
212 Ga0097621_100275562 3300006237 Bacteria 1479
213 Ga0097621_102197246 3300006237 Bacteria 528
214 Ga0068871_100002926 3300006358 Bacteria 11718
215 Ga0068871_100007891 3300006358 Bacteria 7632
216 Ga0068871_100476847 3300006358 Bacteria 1122
217 Ga0068871_101595360 3300006358 Bacteria 618
218 Ga0068865_100018624 3300006881 Bacteria 4483
219 Ga0068865_100026174 3300006881 Bacteria 3844
220 Ga0068865_100127271 3300006881 Bacteria 1903
221 Ga0068865_101853673 3300006881 Bacteria 545
222 Ga0097620_100001530 3300006931 Bacteria 23586
223 Ga0097620_100016966 3300006931 Bacteria 7308
224 Ga0105240_10459525 3300009093 Bacteria 1423
225 Ga0105240_10581976 3300009093 Bacteria 1235
226 Ga0111539_10020475 3300009094 Bacteria 8146
227 Ga0105245_10000229 3300009098 Bacteria 53255
228 Ga0105245_10008820 3300009098 Bacteria 8798
229 Ga0105245_10070554 3300009098 Bacteria 3171
230 Ga0105247_10057266 3300009101 Bacteria 2409
231 Ga0105247_10588584 3300009101 Bacteria 823
232 Ga0105247_11095358 3300009101 Bacteria 628
233 Ga0105243_10053065 3300009148 Bacteria 3214
234 Ga0105243_11944306 3300009148 Bacteria 622
235 Ga0105243_12015750 3300009148 Bacteria 612
236 Ga0105243_12608936 3300009148 Bacteria 545
237 Ga0105241_10011061 3300009174 Bacteria 6620
238 Ga0105241_11600070 3300009174 Bacteria 630
239 Ga0105242_10026312 3300009176 Bacteria 4611
240 Ga0105242_10180837 3300009176 Bacteria 1860
241 Ga0105242_10468976 3300009176 Bacteria 1191
242 Ga0105248_10001163 3300009177 Bacteria 29385
243 Ga0105248_10005337 3300009177 Bacteria 14146
244 Ga0105248_10010506 3300009177 Bacteria 10195
245 Ga0105248_10018730 3300009177 Bacteria 7655
246 Ga0105248_10158252 3300009177 Bacteria 2556
247 Ga0105238_10026372 3300009551 Bacteria 5924
248 Ga0105238_10080782 3300009551 Bacteria 3240
249 Ga0105238_12936417 3300009551 Bacteria 513
250 Ga0105249_10201465 3300009553 Bacteria 1948
251 Ga0105239_10625693 3300010375 Bacteria 1228
252 Ga0105246_10039419 3300011119 Bacteria 3182
253 Ga0105246_10628722 3300011119 Bacteria 931
254 Ga0157315_1025918 3300012508 Bacteria 654
255 Ga0157373_10196676 3300013100 Bacteria 1421
256 Ga0157373_10484502 3300013100 Bacteria 892
257 Ga0157373_10769789 3300013100 Bacteria 708
258 Ga0157373_11087925 3300013100 Bacteria 599
259 Ga0157373_11281613 3300013100 Bacteria 554
260 Ga0157373_11285060 3300013100 Bacteria 554
261 Ga0157371_10005265 3300013102 Bacteria 10964
262 Ga0157371_10035371 3300013102 Bacteria 3579
263 Ga0157371_10071845 3300013102 Bacteria 2450
264 Ga0157371_10124781 3300013102 Bacteria 1831
265 Ga0157371_10663034 3300013102 Bacteria 779
266 Ga0157370_10311975 3300013104 Bacteria 1451
267 Ga0157370_10985140 3300013104 Bacteria 763
268 Ga0157369_10005876 3300013105 Bacteria 14258
269 Ga0157369_10020524 3300013105 Bacteria 7386
270 Ga0157369_10152379 3300013105 Bacteria 2443
271 Ga0157369_10499005 3300013105 Bacteria 1259
272 Ga0157374_10002169 3300013296 Bacteria 16548
273 Ga0157374_10036547 3300013296 Bacteria 4500
274 Ga0157378_10057057 3300013297 Bacteria 3480
275 Ga0157378_10235413 3300013297 Bacteria 1747
276 Ga0157378_10311231 3300013297 Bacteria 1527
277 Ga0157378_12852999 3300013297 Unclassified 536
278 Ga0163162_10013794 3300013306 Bacteria 7893
279 Ga0163162_10038198 3300013306 Bacteria 4792
280 Ga0163162_10052192 3300013306 Bacteria 4106
281 Ga0157372_10059224 3300013307 Bacteria 4283
282 Ga0157372_12212927 3300013307 Unclassified 632
283 Ga0157372_12757287 3300013307 Bacteria 564
284 Ga0157375_10009327 3300013308 Bacteria 8616
285 Ga0157375_10416194 3300013308 Bacteria 1510
286 Ga0157375_10535948 3300013308 Bacteria 1333
287 Ga0157375_10918845 3300013308 Bacteria 1018
288 Ga0163163_10004903 3300014325 Bacteria 11507
289 Ga0163163_10115621 3300014325 Bacteria 2714
290 Ga0163163_10319783 3300014325 Bacteria 1605
291 Ga0163163_10751380 3300014325 Bacteria 1039
292 Ga0163163_10985261 3300014325 Unclassified 906
293 Ga0157380_10129068 3300014326 Bacteria 2154
294 Ga0157380_10768231 3300014326 Bacteria 977
295 Ga0157377_10045012 3300014745 Bacteria 2464
296 Ga0157377_10114445 3300014745 Bacteria 1626
297 Ga0157377_11019817 3300014745 Bacteria 628
298 Ga0157379_10022637 3300014968 Bacteria 5568
299 Ga0157379_10807333 3300014968 Bacteria 886
300 Ga0157379_11038522 3300014968 Bacteria 783
301 Ga0157376_10016991 3300014969 Bacteria 5539
302 Ga0207673_1000907 3300025290 Bacteria 3191
303 Ga0207697_10012028 3300025315 Bacteria 3642
304 Ga0207697_10015485 3300025315 Bacteria 3150
305 Ga0207656_10012783 3300025321 Bacteria 3195
306 Ga0207656_10023279 3300025321 Bacteria 2493
307 Ga0207682_10014848 3300025893 Bacteria 3034
308 Ga0207682_10096037 3300025893 Bacteria 1291
309 Ga0207692_10621125 3300025898 Bacteria 696
310 Ga0207642_10015279 3300025899 Bacteria 2856
311 Ga0207642_10060582 3300025899 Bacteria 1756
312 Ga0207710_10326361 3300025900 Bacteria 779
313 Ga0207688_10000143 3300025901 Bacteria 30382
314 Ga0207688_10243014 3300025901 Bacteria 1089
315 Ga0207680_10053981 3300025903 Bacteria 2415
316 Ga0207680_10196369 3300025903 Bacteria 1372
317 Ga0207680_10526238 3300025903 Bacteria 843
318 Ga0207680_10989134 3300025903 Bacteria 602
319 Ga0207647_10000090 3300025904 Bacteria 69395
320 Ga0207647_10028521 3300025904 Bacteria 3623
321 Ga0207647_10493225 3300025904 Bacteria 683
322 Ga0207699_10229011 3300025906 Bacteria 1272
323 Ga0207645_10004608 3300025907 Bacteria 10159
324 Ga0207645_10649482 3300025907 Bacteria 717
325 Ga0207645_10858979 3300025907 Bacteria 617
326 Ga0207645_10910500 3300025907 Bacteria 597
327 Ga0207643_10018668 3300025908 Bacteria 3798
328 Ga0207643_10363312 3300025908 Bacteria 910
329 Ga0207705_10018190 3300025909 Bacteria 5024
330 Ga0207705_10706028 3300025909 Bacteria 784
331 Ga0207705_10748234 3300025909 Bacteria 759
332 Ga0207684_10383366 3300025910 Bacteria 1209
333 Ga0207654_10206625 3300025911 Bacteria 1296
334 Ga0207707_10285201 3300025912 Bacteria 1429
335 Ga0207695_10371171 3300025913 Bacteria 1317
336 Ga0207660_10000614 3300025917 Bacteria 24044
337 Ga0207660_10368508 3300025917 Bacteria 1153
338 Ga0207662_10011804 3300025918 Bacteria 4855
339 Ga0207662_10142866 3300025918 Bacteria 1517
340 Ga0207662_10519744 3300025918 Bacteria 821
341 Ga0207657_10042845 3300025919 Bacteria 3991
342 Ga0207657_10151353 3300025919 Bacteria 1890
343 Ga0207657_10357030 3300025919 Bacteria 1152
344 Ga0207649_10107279 3300025920 Bacteria 1859
345 Ga0207649_10164649 3300025920 Bacteria 1539
346 Ga0207649_10455544 3300025920 Bacteria 966
347 Ga0207649_10520984 3300025920 Bacteria 906
348 Ga0207649_10823800 3300025920 Bacteria 725
349 Ga0207652_10301794 3300025921 Bacteria 1445
350 Ga0207652_10445274 3300025921 Bacteria 1168
351 Ga0207652_10988089 3300025921 Bacteria 740
352 Ga0207681_10032670 3300025923 Bacteria 3408
353 Ga0207681_11166985 3300025923 Bacteria 647
354 Ga0207694_10059964 3300025924 Bacteria 2960
355 Ga0207694_10139457 3300025924 Bacteria 1949
356 Ga0207650_10014741 3300025925 Bacteria 5433
357 Ga0207650_11385120 3300025925 Bacteria 598
358 Ga0207659_10010923 3300025926 Bacteria 5718
359 Ga0207659_10181427 3300025926 Bacteria 1668
360 Ga0207659_10186573 3300025926 Bacteria 1647
361 Ga0207687_10006429 3300025927 Bacteria 7761
362 Ga0207687_10027491 3300025927 Bacteria 3818
363 Ga0207644_10002984 3300025931 Bacteria 10885
364 Ga0207644_10011021 3300025931 Bacteria 5971
365 Ga0207644_10020073 3300025931 Bacteria 4539
366 Ga0207644_10122596 3300025931 Bacteria 1981
367 Ga0207644_10465093 3300025931 Bacteria 1040
368 Ga0207690_10018347 3300025932 Bacteria 4290
369 Ga0207690_10162856 3300025932 Bacteria 1664
370 Ga0207690_10165094 3300025932 Bacteria 1654
371 Ga0207690_11129478 3300025932 Bacteria 653
372 Ga0207706_10001308 3300025933 Bacteria 25000
373 Ga0207706_10017629 3300025933 Bacteria 6433
374 Ga0207706_10073051 3300025933 Bacteria 3016
375 Ga0207706_10666263 3300025933 Bacteria 890
376 Ga0207706_10824393 3300025933 Bacteria 787
377 Ga0207686_10098680 3300025934 Bacteria 1945
378 Ga0207686_11185295 3300025934 Bacteria 625
379 Ga0207709_10014603 3300025935 Bacteria 4340
380 Ga0207709_10430428 3300025935 Bacteria 1015
381 Ga0207709_10534424 3300025935 Bacteria 920
382 Ga0207670_10059064 3300025936 Bacteria 2608
383 Ga0207669_10130395 3300025937 Bacteria 1726
384 Ga0207669_10138755 3300025937 Bacteria 1684
385 Ga0207669_10231055 3300025937 Bacteria 1364
386 Ga0207704_10021529 3300025938 Bacteria 3436
387 Ga0207704_10127739 3300025938 Bacteria 1754
388 Ga0207704_10306699 3300025938 Bacteria 1218
389 Ga0207704_11473575 3300025938 Bacteria 584
390 Ga0207665_10204328 3300025939 Bacteria 1440
391 Ga0207691_10000045 3300025940 Bacteria 99798
392 Ga0207691_10010279 3300025940 Bacteria 8977
393 Ga0207691_10112469 3300025940 Bacteria 2420
394 Ga0207691_10799613 3300025940 Bacteria 793
395 Ga0207711_10003169 3300025941 Bacteria 14343
396 Ga0207711_10004266 3300025941 Bacteria 12216
397 Ga0207711_10006858 3300025941 Bacteria 9567
398 Ga0207711_10056316 3300025941 Bacteria 3378
399 Ga0207711_10227886 3300025941 Bacteria 1706
400 Ga0207711_11532116 3300025941 Bacteria 610
401 Ga0207689_10000226 3300025942 Bacteria 50110
402 Ga0207689_10068497 3300025942 Bacteria 2917
403 Ga0207661_10333763 3300025944 Bacteria 1365
404 Ga0207661_10336815 3300025944 Bacteria 1359
405 Ga0207679_10013292 3300025945 Bacteria 5395
406 Ga0207679_10237376 3300025945 Bacteria 1543
407 Ga0207679_11186921 3300025945 Bacteria 700
408 Ga0207667_10184487 3300025949 Bacteria 2142
409 Ga0207667_10225489 3300025949 Bacteria 1920
410 Ga0207667_10791956 3300025949 Bacteria 945
411 Ga0207667_11826184 3300025949 Bacteria 571
412 Ga0207651_10000700 3300025960 Bacteria 14344
413 Ga0207651_10003870 3300025960 Bacteria 7431
414 Ga0207651_10206402 3300025960 Bacteria 1578
415 Ga0207651_10664899 3300025960 Bacteria 915
416 Ga0207668_10023177 3300025972 Bacteria 3985
417 Ga0207668_11008314 3300025972 Bacteria 744
418 Ga0207640_10006845 3300025981 Bacteria 6267
419 Ga0207640_10080862 3300025981 Bacteria 2220
420 Ga0207640_10346899 3300025981 Bacteria 1191
421 Ga0207640_10830620 3300025981 Bacteria 802
422 Ga0207658_10006979 3300025986 Bacteria 7688
423 Ga0207658_10009475 3300025986 Bacteria 6607
424 Ga0207658_10168150 3300025986 Bacteria 1803
425 Ga0207658_10550323 3300025986 Bacteria 1032
426 Ga0207677_10003664 3300026023 Bacteria 8157
427 Ga0207677_10010397 3300026023 Bacteria 5263
428 Ga0207677_10267156 3300026023 Bacteria 1397
429 Ga0207703_10007076 3300026035 Bacteria 8928
430 Ga0207703_10043616 3300026035 Bacteria 3601
431 Ga0207703_10058642 3300026035 Bacteria 3142
432 Ga0207703_10083694 3300026035 Bacteria 2666
433 Ga0207639_10031613 3300026041 Bacteria 3891
434 Ga0207639_10072586 3300026041 Bacteria 2695
435 Ga0207639_10342415 3300026041 Bacteria 1333
436 Ga0207639_10355320 3300026041 Bacteria 1310
437 Ga0207639_11037806 3300026041 Bacteria 768
438 Ga0207639_12037195 3300026041 Bacteria 535
439 Ga0207678_10049795 3300026067 Bacteria 3620
440 Ga0207678_10055784 3300026067 Bacteria 3403
441 Ga0207678_10124759 3300026067 Bacteria 2197
442 Ga0207678_10316745 3300026067 Bacteria 1342
443 Ga0207678_10559518 3300026067 Bacteria 1001
444 Ga0207678_10804648 3300026067 Bacteria 830
445 Ga0207678_11434500 3300026067 Bacteria 610
446 Ga0207702_10018224 3300026078 Bacteria 5808
447 Ga0207641_10023275 3300026088 Bacteria 5104
448 Ga0207641_10084421 3300026088 Bacteria 2764
449 Ga0207641_10160985 3300026088 Bacteria 2040
450 Ga0207641_11067043 3300026088 Bacteria 806
451 Ga0207648_10000222 3300026089 Bacteria 61156
452 Ga0207648_10002834 3300026089 Bacteria 18389
453 Ga0207648_10015675 3300026089 Bacteria 6958
454 Ga0207676_10002840 3300026095 Bacteria 12326
455 Ga0207676_10003330 3300026095 Bacteria 11399
456 Ga0207676_10184459 3300026095 Bacteria 1830
457 Ga0207676_10314412 3300026095 Bacteria 1435
458 Ga0207676_10315132 3300026095 Bacteria 1433
459 Ga0207674_10000793 3300026116 Bacteria 41212
460 Ga0207674_10024280 3300026116 Bacteria 6481
461 Ga0207675_100125933 3300026118 Bacteria 2426
462 Ga0207675_100130166 3300026118 Bacteria 2386
463 Ga0207675_100621626 3300026118 Bacteria 1085
464 Ga0207683_10002086 3300026121 Bacteria 17639
465 Ga0207683_10031999 3300026121 Bacteria 4568
466 Ga0207698_10037681 3300026142 Bacteria 3564
467 Ga0207698_10053310 3300026142 Bacteria 3104
468 Ga0207698_10068441 3300026142 Bacteria 2803
469 Ga0207698_10080676 3300026142 Bacteria 2622
470 Ga0207698_10156133 3300026142 Bacteria 1988
471 Ga0207698_10248842 3300026142 Bacteria 1625
472 Ga0268266_10064435 3300028379 Bacteria 3166
473 Ga0268266_10332914 3300028379 Bacteria 1423
474 Ga0268265_10030003 3300028380 Bacteria 3912
475 Ga0268264_10028404 3300028381 Bacteria 4576
476 Ga0268264_10038545 3300028381 Bacteria 3945
477 Ga0316182_1206136 3300030745 Bacteria 540
478 Ga0307408_100006665 3300031548 Bacteria 7656
479 Ga0307405_10998567 3300031731 Bacteria 714
480 Ga0307413_10277006 3300031824 Bacteria 1259
481 Ga0307410_10018361 3300031852 Bacteria 4226
482 Ga0307410_10150905 3300031852 Bacteria 1730
483 Ga0307410_10389368 3300031852 Bacteria 1123
484 Ga0307410_10462151 3300031852 Bacteria 1037
485 Ga0307410_11561682 3300031852 Bacteria 582
486 Ga0307406_10005424 3300031901 Bacteria 6978
487 Ga0307406_11903499 3300031901 Bacteria 530
488 Ga0307407_10009338 3300031903 Bacteria 4561
489 Ga0307407_11026891 3300031903 Bacteria 638
490 Ga0307412_10276902 3300031911 Bacteria 1315
491 Ga0307409_100025809 3300031995 Bacteria 4130
492 Ga0307409_101094056 3300031995 Bacteria 818
493 Ga0307409_102935936 3300031995 Bacteria 503
494 Ga0307416_100008532 3300032002 Bacteria 6622
495 Ga0307414_10005790 3300032004 Bacteria 6835
496 Ga0307414_10045620 3300032004 Bacteria 3003
497 Ga0307414_10051740 3300032004 Bacteria 2853
498 Ga0307414_10084389 3300032004 Bacteria 2336
499 Ga0307414_10261666 3300032004 Bacteria 1444
500 Ga0307411_10002104 3300032005 Bacteria 8591
501 Ga0307411_10026141 3300032005 Bacteria 3510
502 Ga0307411_11322652 3300032005 Bacteria 657
503 Ga0307415_100002741 3300032126 Bacteria 8807
504 Ga0307415_100762676 3300032126 Bacteria 879
505 Ga0307415_101259099 3300032126 Bacteria 699
506 Ga0373939_0065102 3300035114 Bacteria 1172
507 Ga0373955_0064192 3300035172 Bacteria 2035
508 Ga0373942_0011403 3300035207 Bacteria 2108
509 Ga0373947_1090041 3300035725 Bacteria 544
510 Ga0395899_0066776 3300037312 Bacteria 2640
511 Ga0395899_0136181 3300037312 Bacteria 1750
512 Ga0395899_0369493 3300037312 Bacteria 955
513 Ga0395900_0006484 3300037418 Bacteria 12203
514 Ga0395900_0101656 3300037418 Bacteria 2952
515 Ga0395900_0235433 3300037418 Bacteria 1839
516 Ga0395900_0313110 3300037418 Bacteria 1552
517 Ga0395900_0396912 3300037418 Bacteria 1344
518 Ga0395900_0912595 3300037418 Bacteria 801
519 Ga0395898_0209666 3300037466 Bacteria 1858
520 Ga0395898_0273962 3300037466 Bacteria 1609
521 Ga0395898_0321575 3300037466 Bacteria 1476
522 Ga0395905_0047303 3300037471 Bacteria 4032
523 Ga0395905_0136026 3300037471 Bacteria 2311
524 Ga0395905_0324160 3300037471 Bacteria 1430
525 Ga0395905_0851522 3300037471 Bacteria 815
526 Ga0395905_1022819 3300037471 Bacteria 729
527 Ga0395905_1302725 3300037471 Bacteria 630
528 Ga0395905_1487335 3300037471 Bacteria 582
529 Ga0395901_0000516 3300038443 Bacteria 44694
530 Ga0395901_0419578 3300038443 Bacteria 1372
531 Ga0395901_0472675 3300038443 Bacteria 1279
532 Ga0395901_0925047 3300038443 Bacteria 852
533 Ga0439445_0012940 3300042004 Bacteria 2012
534 Ga0450914_001720 3300042118 Bacteria 1439
535 Ga0450890_002636 3300042127 Bacteria 2440
536 Ga0450890_011521 3300042127 Bacteria 1143
537 Ga0450889_000054 3300042144 Bacteria 10083
538 Ga0450916_098474 3300042530 Bacteria 516
539 Ga0466972_0029224 3300044658 Bacteria 2714
540 Ga0466972_0071031 3300044658 Bacteria 1661
541 Ga0466963_0054339 3300044694 Bacteria 2661
542 Ga0466963_0065320 3300044694 Bacteria 2439
543 Ga0466963_0078941 3300044694 Bacteria 2226
544 Ga0466963_0251408 3300044694 Bacteria 1240
545 Ga0466971_0036174 3300044719 Bacteria 2214
546 Ga0466970_0015065 3300044765 Bacteria 3977
547 Ga0466957_0044841 3300044842 Bacteria 2680
548 Ga0466957_0060320 3300044842 Bacteria 2326
549 Ga0466957_0250298 3300044842 Bacteria 1178
550 Ga0466957_0253001 3300044842 Bacteria 1172
551 Ga0466957_0852863 3300044842 Bacteria 649
552 Ga0466957_1328481 3300044842 Bacteria 522
553 Ga0466960_0005328 3300044901 Bacteria 5088
554 Ga0466958_0228648 3300045836 Bacteria 1187
555 Ga0466958_0229902 3300045836 Bacteria 1184
556 Ga0466958_0278710 3300045836 Bacteria 1071
557 Ga0466967_0115442 3300045976 Bacteria 2472
558 Ga0466967_0147953 3300045976 Bacteria 2192
559 Ga0466967_0151919 3300045976 Bacteria 2165
560 Ga0466967_0502032 3300045976 Bacteria 1190
561 Ga0466967_0510958 3300045976 Bacteria 1180
562 Ga0466967_1645233 3300045976 Bacteria 639
563 Ga0495663_0001185 3300046525 Bacteria 8408
564 Ga0495663_0005983 3300046525 Bacteria 3368
565 Ga0495598_0001262 3300046537 Bacteria 4934
566 Ga0495598_0121650 3300046537 Bacteria 885
567 Ga0495621_0008955 3300046539 Bacteria 3019
568 Ga0495621_0009563 3300046539 Bacteria 2947
569 Ga0495621_0205955 3300046539 Bacteria 792
570 Ga0495656_0524269 3300046615 Bacteria 630
571 Ga0495659_0294177 3300046664 Bacteria 685
572 Ga0495661_0291401 3300046665 Bacteria 820
573 Ga0495669_0060507 3300046684 Bacteria 1712
574 Ga0495670_0040893 3300046691 Bacteria 2312
575 Ga0495670_0202971 3300046691 Bacteria 1050
576 Ga0495670_0770201 3300046691 Bacteria 525
577 Ga0495677_0021753 3300047445 Bacteria 2324
578 Ga0495677_0066009 3300047445 Bacteria 1345
579 Ga0495677_0281955 3300047445 Bacteria 652
580 Ga0496100_0004003 3300048903 Bacteria 7749
581 Ga0496100_0699678 3300048903 Bacteria 791
582 Ga0496101_0006572 3300048904 Bacteria 7490
583 Ga0496101_0213991 3300048904 Bacteria 1494
584 Ga0496102_0030419 3300048905 Bacteria 4833
585 Ga0496102_0069236 3300048905 Bacteria 3239
586 Ga0496102_1440463 3300048905 Bacteria 608
587 Ga0496103_0070845 3300048906 Bacteria 2181
588 Ga0496104_0010607 3300048907 Bacteria 8230
589 Ga0496105_0014380 3300048908 Bacteria 6299
590 Ga0496106_0015094 3300048909 Bacteria 5718
591 Ga0496107_0025897 3300048910 Bacteria 4156
592 Ga0496108_0009066 3300048911 Bacteria 8059
593 Ga0496108_0081849 3300048911 Bacteria 2736
594 Ga0496109_0218500 3300048912 Bacteria 1792
595 Ga0496110_0043665 3300048913 Bacteria 3914
596 Ga0496110_0049102 3300048913 Bacteria 3700
597 Ga0496111_0032659 3300048914 Bacteria 3711
598 Ga0496112_0038177 3300048915 Bacteria 4689
599 Ga0496112_0314788 3300048915 Bacteria 1510
600 Ga0496112_1386997 3300048915 Bacteria 617
601 Ga0496113_0251325 3300048916 Bacteria 1411
602 Ga0496114_0018619 3300048917 Bacteria 5618
603 nmdc:mga00v17_555444_c1 3300050491 Bacteria 742
604 nmdc:mga08y16_23142_c1 3300050511 Bacteria 6559
605 JGI24747J21853_1010384
606 JGI24740J21852_10002524
607 JGI24740J21852_10011151
608 JGI24739J22299_10012202
609 JGI24739J22299_10146310
610 JGI24737J22298_10000287
611 JGI24737J22298_10168072
612 JGI24743J22301_10044473
613 JGI24743J22301_10154285
614 JGI24735J21928_10111578
615 JGI24750J21931_1023521
616 JGI24745J21846_1015157
617 JGI24738J21930_10001143
618 JGI24738J21930_10002981
619 JGI24738J21930_10064519
620 JGI24744J21845_10000108
621 JGI24744J21845_10016891
622 JGI24035J26624_1010412
623 JGI24034J26672_10011752
624 JGI24742J22300_10042822
625 Ga0065712_10222415
626 Ga0065715_10288954
627 Ga0065715_10602275
628 Ga0070658_10123077
629 Ga0070658_10325669
630 Ga0070676_10010897
631 Ga0070676_10668795
632 Ga0070676_11084188
633 Ga0070683_100310551
634 Ga0070683_101795326
635 Ga0070690_100004002
636 Ga0070690_100004780
637 Ga0070690_101121419
638 Ga0070690_101231156
639 Ga0070670_100008058
640 Ga0070670_100009600
641 Ga0070670_100041316
642 Ga0070670_100103950
643 Ga0070670_100193758
644 Ga0070677_10500220
645 Ga0068869_100021006
646 Ga0068869_100090194
647 Ga0068869_101734385
648 Ga0070666_10004110
649 Ga0070666_10026484
650 Ga0070666_10031644
651 Ga0070666_10872541
652 Ga0070680_100000367
653 Ga0070682_100211111
654 Ga0068868_100000259
655 Ga0068868_100080745
656 Ga0068868_100619528
657 Ga0068868_102097171
658 Ga0070660_100003560
659 Ga0070660_100022446
660 Ga0070660_100117962
661 Ga0070660_100282036
662 Ga0070660_100402093
663 Ga0070660_100416200
664 Ga0070689_100100634
665 Ga0070689_100827181
666 Ga0070687_100086138
667 Ga0070687_100280333
668 Ga0070687_100444727
669 Ga0070687_101087824
670 Ga0070687_101244375
671 Ga0070661_100016752
672 Ga0070661_100027518
673 Ga0070661_100033750
674 Ga0070661_100099576
675 Ga0070661_100237404
676 Ga0070661_100568956
677 Ga0070668_100009183
678 Ga0070668_101041667
679 Ga0070669_100000174
680 Ga0070669_100163621
681 Ga0070669_100732679
682 Ga0070675_100020924
683 Ga0070675_100120485
684 Ga0070675_100217577
685 Ga0070675_100404177
686 Ga0070675_100481105
687 Ga0070671_100014703
688 Ga0070671_100122509
689 Ga0070671_100150577
690 Ga0070671_101401149
691 Ga0070674_100037685
692 Ga0070674_100086021
693 Ga0070674_100106771
694 Ga0070673_100000163
695 Ga0070673_100001364
696 Ga0070673_100011759
697 Ga0070673_100433907
698 Ga0070688_100414489
699 Ga0070659_100001133
700 Ga0070659_100023608
701 Ga0070659_100104008
702 Ga0070659_100608623
703 Ga0070659_100694527
704 Ga0070659_100705848
705 Ga0070659_101281336
706 Ga0070667_100002428
707 Ga0070667_100002967
708 Ga0070667_100019816
709 Ga0070667_100024019
710 Ga0070714_100875069
711 Ga0070713_100362033
712 Ga0070710_11158530
713 Ga0070663_100099559
714 Ga0070663_100134176
715 Ga0070663_100152380
716 Ga0070663_100285906
717 Ga0070663_101012896
718 Ga0070678_100018388
719 Ga0070678_100066517
720 Ga0070662_100000478
721 Ga0070662_100000764
722 Ga0070662_100002675
723 Ga0070662_100086450
724 Ga0070662_100543884
725 Ga0070662_100873404
726 Ga0070681_11068920
727 Ga0068867_100002891
728 Ga0068867_100025034
729 Ga0068867_102136855
730 Ga0070685_11143381
731 Ga0070679_100394102
732 Ga0070679_100606907
733 Ga0070679_100698339
734 Ga0070684_100006144
735 Ga0070684_100941452
736 Ga0068853_100000404
737 Ga0068853_100086191
738 Ga0068853_100238209
739 Ga0070672_100001335
740 Ga0070672_100005799
741 Ga0070672_100123870
742 Ga0070672_100745166
743 Ga0070672_101852814
744 Ga0070686_100111343
745 Ga0070686_100308194
746 Ga0070696_100003860
747 Ga0070696_100192740
748 Ga0070693_100049023
749 Ga0070693_100159150
750 Ga0070665_100061283
751 Ga0070665_100096941
752 Ga0070665_100208145
753 Ga0070704_101130449
754 Ga0068855_100002608
755 Ga0068855_100078173
756 Ga0068855_100397347
757 Ga0070664_100015659
758 Ga0070664_100041274
759 Ga0070664_100310205
760 Ga0070664_101431306
761 Ga0068857_100012569
762 Ga0068857_100124996
763 Ga0068857_100180788
764 Ga0068857_100475545
765 Ga0068857_101627494
766 Ga0068854_100002515
767 Ga0068854_100045872
768 Ga0068854_100049682
769 Ga0068854_100175219
770 Ga0068854_101343588
771 Ga0068856_100052611
772 Ga0068856_101219194
773 Ga0068856_101514184
774 Ga0068856_101819132
775 Ga0068852_100019729
776 Ga0068852_100057101
777 Ga0068852_100074829
778 Ga0068852_100963223
779 Ga0068852_101287494
780 Ga0068852_101893324
781 Ga0068859_100001530
782 Ga0068859_100016966
783 Ga0068864_100000174
784 Ga0068864_100006777
785 Ga0068864_100060290
786 Ga0068866_10061939
787 Ga0068866_10340517
788 Ga0068861_100472667
789 Ga0068851_10019850
790 Ga0068851_10035969
791 Ga0068851_10218545
792 Ga0068870_10316862
793 Ga0068870_10752532
794 Ga0068870_10914659
795 Ga0068863_100001532
796 Ga0068863_100003026
797 Ga0068863_100023513
798 Ga0068863_100639516
799 Ga0068863_101187358
800 Ga0068858_100000600
801 Ga0068858_100012586
802 Ga0068858_100036867
803 Ga0068858_100590920
804 Ga0068858_101197023
805 Ga0068860_100015621
806 Ga0068860_100126264
807 Ga0068860_100194268
808 Ga0068862_100041957
809 Ga0068862_100102117
810 Ga0070717_10140099
811 Ga0070717_11422497
812 Ga0075364_10784667
813 Ga0070716_100435760
814 Ga0070712_100032575
815 Ga0097621_100010641
816 Ga0097621_100275562
817 Ga0097621_102197246
818 Ga0068871_100002926
819 Ga0068871_100007891
820 Ga0068871_100476847
821 Ga0068871_101595360
822 Ga0068865_100018624
823 Ga0068865_100026174
824 Ga0068865_100127271
825 Ga0068865_101853673
826 Ga0097620_100001530
827 Ga0097620_100016966
828 Ga0105240_10459525
829 Ga0105240_10581976
830 Ga0111539_10020475
831 Ga0105245_10000229
832 Ga0105245_10008820
833 Ga0105245_10070554
834 Ga0105247_10057266
835 Ga0105247_10588584
836 Ga0105247_11095358
837 Ga0105243_10053065
838 Ga0105243_11944306
839 Ga0105243_12015750
840 Ga0105243_12608936
841 Ga0105241_10011061
842 Ga0105241_11600070
843 Ga0105242_10026312
844 Ga0105242_10180837
845 Ga0105242_10468976
846 Ga0105248_10001163
847 Ga0105248_10005337
848 Ga0105248_10010506
849 Ga0105248_10018730
850 Ga0105248_10158252
851 Ga0105238_10026372
852 Ga0105238_10080782
853 Ga0105238_12936417
854 Ga0105249_10201465
855 Ga0105239_10625693
856 Ga0105246_10039419
857 Ga0105246_10628722
858 Ga0157315_1025918
859 Ga0157373_10196676
860 Ga0157373_10484502
861 Ga0157373_10769789
862 Ga0157373_11087925
863 Ga0157373_11281613
864 Ga0157373_11285060
865 Ga0157371_10005265
866 Ga0157371_10035371
867 Ga0157371_10071845
868 Ga0157371_10124781
869 Ga0157371_10663034
870 Ga0157370_10311975
871 Ga0157370_10985140
872 Ga0157369_10005876
873 Ga0157369_10020524
874 Ga0157369_10152379
875 Ga0157369_10499005
876 Ga0157374_10002169
877 Ga0157374_10036547
878 Ga0157378_10057057
879 Ga0157378_10235413
880 Ga0157378_10311231
881 Ga0157378_12852999
882 Ga0163162_10013794
883 Ga0163162_10038198
884 Ga0163162_10052192
885 Ga0157372_10059224
886 Ga0157372_12212927
887 Ga0157372_12757287
888 Ga0157375_10009327
889 Ga0157375_10416194
890 Ga0157375_10535948
891 Ga0157375_10918845
892 Ga0163163_10004903
893 Ga0163163_10115621
894 Ga0163163_10319783
895 Ga0163163_10751380
896 Ga0163163_10985261
897 Ga0157380_10129068
898 Ga0157380_10768231
899 Ga0157377_10045012
900 Ga0157377_10114445
901 Ga0157377_11019817
902 Ga0157379_10022637
903 Ga0157379_10807333
904 Ga0157379_11038522
905 Ga0157376_10016991
906 Ga0207673_1000907
907 Ga0207697_10012028
908 Ga0207697_10015485
909 Ga0207656_10012783
910 Ga0207656_10023279
911 Ga0207682_10014848
912 Ga0207682_10096037
913 Ga0207692_10621125
914 Ga0207642_10015279
915 Ga0207642_10060582
916 Ga0207710_10326361
917 Ga0207688_10000143
918 Ga0207688_10243014
919 Ga0207680_10053981
920 Ga0207680_10196369
921 Ga0207680_10526238
922 Ga0207680_10989134
923 Ga0207647_10000090
924 Ga0207647_10028521
925 Ga0207647_10493225
926 Ga0207699_10229011
927 Ga0207645_10004608
928 Ga0207645_10649482
929 Ga0207645_10858979
930 Ga0207645_10910500
931 Ga0207643_10018668
932 Ga0207643_10363312
933 Ga0207705_10018190
934 Ga0207705_10706028
935 Ga0207705_10748234
936 Ga0207684_10383366
937 Ga0207654_10206625
938 Ga0207707_10285201
939 Ga0207695_10371171
940 Ga0207660_10000614
941 Ga0207660_10368508
942 Ga0207662_10011804
943 Ga0207662_10142866
944 Ga0207662_10519744
945 Ga0207657_10042845
946 Ga0207657_10151353
947 Ga0207657_10357030
948 Ga0207649_10107279
949 Ga0207649_10164649
950 Ga0207649_10455544
951 Ga0207649_10520984
952 Ga0207649_10823800
953 Ga0207652_10301794
954 Ga0207652_10445274
955 Ga0207652_10988089
956 Ga0207681_10032670
957 Ga0207681_11166985
958 Ga0207694_10059964
959 Ga0207694_10139457
960 Ga0207650_10014741
961 Ga0207650_11385120
962 Ga0207659_10010923
963 Ga0207659_10181427
964 Ga0207659_10186573
965 Ga0207687_10006429
966 Ga0207687_10027491
967 Ga0207644_10002984
968 Ga0207644_10011021
969 Ga0207644_10020073
970 Ga0207644_10122596
971 Ga0207644_10465093
972 Ga0207690_10018347
973 Ga0207690_10162856
974 Ga0207690_10165094
975 Ga0207690_11129478
976 Ga0207706_10001308
977 Ga0207706_10017629
978 Ga0207706_10073051
979 Ga0207706_10666263
980 Ga0207706_10824393
981 Ga0207686_10098680
982 Ga0207686_11185295
983 Ga0207709_10014603
984 Ga0207709_10430428
985 Ga0207709_10534424
986 Ga0207670_10059064
987 Ga0207669_10130395
988 Ga0207669_10138755
989 Ga0207669_10231055
990 Ga0207704_10021529
991 Ga0207704_10127739
992 Ga0207704_10306699
993 Ga0207704_11473575
994 Ga0207665_10204328
995 Ga0207691_10000045
996 Ga0207691_10010279
997 Ga0207691_10112469
998 Ga0207691_10799613
999 Ga0207711_10003169
1000 Ga0207711_10004266
1001 Ga0207711_10006858
1002 Ga0207711_10056316
1003 Ga0207711_10227886
1004 Ga0207711_11532116
1005 Ga0207689_10000226
1006 Ga0207689_10068497
1007 Ga0207661_10333763
1008 Ga0207661_10336815
1009 Ga0207679_10013292
1010 Ga0207679_10237376
1011 Ga0207679_11186921
1012 Ga0207667_10184487
1013 Ga0207667_10225489
1014 Ga0207667_10791956
1015 Ga0207667_11826184
1016 Ga0207651_10000700
1017 Ga0207651_10003870
1018 Ga0207651_10206402
1019 Ga0207651_10664899
1020 Ga0207668_10023177
1021 Ga0207668_11008314
1022 Ga0207640_10006845
1023 Ga0207640_10080862
1024 Ga0207640_10346899
1025 Ga0207640_10830620
1026 Ga0207658_10006979
1027 Ga0207658_10009475
1028 Ga0207658_10168150
1029 Ga0207658_10550323
1030 Ga0207677_10003664
1031 Ga0207677_10010397
1032 Ga0207677_10267156
1033 Ga0207703_10007076
1034 Ga0207703_10043616
1035 Ga0207703_10058642
1036 Ga0207703_10083694
1037 Ga0207639_10031613
1038 Ga0207639_10072586
1039 Ga0207639_10342415
1040 Ga0207639_10355320
1041 Ga0207639_11037806
1042 Ga0207639_12037195
1043 Ga0207678_10049795
1044 Ga0207678_10055784
1045 Ga0207678_10124759
1046 Ga0207678_10316745
1047 Ga0207678_10559518
1048 Ga0207678_10804648
1049 Ga0207678_11434500
1050 Ga0207702_10018224
1051 Ga0207641_10023275
1052 Ga0207641_10084421
1053 Ga0207641_10160985
1054 Ga0207641_11067043
1055 Ga0207648_10000222
1056 Ga0207648_10002834
1057 Ga0207648_10015675
1058 Ga0207676_10002840
1059 Ga0207676_10003330
1060 Ga0207676_10184459
1061 Ga0207676_10314412
1062 Ga0207676_10315132
1063 Ga0207674_10000793
1064 Ga0207674_10024280
1065 Ga0207675_100125933
1066 Ga0207675_100130166
1067 Ga0207675_100621626
1068 Ga0207683_10002086
1069 Ga0207683_10031999
1070 Ga0207698_10037681
1071 Ga0207698_10053310
1072 Ga0207698_10068441
1073 Ga0207698_10080676
1074 Ga0207698_10156133
1075 Ga0207698_10248842
1076 Ga0268266_10064435
1077 Ga0268266_10332914
1078 Ga0268265_10030003
1079 Ga0268264_10028404
1080 Ga0268264_10038545
1081 Ga0316182_1206136
1082 Ga0307408_100006665
1083 Ga0307405_10998567
1084 Ga0307413_10277006
1085 Ga0307410_10018361
1086 Ga0307410_10150905
1087 Ga0307410_10389368
1088 Ga0307410_10462151
1089 Ga0307410_11561682
1090 Ga0307406_10005424
1091 Ga0307406_11903499
1092 Ga0307407_10009338
1093 Ga0307407_11026891
1094 Ga0307412_10276902
1095 Ga0307409_100025809
1096 Ga0307409_101094056
1097 Ga0307409_102935936
1098 Ga0307416_100008532
1099 Ga0307414_10005790
1100 Ga0307414_10045620
1101 Ga0307414_10051740
1102 Ga0307414_10084389
1103 Ga0307414_10261666
1104 Ga0307411_10002104
1105 Ga0307411_10026141
1106 Ga0307411_11322652
1107 Ga0307415_100002741
1108 Ga0307415_100762676
1109 Ga0307415_101259099
1110 Ga0373939_0065102
1111 Ga0373955_0064192
1112 Ga0373942_0011403
1113 Ga0373947_1090041
1114 Ga0395899_0066776
1115 Ga0395899_0136181
1116 Ga0395899_0369493
1117 Ga0395900_0006484
1118 Ga0395900_0101656
1119 Ga0395900_0235433
1120 Ga0395900_0313110
1121 Ga0395900_0396912
1122 Ga0395900_0912595
1123 Ga0395898_0209666
1124 Ga0395898_0273962
1125 Ga0395898_0321575
1126 Ga0395905_0047303
1127 Ga0395905_0136026
1128 Ga0395905_0324160
1129 Ga0395905_0851522
1130 Ga0395905_1022819
1131 Ga0395905_1302725
1132 Ga0395905_1487335
1133 Ga0395901_0000516
1134 Ga0395901_0419578
1135 Ga0395901_0472675
1136 Ga0395901_0925047
1137 Ga0439445_0012940
1138 Ga0450914_001720
1139 Ga0450890_002636
1140 Ga0450890_011521
1141 Ga0450889_000054
1142 Ga0450916_098474
1143 Ga0466972_0029224
1144 Ga0466972_0071031
1145 Ga0466963_0054339
1146 Ga0466963_0065320
1147 Ga0466963_0078941
1148 Ga0466963_0251408
1149 Ga0466971_0036174
1150 Ga0466970_0015065
1151 Ga0466957_0044841
1152 Ga0466957_0060320
1153 Ga0466957_0250298
1154 Ga0466957_0253001
1155 Ga0466957_0852863
1156 Ga0466957_1328481
1157 Ga0466960_0005328
1158 Ga0466958_0228648
1159 Ga0466958_0229902
1160 Ga0466958_0278710
1161 Ga0466967_0115442
1162 Ga0466967_0147953
1163 Ga0466967_0151919
1164 Ga0466967_0502032
1165 Ga0466967_0510958
1166 Ga0466967_1645233
1167 Ga0495663_0001185
1168 Ga0495663_0005983
1169 Ga0495598_0001262
1170 Ga0495598_0121650
1171 Ga0495621_0008955
1172 Ga0495621_0009563
1173 Ga0495621_0205955
1174 Ga0495656_0524269
1175 Ga0495659_0294177
1176 Ga0495661_0291401
1177 Ga0495669_0060507
1178 Ga0495670_0040893
1179 Ga0495670_0202971
1180 Ga0495670_0770201
1181 Ga0495677_0021753
1182 Ga0495677_0066009
1183 Ga0495677_0281955
1184 Ga0496100_0004003
1185 Ga0496100_0699678
1186 Ga0496101_0006572
1187 Ga0496101_0213991
1188 Ga0496102_0030419
1189 Ga0496102_0069236
1190 Ga0496102_1440463
1191 Ga0496103_0070845
1192 Ga0496104_0010607
1193 Ga0496105_0014380
1194 Ga0496106_0015094
1195 Ga0496107_0025897
1196 Ga0496108_0009066
1197 Ga0496108_0081849
1198 Ga0496109_0218500
1199 Ga0496110_0043665
1200 Ga0496110_0049102
1201 Ga0496111_0032659
1202 Ga0496112_0038177
1203 Ga0496112_0314788
1204 Ga0496112_1386997
1205 Ga0496113_0251325
1206 Ga0496114_0018619
1207 nmdc:mga00v17_555444_c1
1208 nmdc:mga08y16_23142_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

16

63

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9251 16 95
7pao-assembly1.cif.gz_C 70s ribosome with ef-g, a*- and p/e-site trnas in mycoplasma pneumoniae cells 0.9204 17 64
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.9167 14 96
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9163 16 95
1dm9-assembly1.cif.gz_A heat shock protein 15 kd 0.9033 15 97
ID Description Score Start End Superfamily
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9348 17 62 3.10.290.10
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9333 16 95 3.10.290.10
af_Q6R9N5_90_173_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9276 17 64 3.10.290.10
af_Q4D8U8_345_395_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9046 19 64 3.10.290.10
1dm9A00 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9033 15 97 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A239HNL4-F1-model_v4 Ribosome-associated heat shock protein Hsp15 0.9956 14 98 GO:0003723
AF-A0A2D5DFX7-F1-model_v4 deleted 0.9903 16 95
AF-A0A520I0F2-F1-model_v4 RNA-binding S4 domain-containing protein 0.9887 16 95 GO:0003723
AF-A0A1X7G362-F1-model_v4 Ribosome-associated heat shock protein Hsp15 0.984 14 96 GO:0003723
AF-A0A841L464-F1-model_v4 Ribosome-associated heat shock protein Hsp15 0.9839 15 95 GO:0003723

Map