F468302

General Info

Members Datasets Scaffolds Average Seq Length
603 290 1206 258

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0014303|Ga0316574_0014303_2183_3148
Length 307
Sequence LTRRDIGMASKKKGDRPVSPPAAGPLPPQPVEPSTLSRAPGGRRSSARLSPDQLSELLQILPTSDSVELKVTVPESSHRSTVAALGMDPLNAQIRQVFFYDTPDLDLYKAGVVVRARRIQGKGGDSVVKLRPVVPEALPPELRNSPAFVAEVDAMPGGYVCSGTLKSRVDPDLVRQVALGGVSVRKLFSKEQRALFAEHAPENLDLDQLPVLGPIFVLKLAFTPAELQRRMVAEMWLYPDGSRILELSTKCLPPELLTVFAEARRFLDDRGIDRSGDQQAKTRRALTFFSKELTRGKESGAEADTAV

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 8.96
Rhizosphere 90.05
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0014303 3300035398 Bacteria 4583
2 JGI24739J22299_10032492 3300001989 Unclassified 1795
3 JGI24745J21846_1009133 3300002073 Bacteria 1122
4 JGI24738J21930_10004890 3300002075 Bacteria 3250
5 JGI24738J21930_10008559 3300002075 Unclassified 2325
6 JGI24744J21845_10038369 3300002077 Bacteria 901
7 JGI24742J22300_10031080 3300002244 Bacteria 933
8 JGI25407J50210_10005433 3300003373 Bacteria 3132
9 JGI25407J50210_10008282 3300003373 Bacteria 2619
10 JGI25407J50210_10040533 3300003373 Bacteria 1194
11 Ga0070658_10013974 3300005327 Bacteria 6445
12 Ga0070676_10119936 3300005328 Bacteria 1649
13 Ga0070683_100040741 3300005329 Bacteria 4271
14 Ga0070683_100069620 3300005329 Bacteria 3281
15 Ga0070683_100122928 3300005329 Bacteria 2452
16 Ga0070683_100208484 3300005329 Bacteria 1856
17 Ga0070683_100313936 3300005329 Bacteria 1492
18 Ga0070683_100346822 3300005329 Bacteria 1414
19 Ga0070690_100482955 3300005330 Bacteria 924
20 Ga0070670_100152428 3300005331 Bacteria 2001
21 Ga0070670_100174016 3300005331 Bacteria 1868
22 Ga0068869_100150164 3300005334 Bacteria 1806
23 Ga0070680_100314200 3300005336 Bacteria 1330
24 Ga0070680_100395818 3300005336 Unclassified 1177
25 Ga0070682_100006837 3300005337 Bacteria 6404
26 Ga0070682_100014400 3300005337 Bacteria 4569
27 Ga0070682_100262340 3300005337 Bacteria 1251
28 Ga0070682_100373270 3300005337 Bacteria 1070
29 Ga0068868_100005641 3300005338 Bacteria 8811
30 Ga0068868_100170085 3300005338 Unclassified 1804
31 Ga0068868_100233157 3300005338 Unclassified 1545
32 Ga0070660_100061134 3300005339 Bacteria 2924
33 Ga0070660_100079776 3300005339 Bacteria 2568
34 Ga0070660_100129067 3300005339 Bacteria 2022
35 Ga0070691_10067200 3300005341 Bacteria 1733
36 Ga0070687_100032544 3300005343 Bacteria 2566
37 Ga0070661_100007933 3300005344 Bacteria 7330
38 Ga0070692_10001261 3300005345 Bacteria 9044
39 Ga0070692_10001544 3300005345 Bacteria 8455
40 Ga0070675_100013343 3300005354 Bacteria 6456
41 Ga0070675_100256255 3300005354 Bacteria 1532
42 Ga0070671_100236772 3300005355 Bacteria 1550
43 Ga0070671_100274832 3300005355 Bacteria 1432
44 Ga0070671_100516126 3300005355 Bacteria 1029
45 Ga0070674_100087285 3300005356 Bacteria 2242
46 Ga0070674_100192227 3300005356 Bacteria 1571
47 Ga0070673_100117931 3300005364 Bacteria 2210
48 Ga0070673_100193387 3300005364 Bacteria 1749
49 Ga0070688_100294734 3300005365 Bacteria 1170
50 Ga0070659_100166444 3300005366 Bacteria 1804
51 Ga0070714_100011014 3300005435 Bacteria 7162
52 Ga0070714_100500682 3300005435 Bacteria 1158
53 Ga0070713_100081716 3300005436 Bacteria 2758
54 Ga0070713_100426623 3300005436 Unclassified 1242
55 Ga0070701_10000968 3300005438 Bacteria 10385
56 Ga0070711_100013456 3300005439 Bacteria 5140
57 Ga0070700_100001110 3300005441 Bacteria 13330
58 Ga0070700_100122683 3300005441 Bacteria 1743
59 Ga0070694_100164866 3300005444 Bacteria 1629
60 Ga0070663_100029308 3300005455 Bacteria 3759
61 Ga0070678_100001021 3300005456 Bacteria 14583
62 Ga0070678_100175431 3300005456 Bacteria 1749
63 Ga0070678_100355680 3300005456 Bacteria 1260
64 Ga0070662_100034086 3300005457 Bacteria 3588
65 Ga0070681_10081108 3300005458 Bacteria 3200
66 Ga0070681_10264823 3300005458 Bacteria 1630
67 Ga0068867_100003260 3300005459 Bacteria 11434
68 Ga0068867_100520502 3300005459 Bacteria 1026
69 Ga0068867_100543753 3300005459 Bacteria 1005
70 Ga0070685_10067625 3300005466 Bacteria 2108
71 Ga0070685_10308228 3300005466 Unclassified 1069
72 Ga0070698_100363297 3300005471 Bacteria 1380
73 Ga0070699_100321599 3300005518 Unclassified 1390
74 Ga0070684_100004377 3300005535 Bacteria 10735
75 Ga0070684_100011907 3300005535 Bacteria 6945
76 Ga0070684_100220085 3300005535 Bacteria 1732
77 Ga0068853_100020164 3300005539 Bacteria 5542
78 Ga0070672_100009314 3300005543 Bacteria 6766
79 Ga0070672_100010774 3300005543 Bacteria 6354
80 Ga0070686_100034650 3300005544 Bacteria 3113
81 Ga0070695_100099555 3300005545 Unclassified 1955
82 Ga0070693_100108607 3300005547 Bacteria 1702
83 Ga0070665_100034827 3300005548 Bacteria 5065
84 Ga0070665_100706532 3300005548 Bacteria 1021
85 Ga0070704_100672015 3300005549 Bacteria 916
86 Ga0068855_100089812 3300005563 Bacteria 3546
87 Ga0070664_100063245 3300005564 Unclassified 3155
88 Ga0068857_100016885 3300005577 Bacteria 6396
89 Ga0068856_100057099 3300005614 Unclassified 3853
90 Ga0070702_100011113 3300005615 Bacteria 4467
91 Ga0070702_100011236 3300005615 Bacteria 4447
92 Ga0070702_100025348 3300005615 Bacteria 3176
93 Ga0070702_100182836 3300005615 Bacteria 1373
94 Ga0070702_100203661 3300005615 Bacteria 1312
95 Ga0068852_100001464 3300005616 Bacteria 15962
96 Ga0068852_100002729 3300005616 Bacteria 12211
97 Ga0068852_100132308 3300005616 Bacteria 2299
98 Ga0068852_100725476 3300005616 Bacteria 1005
99 Ga0068859_100383943 3300005617 Bacteria 1500
100 Ga0068861_100159176 3300005719 Unclassified 1861
101 Ga0068861_100330973 3300005719 Bacteria 1329
102 Ga0068851_10023005 3300005834 Bacteria 3042
103 Ga0068851_10044309 3300005834 Bacteria 2245
104 Ga0068870_10020631 3300005840 Bacteria 3213
105 Ga0068870_10063379 3300005840 Bacteria 1994
106 Ga0068858_100513654 3300005842 Bacteria 1158
107 Ga0068860_100683181 3300005843 Bacteria 1036
108 Ga0081455_10006072 3300005937 Bacteria 13074
109 Ga0081455_10019446 3300005937 Bacteria 6425
110 Ga0081455_10022817 3300005937 Bacteria 5838
111 Ga0081455_10022835 3300005937 Bacteria 5834
112 Ga0081455_10067704 3300005937 Bacteria 2975
113 Ga0081455_10074510 3300005937 Unclassified 2803
114 Ga0081455_10114969 3300005937 Bacteria 2131
115 Ga0081455_10162329 3300005937 Bacteria 1711
116 Ga0081455_10229811 3300005937 Bacteria 1370
117 Ga0081455_10348133 3300005937 Bacteria 1046
118 Ga0081538_10000225 3300005981 Bacteria 63512
119 Ga0081538_10003288 3300005981 Bacteria 15342
120 Ga0081538_10004842 3300005981 Bacteria 12268
121 Ga0081538_10009665 3300005981 Bacteria 8015
122 Ga0081538_10009666 3300005981 Bacteria 8014
123 Ga0081540_1022850 3300005983 Unclassified 3680
124 Ga0070717_10153503 3300006028 Bacteria 1994
125 Ga0075364_10085343 3300006051 Unclassified 2091
126 Ga0070712_100135833 3300006175 Bacteria 1870
127 Ga0097621_100142848 3300006237 Bacteria 2046
128 Ga0068871_100569333 3300006358 Bacteria 1027
129 Ga0075428_100022144 3300006844 Bacteria 7035
130 Ga0075428_100037963 3300006844 Bacteria 5301
131 Ga0075428_100088102 3300006844 Bacteria 3386
132 Ga0075428_100098283 3300006844 Bacteria 3191
133 Ga0075428_100311601 3300006844 Bacteria 1692
134 Ga0075428_100388780 3300006844 Unclassified 1495
135 Ga0075428_100877715 3300006844 Bacteria 952
136 Ga0075430_100003951 3300006846 Bacteria 12500
137 Ga0075430_100014747 3300006846 Bacteria 6654
138 Ga0075431_100152851 3300006847 Bacteria 2376
139 Ga0075431_100309296 3300006847 Bacteria 1595
140 Ga0075433_10172946 3300006852 Unclassified 1922
141 Ga0075429_100005504 3300006880 Bacteria 10905
142 Ga0075429_100146597 3300006880 Bacteria 2066
143 Ga0075429_100209826 3300006880 Bacteria 1706
144 Ga0068865_100015643 3300006881 Bacteria 4840
145 Ga0068865_100149341 3300006881 Bacteria 1771
146 Ga0068865_100291831 3300006881 Unclassified 1302
147 Ga0068865_100351516 3300006881 Unclassified 1194
148 Ga0097620_100383891 3300006931 Bacteria 1500
149 Ga0075435_100072589 3300007076 Bacteria 2812
150 Ga0105240_10321210 3300009093 Bacteria 1765
151 Ga0111539_10003156 3300009094 Bacteria 21810
152 Ga0111539_10004911 3300009094 Bacteria 17402
153 Ga0111539_10007568 3300009094 Bacteria 13886
154 Ga0111539_10014668 3300009094 Bacteria 9776
155 Ga0111539_10037347 3300009094 Bacteria 5866
156 Ga0111539_10088625 3300009094 Bacteria 3636
157 Ga0105245_10022996 3300009098 Bacteria 5469
158 Ga0105245_10043180 3300009098 Bacteria 4022
159 Ga0105245_10070670 3300009098 Bacteria 3168
160 Ga0105245_10617705 3300009098 Unclassified 1112
161 Ga0114129_10008493 3300009147 Bacteria 14637
162 Ga0114129_10023004 3300009147 Bacteria 8842
163 Ga0114129_10101666 3300009147 Bacteria 3977
164 Ga0114129_10167537 3300009147 Bacteria 2997
165 Ga0114129_10407924 3300009147 Bacteria 1790
166 Ga0114129_10457274 3300009147 Bacteria 1673
167 Ga0114129_10464551 3300009147 Unclassified 1658
168 Ga0114129_10559991 3300009147 Bacteria 1485
169 Ga0114129_11046111 3300009147 Bacteria 1025
170 Ga0105243_10001866 3300009148 Bacteria 17995
171 Ga0105243_10008877 3300009148 Bacteria 7692
172 Ga0105243_10025655 3300009148 Bacteria 4506
173 Ga0105243_10134145 3300009148 Bacteria 2104
174 Ga0105243_10347616 3300009148 Bacteria 1360
175 Ga0105243_10463607 3300009148 Bacteria 1192
176 Ga0105241_10164410 3300009174 Bacteria 1827
177 Ga0105242_10010745 3300009176 Bacteria 7030
178 Ga0105242_10010764 3300009176 Bacteria 7021
179 Ga0105242_10019168 3300009176 Bacteria 5359
180 Ga0105242_10322315 3300009176 Bacteria 1418
181 Ga0105242_10404759 3300009176 Bacteria 1275
182 Ga0105242_10498152 3300009176 Bacteria 1158
183 Ga0105242_10728422 3300009176 Bacteria 974
184 Ga0105248_10010369 3300009177 Bacteria 10260
185 Ga0105248_10074045 3300009177 Bacteria 3828
186 Ga0105248_10881601 3300009177 Bacteria 1010
187 Ga0105238_10010740 3300009551 Bacteria 9197
188 Ga0105238_10026354 3300009551 Bacteria 5926
189 Ga0105238_10369479 3300009551 Bacteria 1425
190 Ga0105249_10008027 3300009553 Bacteria 9198
191 Ga0105249_10309447 3300009553 Bacteria 1587
192 Ga0105239_10100802 3300010375 Bacteria 3194
193 Ga0105239_10163316 3300010375 Bacteria 2489
194 Ga0105239_10827232 3300010375 Bacteria 1061
195 Ga0105246_10049642 3300011119 Bacteria 2874
196 Ga0105246_10658007 3300011119 Bacteria 913
197 Ga0157371_10019637 3300013102 Bacteria 4979
198 Ga0157371_10226958 3300013102 Bacteria 1342
199 Ga0157369_10159031 3300013105 Bacteria 2385
200 Ga0157374_10266411 3300013296 Bacteria 1689
201 Ga0163162_10328991 3300013306 Bacteria 1660
202 Ga0157372_10029577 3300013307 Bacteria 5983
203 Ga0157372_10090398 3300013307 Bacteria 3481
204 Ga0157372_10133587 3300013307 Bacteria 2857
205 Ga0157375_10007529 3300013308 Bacteria 9518
206 Ga0157375_10023009 3300013308 Bacteria 5744
207 Ga0157375_10058030 3300013308 Bacteria 3828
208 Ga0157375_10426040 3300013308 Bacteria 1493
209 Ga0157375_10885949 3300013308 Bacteria 1037
210 Ga0163163_10052026 3300014325 Bacteria 4039
211 Ga0163163_10151857 3300014325 Bacteria 2359
212 Ga0163163_10269022 3300014325 Bacteria 1755
213 Ga0163163_10598664 3300014325 Bacteria 1166
214 Ga0163163_10950475 3300014325 Bacteria 923
215 Ga0157380_10005445 3300014326 Bacteria 8897
216 Ga0157380_10005654 3300014326 Bacteria 8741
217 Ga0157380_10101773 3300014326 Bacteria 2394
218 Ga0157377_10004275 3300014745 Bacteria 6549
219 Ga0157377_10042326 3300014745 Bacteria 2529
220 Ga0157377_10320660 3300014745 Unclassified 1029
221 Ga0157377_10323412 3300014745 Unclassified 1025
222 Ga0157376_10265965 3300014969 Bacteria 1609
223 Ga0157376_10669018 3300014969 Unclassified 1040
224 Ga0163161_10247872 3300017792 Unclassified 1387
225 Ga0207697_10038038 3300025315 Bacteria 1973
226 Ga0207656_10062820 3300025321 Bacteria 1633
227 Ga0207692_10101949 3300025898 Bacteria 1577
228 Ga0207642_10015699 3300025899 Bacteria 2831
229 Ga0207688_10003985 3300025901 Bacteria 8046
230 Ga0207688_10043392 3300025901 Bacteria 2504
231 Ga0207680_10227481 3300025903 Bacteria 1281
232 Ga0207645_10184239 3300025907 Bacteria 1370
233 Ga0207643_10005813 3300025908 Bacteria 6592
234 Ga0207643_10023281 3300025908 Bacteria 3415
235 Ga0207705_10225855 3300025909 Bacteria 1423
236 Ga0207705_10433731 3300025909 Bacteria 1018
237 Ga0207695_10421920 3300025913 Bacteria 1218
238 Ga0207693_10122730 3300025915 Bacteria 2040
239 Ga0207660_10403025 3300025917 Bacteria 1102
240 Ga0207662_10086982 3300025918 Bacteria 1916
241 Ga0207657_10002141 3300025919 Bacteria 21395
242 Ga0207657_10032356 3300025919 Bacteria 4726
243 Ga0207657_10087272 3300025919 Bacteria 2610
244 Ga0207657_10199896 3300025919 Bacteria 1608
245 Ga0207649_10050478 3300025920 Bacteria 2573
246 Ga0207649_10055195 3300025920 Bacteria 2475
247 Ga0207681_10465157 3300025923 Unclassified 1031
248 Ga0207694_10033677 3300025924 Bacteria 3924
249 Ga0207694_10277476 3300025924 Bacteria 1376
250 Ga0207694_10383120 3300025924 Unclassified 1167
251 Ga0207650_10030676 3300025925 Bacteria 3875
252 Ga0207650_10565591 3300025925 Unclassified 954
253 Ga0207659_10068370 3300025926 Unclassified 2583
254 Ga0207659_10300844 3300025926 Bacteria 1317
255 Ga0207687_10009190 3300025927 Bacteria 6466
256 Ga0207687_10017955 3300025927 Bacteria 4667
257 Ga0207687_10043358 3300025927 Bacteria 3099
258 Ga0207687_10410482 3300025927 Bacteria 1116
259 Ga0207700_10175386 3300025928 Bacteria 1791
260 Ga0207664_10011147 3300025929 Bacteria 6372
261 Ga0207664_10196954 3300025929 Bacteria 1737
262 Ga0207644_10323807 3300025931 Bacteria 1247
263 Ga0207690_10005227 3300025932 Bacteria 7657
264 Ga0207690_10296685 3300025932 Bacteria 1263
265 Ga0207690_10327235 3300025932 Bacteria 1206
266 Ga0207706_10171503 3300025933 Bacteria 1906
267 Ga0207686_10122271 3300025934 Bacteria 1773
268 Ga0207709_10017251 3300025935 Bacteria 4027
269 Ga0207709_10053615 3300025935 Bacteria 2482
270 Ga0207709_10126593 3300025935 Bacteria 1734
271 Ga0207709_10488486 3300025935 Unclassified 959
272 Ga0207669_10027126 3300025937 Bacteria 3129
273 Ga0207669_10039874 3300025937 Unclassified 2719
274 Ga0207669_10079866 3300025937 Bacteria 2090
275 Ga0207704_10030789 3300025938 Bacteria 3013
276 Ga0207704_10277998 3300025938 Bacteria 1271
277 Ga0207704_10350349 3300025938 Unclassified 1149
278 Ga0207691_10004435 3300025940 Bacteria 13605
279 Ga0207691_10009121 3300025940 Bacteria 9520
280 Ga0207711_10019490 3300025941 Bacteria 5647
281 Ga0207689_10160864 3300025942 Bacteria 1850
282 Ga0207661_10031427 3300025944 Bacteria 4101
283 Ga0207661_10213450 3300025944 Bacteria 1702
284 Ga0207661_10292782 3300025944 Bacteria 1457
285 Ga0207661_10444131 3300025944 Bacteria 1181
286 Ga0207679_10089618 3300025945 Bacteria 2375
287 Ga0207679_10554636 3300025945 Bacteria 1031
288 Ga0207667_10509330 3300025949 Bacteria 1220
289 Ga0207651_10283871 3300025960 Bacteria 1369
290 Ga0207651_10545212 3300025960 Bacteria 1008
291 Ga0207712_10013493 3300025961 Bacteria 5240
292 Ga0207712_10138167 3300025961 Bacteria 1866
293 Ga0207668_10370842 3300025972 Bacteria 1202
294 Ga0207677_10018551 3300026023 Bacteria 4178
295 Ga0207677_10136417 3300026023 Bacteria 1871
296 Ga0207703_10403108 3300026035 Unclassified 1269
297 Ga0207639_10008079 3300026041 Bacteria 7194
298 Ga0207639_10035691 3300026041 Bacteria 3680
299 Ga0207678_10336456 3300026067 Bacteria 1300
300 Ga0207708_10000259 3300026075 Bacteria 41740
301 Ga0207708_10068883 3300026075 Bacteria 2708
302 Ga0207708_10158566 3300026075 Bacteria 1786
303 Ga0207708_10203816 3300026075 Bacteria 1579
304 Ga0207702_10306473 3300026078 Unclassified 1508
305 Ga0207702_10526289 3300026078 Bacteria 1154
306 Ga0207702_10922399 3300026078 Bacteria 866
307 Ga0207641_10024262 3300026088 Bacteria 4999
308 Ga0207648_10006891 3300026089 Bacteria 11257
309 Ga0207648_10655163 3300026089 Bacteria 971
310 Ga0207676_10093090 3300026095 Bacteria 2480
311 Ga0207674_10011005 3300026116 Bacteria 10174
312 Ga0207675_100010104 3300026118 Bacteria 8845
313 Ga0207675_100715543 3300026118 Unclassified 1011
314 Ga0207675_100734673 3300026118 Bacteria 998
315 Ga0207683_10008744 3300026121 Bacteria 8646
316 Ga0207683_10019287 3300026121 Bacteria 5822
317 Ga0207683_10118316 3300026121 Bacteria 2377
318 Ga0207698_10010655 3300026142 Bacteria 5925
319 Ga0207698_10014325 3300026142 Bacteria 5268
320 Ga0207428_10029093 3300027907 Bacteria 4583
321 Ga0207428_10050668 3300027907 Bacteria 3321
322 Ga0207428_10205789 3300027907 Bacteria 1480
323 Ga0207428_10291701 3300027907 Bacteria 1209
324 Ga0268266_10153900 3300028379 Bacteria 2075
325 Ga0307408_100338846 3300031548 Unclassified 1272
326 Ga0307405_10197586 3300031731 Bacteria 1458
327 Ga0307410_10348135 3300031852 Bacteria 1183
328 Ga0307410_10404406 3300031852 Bacteria 1104
329 Ga0307406_10233472 3300031901 Unclassified 1375
330 Ga0307409_100020572 3300031995 Bacteria 4502
331 Ga0307409_100718875 3300031995 Bacteria 1000
332 Ga0307416_100048445 3300032002 Bacteria 3371
333 Ga0307416_100067611 3300032002 Bacteria 2948
334 Ga0307416_100099678 3300032002 Bacteria 2524
335 Ga0307416_100157162 3300032002 Bacteria 2095
336 Ga0307416_100363176 3300032002 Unclassified 1471
337 Ga0307416_100623266 3300032002 Bacteria 1161
338 Ga0307411_10232891 3300032005 Bacteria 1437
339 Ga0307415_100041009 3300032126 Bacteria 3071
340 Ga0307415_100090212 3300032126 Bacteria 2216
341 Ga0373945_0066698 3300035116 Bacteria 1354
342 Ga0373960_0015917 3300035121 Unclassified 1927
343 Ga0373943_0005631 3300035170 Bacteria 5620
344 Ga0373943_0006334 3300035170 Bacteria 5312
345 Ga0373946_0021568 3300035171 Bacteria 2499
346 Ga0373946_0054491 3300035171 Bacteria 1683
347 Ga0373931_0042635 3300035691 Unclassified 2387
348 Ga0373935_0112068 3300035692 Bacteria 1812
349 Ga0373927_0038250 3300035695 Bacteria 3115
350 Ga0373927_0175495 3300035695 Bacteria 1405
351 Ga0373947_0007745 3300035725 Bacteria 6205
352 Ga0373947_0010306 3300035725 Bacteria 5364
353 Ga0373937_0001489 3300036401 Bacteria 19646
354 Ga0373925_0012512 3300037068 Bacteria 6147
355 Ga0395899_0113846 3300037312 Bacteria 1942
356 Ga0395900_0030023 3300037418 Bacteria 5579
357 Ga0395900_0262915 3300037418 Bacteria 1722
358 Ga0395898_0005087 3300037466 Bacteria 14250
359 Ga0395898_0041850 3300037466 Bacteria 4522
360 Ga0395898_0052071 3300037466 Bacteria 4000
361 Ga0395905_0021229 3300037471 Bacteria 6144
362 Ga0395905_0024027 3300037471 Bacteria 5753
363 Ga0395905_0291957 3300037471 Bacteria 1517
364 Ga0436360_1092592 3300039438 Bacteria 2070
365 Ga0451845_0702408 3300041501 Bacteria 1723
366 Ga0451853_1533356 3300041512 Bacteria 1998
367 Ga0439455_0040336 3300042012 Bacteria 1193
368 Ga0439463_033153 3300042016 Unclassified 1306
369 Ga0466965_0098019 3300044683 Unclassified 1497
370 Ga0453684_0599363 3300044712 Bacteria 1208
371 Ga0495592_0000362 3300046454 Bacteria 36022
372 Ga0495592_0002396 3300046454 Bacteria 13206
373 Ga0495603_0004603 3300046455 Bacteria 8231
374 Ga0495629_0012219 3300046459 Bacteria 6219
375 Ga0495641_0028325 3300046461 Bacteria 2711
376 Ga0495641_0065264 3300046461 Bacteria 1638
377 Ga0495651_0000037 3300046462 Bacteria 97257
378 Ga0495651_0071394 3300046462 Bacteria 2640
379 Ga0495653_0005841 3300046463 Bacteria 10069
380 Ga0495653_0064182 3300046463 Bacteria 2767
381 Ga0495580_0026665 3300046472 Bacteria 4211
382 Ga0495580_0053034 3300046472 Bacteria 2863
383 Ga0495639_0000647 3300046475 Bacteria 16080
384 Ga0495662_0009172 3300046476 Bacteria 4854
385 Ga0495664_0009342 3300046477 Bacteria 5484
386 Ga0495594_0000157 3300046499 Bacteria 32522
387 Ga0495596_0044489 3300046500 Bacteria 1747
388 Ga0495608_0000561 3300046511 Bacteria 25603
389 Ga0495616_0223399 3300046513 Bacteria 819
390 Ga0495618_0007526 3300046514 Bacteria 6592
391 Ga0495628_0000295 3300046516 Bacteria 44980
392 Ga0495628_0052951 3300046516 Bacteria 3205
393 Ga0495628_0108261 3300046516 Unclassified 2139
394 Ga0495630_0161687 3300046517 Unclassified 1705
395 Ga0495630_0321698 3300046517 Bacteria 1182
396 Ga0495666_0005104 3300046526 Bacteria 6636
397 Ga0495666_0196112 3300046526 Unclassified 929
398 Ga0495652_0000015 3300046529 Bacteria 222624
399 Ga0495652_0098092 3300046529 Unclassified 2382
400 Ga0495665_0008283 3300046531 Bacteria 5635
401 Ga0495640_0008507 3300046533 Bacteria 8043
402 Ga0495587_0000288 3300046536 Bacteria 35655
403 Ga0495645_0000097 3300046543 Bacteria 60603
404 Ga0495645_0002613 3300046543 Bacteria 12250
405 Ga0495622_0144349 3300046557 Unclassified 1079
406 Ga0495667_0058308 3300046559 Bacteria 2537
407 Ga0495634_0051206 3300046642 Bacteria 2771
408 Ga0495635_0018495 3300046663 Bacteria 4860
409 Ga0495588_0000628 3300046674 Bacteria 16489
410 Ga0495657_0066729 3300046675 Bacteria 2363
411 Ga0495599_0000132 3300046678 Bacteria 48518
412 Ga0495599_0073676 3300046678 Unclassified 2131
413 Ga0495623_0000392 3300046679 Bacteria 28835
414 Ga0495623_0045718 3300046679 Unclassified 2780
415 Ga0495646_0000745 3300046680 Bacteria 18128
416 Ga0495647_0001447 3300046681 Bacteria 7356
417 Ga0495658_0000183 3300046683 Bacteria 36190
418 Ga0495613_0111482 3300046689 Unclassified 1971
419 Ga0495613_0116106 3300046689 Bacteria 1925
420 Ga0495624_0001146 3300046690 Bacteria 21006
421 Ga0495600_0019753 3300046809 Bacteria 4306
422 Ga0495581_0000451 3300047315 Bacteria 21053
423 Ga0495604_0000077 3300047317 Bacteria 84167
424 Ga0495674_0104849 3300047319 Bacteria 2403
425 Ga0495674_0112310 3300047319 Unclassified 2309
426 Ga0495672_0114444 3300047320 Bacteria 1443
427 Ga0495676_0024237 3300047321 Bacteria 5256
428 Ga0495680_0035293 3300047322 Bacteria 4029
429 Ga0495680_0184477 3300047322 Unclassified 1504
430 Ga0495675_0000156 3300047444 Bacteria 48295
431 Ga0495593_0008017 3300047673 Bacteria 6145
432 Ga0495602_0000171 3300048088 Bacteria 60650
433 Ga0495602_0019105 3300048088 Bacteria 6816
434 Ga0495614_0000901 3300048089 Bacteria 12628
435 Ga0496100_0015681 3300048903 Bacteria 4429
436 Ga0496100_0069605 3300048903 Bacteria 2344
437 Ga0496101_0068111 3300048904 Unclassified 2601
438 Ga0496101_0134847 3300048904 Bacteria 1878
439 Ga0496102_0021314 3300048905 Bacteria 5731
440 Ga0496102_0101819 3300048905 Bacteria 2669
441 Ga0496102_0163652 3300048905 Bacteria 2093
442 Ga0496104_0015371 3300048907 Bacteria 6931
443 Ga0496104_0119596 3300048907 Bacteria 2529
444 Ga0496104_0122832 3300048907 Bacteria 2493
445 Ga0496104_0147106 3300048907 Bacteria 2262
446 Ga0496104_0165881 3300048907 Bacteria 2118
447 Ga0496104_0272932 3300048907 Bacteria 1604
448 Ga0496104_0349729 3300048907 Bacteria 1391
449 Ga0496105_0046455 3300048908 Bacteria 3584
450 Ga0496105_0216253 3300048908 Unclassified 1561
451 Ga0496106_0148787 3300048909 Bacteria 1846
452 Ga0496106_0174760 3300048909 Bacteria 1704
453 Ga0496107_0050538 3300048910 Bacteria 2997
454 Ga0496107_0113232 3300048910 Bacteria 1995
455 Ga0496107_0156290 3300048910 Bacteria 1689
456 Ga0496108_0008107 3300048911 Bacteria 8516
457 Ga0496108_0030957 3300048911 Bacteria 4435
458 Ga0496108_0049793 3300048911 Bacteria 3504
459 Ga0496108_0150981 3300048911 Bacteria 2005
460 Ga0496108_0203805 3300048911 Bacteria 1717
461 Ga0496109_0002845 3300048912 Bacteria 14479
462 Ga0496109_0029621 3300048912 Bacteria 4903
463 Ga0496110_0000952 3300048913 Bacteria 20269
464 Ga0496110_0157005 3300048913 Bacteria 2061
465 Ga0496110_0640140 3300048913 Bacteria 963
466 Ga0496110_0834277 3300048913 Bacteria 827
467 Ga0496111_0008567 3300048914 Bacteria 6774
468 Ga0496111_0055018 3300048914 Bacteria 2878
469 Ga0496111_0057743 3300048914 Bacteria 2809
470 Ga0496111_0106644 3300048914 Bacteria 2062
471 Ga0496111_0256243 3300048914 Unclassified 1298
472 Ga0496112_0006488 3300048915 Bacteria 10283
473 Ga0496112_0046328 3300048915 Bacteria 4265
474 Ga0496112_0051756 3300048915 Bacteria 4028
475 Ga0496112_0127393 3300048915 Bacteria 2516
476 Ga0496112_0134363 3300048915 Bacteria 2444
477 Ga0496112_0152016 3300048915 Bacteria 2282
478 Ga0496112_0206673 3300048915 Bacteria 1921
479 Ga0496112_0416987 3300048915 Unclassified 1282
480 Ga0496113_0015216 3300048916 Bacteria 5279
481 Ga0496113_0017337 3300048916 Bacteria 4996
482 Ga0496113_0026235 3300048916 Bacteria 4163
483 Ga0496114_0016923 3300048917 Bacteria 5880
484 Ga0496114_0041052 3300048917 Bacteria 3834
485 Ga0496114_0050377 3300048917 Unclassified 3466
486 Ga0496114_0412332 3300048917 Bacteria 1196
487 Ga0496114_0523229 3300048917 Unclassified 1049
488 Ga0496115_0060931 3300048918 Bacteria 3041
489 Ga0501032_0151224 3300049569 Bacteria 1526
490 Ga0501033_0196188 3300049570 Bacteria 1443
491 Ga0501034_0014313 3300049571 Bacteria 8175
492 Ga0501037_0005770 3300049573 Bacteria 9039
493 Ga0501038_0094421 3300049574 Bacteria 2500
494 Ga0501039_0005742 3300049575 Bacteria 9393
495 Ga0501039_0018474 3300049575 Bacteria 5353
496 Ga0501039_0180990 3300049575 Bacteria 1658
497 Ga0501039_0200103 3300049575 Bacteria 1571
498 Ga0501040_0166186 3300049576 Bacteria 1561
499 Ga0501041_0162468 3300049577 Bacteria 1396
500 Ga0501042_0007826 3300049578 Bacteria 7024
501 Ga0501042_0053546 3300049578 Bacteria 2879
502 Ga0501043_0050470 3300049579 Bacteria 3270
503 Ga0501046_0107475 3300049580 Unclassified 2135
504 Ga0501048_0065542 3300049582 Bacteria 2568
505 Ga0501048_0115974 3300049582 Bacteria 1892
506 Ga0501067_0012389 3300049583 Bacteria 4730
507 Ga0501067_0041103 3300049583 Bacteria 2567
508 Ga0501068_0000325 3300049584 Bacteria 23813
509 Ga0501068_0020429 3300049584 Bacteria 3858
510 Ga0501068_0147989 3300049584 Bacteria 1475
511 Ga0501069_0030398 3300049585 Bacteria 2966
512 Ga0501069_0082716 3300049585 Bacteria 1809
513 Ga0501069_0131642 3300049585 Bacteria 1432
514 Ga0501070_0203840 3300049586 Bacteria 1624
515 Ga0501070_0244655 3300049586 Bacteria 1468
516 Ga0501071_0106509 3300049587 Unclassified 2070
517 Ga0501072_0021859 3300049588 Bacteria 4962
518 Ga0501072_0039400 3300049588 Bacteria 3710
519 Ga0501072_0052155 3300049588 Unclassified 3220
520 Ga0501072_0081912 3300049588 Bacteria 2558
521 Ga0501072_0085994 3300049588 Bacteria 2495
522 Ga0501072_0153386 3300049588 Bacteria 1837
523 Ga0501074_0038956 3300049590 Bacteria 3442
524 Ga0501075_0011493 3300049591 Bacteria 6267
525 Ga0501075_0061359 3300049591 Bacteria 2833
526 Ga0501075_0493420 3300049591 Bacteria 934
527 Ga0501076_0016536 3300049592 Bacteria 5592
528 Ga0501076_0028409 3300049592 Bacteria 4343
529 Ga0501076_0101058 3300049592 Bacteria 2324
530 Ga0501076_0293140 3300049592 Unclassified 1333
531 Ga0501077_0074489 3300049593 Bacteria 2150
532 Ga0501079_0004819 3300049741 Bacteria 9998
533 Ga0501079_0021568 3300049741 Bacteria 4928
534 Ga0501079_0123585 3300049741 Bacteria 2013
535 Ga0501079_0244288 3300049741 Bacteria 1403
536 Ga0501079_0298802 3300049741 Bacteria 1260
537 Ga0501080_0313853 3300049742 Bacteria 1420
538 Ga0501080_0315323 3300049742 Bacteria 1417
539 Ga0501081_0098787 3300049743 Bacteria 2062
540 Ga0501081_0319320 3300049743 Bacteria 1141
541 Ga0501083_0156553 3300049744 Bacteria 1491
542 Ga0501083_0400637 3300049744 Bacteria 893
543 Ga0501035_0129236 3300049822 Bacteria 2203
544 Ga0501035_0258865 3300049822 Bacteria 1476
545 Ga0501045_0018855 3300049824 Bacteria 4911
546 Ga0501045_0114097 3300049824 Bacteria 2004
547 nmdc:mga0yw44_21263_c1 3300050492 Bacteria 3616
548 nmdc:mga05p37_113270_c1 3300050507 Bacteria 3335
549 nmdc:mga05p37_169956_c1 3300050507 Bacteria 2659
550 nmdc:mga05p37_199105_c1 3300050507 Bacteria 2427
551 nmdc:mga05p37_3840_c1 3300050507 Bacteria 8522
552 nmdc:mga05p37_41889_c2 3300050507 Bacteria 5226
553 nmdc:mga05p37_48902_c1 3300050507 Bacteria 5200
554 nmdc:mga05p37_6814_c1 3300050507 Bacteria 13466
555 nmdc:mga05p37_72807_c1 3300050507 Bacteria 4229
556 nmdc:mga05p37_749118_c1 3300050507 Bacteria 1077
557 nmdc:mga09592_12284_c1 3300050508 Bacteria 6972
558 nmdc:mga09592_34136_c1 3300050508 Bacteria 4252
559 nmdc:mga09592_5391_c1 3300050508 Bacteria 10402
560 nmdc:mga0qj67_293549_c1 3300050509 Bacteria 1317
561 nmdc:mga0qj67_51184_c1 3300050509 Bacteria 3265
562 nmdc:mga0qj67_5283_c1 3300050509 Bacteria 9419
563 nmdc:mga0qj67_8464_c1 3300050509 Bacteria 6554
564 nmdc:mga06r32_165329_c1 3300050510 Bacteria 2195
565 nmdc:mga06r32_204029_c1 3300050510 Bacteria 1965
566 nmdc:mga06r32_30836_c1 3300050510 Bacteria 5032
567 nmdc:mga08y16_114083_c1 3300050511 Bacteria 2813
568 nmdc:mga08y16_19442_c1 3300050511 Bacteria 7161
569 nmdc:mga08y16_263103_c1 3300050511 Bacteria 1781
570 nmdc:mga08y16_4771_c1 3300050511 Bacteria 14145
571 nmdc:mga08y16_4986_c1 3300050511 Bacteria 13880
572 nmdc:mga08y16_535311_c1 3300050511 Bacteria 1187
573 nmdc:mga0rr50_102621_c1 3300050513 Bacteria 2250
574 nmdc:mga0rr50_28019_c2 3300050513 Bacteria 1586
575 nmdc:mga0a205_83639_c1 3300050515 Bacteria 3082
576 nmdc:mga0a205_83896_c1 3300050515 Bacteria 3077
577 Ga0495601_0000133 3300053077 Bacteria 42065
578 Ga0495601_0065728 3300053077 Unclassified 2308
579 Ga0495601_0067676 3300053077 Bacteria 2275
580 Ga0495612_0002626 3300053078 Bacteria 7405
581 Ga0495655_0015927 3300053083 Bacteria 1609
582 Ga0495595_0114251 3300053084 Unclassified 1311
583 Ga0495595_0178492 3300053084 Bacteria 1052
584 Ga0495619_0000400 3300053085 Bacteria 29573
585 Ga0495619_0124524 3300053085 Bacteria 1768
586 Ga0500566_0070823 3300053094 Bacteria 1957
587 Ga0500616_0000354 3300053153 Bacteria 65496
588 Ga0501084_0071194 3300054114 Bacteria 2912
589 Ga0501084_0120576 3300054114 Bacteria 2205
590 Ga0501084_0344211 3300054114 Bacteria 1259
591 Ga0501084_0390533 3300054114 Bacteria 1176
592 Ga0501084_0420333 3300054114 Unclassified 1130
593 Ga0501082_0004869 3300060353 Bacteria 11712
594 Ga0501082_0162120 3300060353 Bacteria 1943
595 Ga0530510_0009459 3300061734 Bacteria 6832
596 Ga0530510_0057673 3300061734 Bacteria 2806
597 Ga0530510_0090182 3300061734 Bacteria 2236
598 Ga0530510_0107273 3300061734 Bacteria 2044
599 Ga0530510_0150042 3300061734 Bacteria 1721
600 Ga0530510_0229372 3300061734 Bacteria 1381
601 Ga0530510_0235538 3300061734 Bacteria 1362
602 Ga0530510_0261860 3300061734 Bacteria 1290
603 Ga0530510_0466265 3300061734 Bacteria 956
604 Ga0316574_0014303
605 JGI24739J22299_10032492
606 JGI24745J21846_1009133
607 JGI24738J21930_10004890
608 JGI24738J21930_10008559
609 JGI24744J21845_10038369
610 JGI24742J22300_10031080
611 JGI25407J50210_10005433
612 JGI25407J50210_10008282
613 JGI25407J50210_10040533
614 Ga0070658_10013974
615 Ga0070676_10119936
616 Ga0070683_100040741
617 Ga0070683_100069620
618 Ga0070683_100122928
619 Ga0070683_100208484
620 Ga0070683_100313936
621 Ga0070683_100346822
622 Ga0070690_100482955
623 Ga0070670_100152428
624 Ga0070670_100174016
625 Ga0068869_100150164
626 Ga0070680_100314200
627 Ga0070680_100395818
628 Ga0070682_100006837
629 Ga0070682_100014400
630 Ga0070682_100262340
631 Ga0070682_100373270
632 Ga0068868_100005641
633 Ga0068868_100170085
634 Ga0068868_100233157
635 Ga0070660_100061134
636 Ga0070660_100079776
637 Ga0070660_100129067
638 Ga0070691_10067200
639 Ga0070687_100032544
640 Ga0070661_100007933
641 Ga0070692_10001261
642 Ga0070692_10001544
643 Ga0070675_100013343
644 Ga0070675_100256255
645 Ga0070671_100236772
646 Ga0070671_100274832
647 Ga0070671_100516126
648 Ga0070674_100087285
649 Ga0070674_100192227
650 Ga0070673_100117931
651 Ga0070673_100193387
652 Ga0070688_100294734
653 Ga0070659_100166444
654 Ga0070714_100011014
655 Ga0070714_100500682
656 Ga0070713_100081716
657 Ga0070713_100426623
658 Ga0070701_10000968
659 Ga0070711_100013456
660 Ga0070700_100001110
661 Ga0070700_100122683
662 Ga0070694_100164866
663 Ga0070663_100029308
664 Ga0070678_100001021
665 Ga0070678_100175431
666 Ga0070678_100355680
667 Ga0070662_100034086
668 Ga0070681_10081108
669 Ga0070681_10264823
670 Ga0068867_100003260
671 Ga0068867_100520502
672 Ga0068867_100543753
673 Ga0070685_10067625
674 Ga0070685_10308228
675 Ga0070698_100363297
676 Ga0070699_100321599
677 Ga0070684_100004377
678 Ga0070684_100011907
679 Ga0070684_100220085
680 Ga0068853_100020164
681 Ga0070672_100009314
682 Ga0070672_100010774
683 Ga0070686_100034650
684 Ga0070695_100099555
685 Ga0070693_100108607
686 Ga0070665_100034827
687 Ga0070665_100706532
688 Ga0070704_100672015
689 Ga0068855_100089812
690 Ga0070664_100063245
691 Ga0068857_100016885
692 Ga0068856_100057099
693 Ga0070702_100011113
694 Ga0070702_100011236
695 Ga0070702_100025348
696 Ga0070702_100182836
697 Ga0070702_100203661
698 Ga0068852_100001464
699 Ga0068852_100002729
700 Ga0068852_100132308
701 Ga0068852_100725476
702 Ga0068859_100383943
703 Ga0068861_100159176
704 Ga0068861_100330973
705 Ga0068851_10023005
706 Ga0068851_10044309
707 Ga0068870_10020631
708 Ga0068870_10063379
709 Ga0068858_100513654
710 Ga0068860_100683181
711 Ga0081455_10006072
712 Ga0081455_10019446
713 Ga0081455_10022817
714 Ga0081455_10022835
715 Ga0081455_10067704
716 Ga0081455_10074510
717 Ga0081455_10114969
718 Ga0081455_10162329
719 Ga0081455_10229811
720 Ga0081455_10348133
721 Ga0081538_10000225
722 Ga0081538_10003288
723 Ga0081538_10004842
724 Ga0081538_10009665
725 Ga0081538_10009666
726 Ga0081540_1022850
727 Ga0070717_10153503
728 Ga0075364_10085343
729 Ga0070712_100135833
730 Ga0097621_100142848
731 Ga0068871_100569333
732 Ga0075428_100022144
733 Ga0075428_100037963
734 Ga0075428_100088102
735 Ga0075428_100098283
736 Ga0075428_100311601
737 Ga0075428_100388780
738 Ga0075428_100877715
739 Ga0075430_100003951
740 Ga0075430_100014747
741 Ga0075431_100152851
742 Ga0075431_100309296
743 Ga0075433_10172946
744 Ga0075429_100005504
745 Ga0075429_100146597
746 Ga0075429_100209826
747 Ga0068865_100015643
748 Ga0068865_100149341
749 Ga0068865_100291831
750 Ga0068865_100351516
751 Ga0097620_100383891
752 Ga0075435_100072589
753 Ga0105240_10321210
754 Ga0111539_10003156
755 Ga0111539_10004911
756 Ga0111539_10007568
757 Ga0111539_10014668
758 Ga0111539_10037347
759 Ga0111539_10088625
760 Ga0105245_10022996
761 Ga0105245_10043180
762 Ga0105245_10070670
763 Ga0105245_10617705
764 Ga0114129_10008493
765 Ga0114129_10023004
766 Ga0114129_10101666
767 Ga0114129_10167537
768 Ga0114129_10407924
769 Ga0114129_10457274
770 Ga0114129_10464551
771 Ga0114129_10559991
772 Ga0114129_11046111
773 Ga0105243_10001866
774 Ga0105243_10008877
775 Ga0105243_10025655
776 Ga0105243_10134145
777 Ga0105243_10347616
778 Ga0105243_10463607
779 Ga0105241_10164410
780 Ga0105242_10010745
781 Ga0105242_10010764
782 Ga0105242_10019168
783 Ga0105242_10322315
784 Ga0105242_10404759
785 Ga0105242_10498152
786 Ga0105242_10728422
787 Ga0105248_10010369
788 Ga0105248_10074045
789 Ga0105248_10881601
790 Ga0105238_10010740
791 Ga0105238_10026354
792 Ga0105238_10369479
793 Ga0105249_10008027
794 Ga0105249_10309447
795 Ga0105239_10100802
796 Ga0105239_10163316
797 Ga0105239_10827232
798 Ga0105246_10049642
799 Ga0105246_10658007
800 Ga0157371_10019637
801 Ga0157371_10226958
802 Ga0157369_10159031
803 Ga0157374_10266411
804 Ga0163162_10328991
805 Ga0157372_10029577
806 Ga0157372_10090398
807 Ga0157372_10133587
808 Ga0157375_10007529
809 Ga0157375_10023009
810 Ga0157375_10058030
811 Ga0157375_10426040
812 Ga0157375_10885949
813 Ga0163163_10052026
814 Ga0163163_10151857
815 Ga0163163_10269022
816 Ga0163163_10598664
817 Ga0163163_10950475
818 Ga0157380_10005445
819 Ga0157380_10005654
820 Ga0157380_10101773
821 Ga0157377_10004275
822 Ga0157377_10042326
823 Ga0157377_10320660
824 Ga0157377_10323412
825 Ga0157376_10265965
826 Ga0157376_10669018
827 Ga0163161_10247872
828 Ga0207697_10038038
829 Ga0207656_10062820
830 Ga0207692_10101949
831 Ga0207642_10015699
832 Ga0207688_10003985
833 Ga0207688_10043392
834 Ga0207680_10227481
835 Ga0207645_10184239
836 Ga0207643_10005813
837 Ga0207643_10023281
838 Ga0207705_10225855
839 Ga0207705_10433731
840 Ga0207695_10421920
841 Ga0207693_10122730
842 Ga0207660_10403025
843 Ga0207662_10086982
844 Ga0207657_10002141
845 Ga0207657_10032356
846 Ga0207657_10087272
847 Ga0207657_10199896
848 Ga0207649_10050478
849 Ga0207649_10055195
850 Ga0207681_10465157
851 Ga0207694_10033677
852 Ga0207694_10277476
853 Ga0207694_10383120
854 Ga0207650_10030676
855 Ga0207650_10565591
856 Ga0207659_10068370
857 Ga0207659_10300844
858 Ga0207687_10009190
859 Ga0207687_10017955
860 Ga0207687_10043358
861 Ga0207687_10410482
862 Ga0207700_10175386
863 Ga0207664_10011147
864 Ga0207664_10196954
865 Ga0207644_10323807
866 Ga0207690_10005227
867 Ga0207690_10296685
868 Ga0207690_10327235
869 Ga0207706_10171503
870 Ga0207686_10122271
871 Ga0207709_10017251
872 Ga0207709_10053615
873 Ga0207709_10126593
874 Ga0207709_10488486
875 Ga0207669_10027126
876 Ga0207669_10039874
877 Ga0207669_10079866
878 Ga0207704_10030789
879 Ga0207704_10277998
880 Ga0207704_10350349
881 Ga0207691_10004435
882 Ga0207691_10009121
883 Ga0207711_10019490
884 Ga0207689_10160864
885 Ga0207661_10031427
886 Ga0207661_10213450
887 Ga0207661_10292782
888 Ga0207661_10444131
889 Ga0207679_10089618
890 Ga0207679_10554636
891 Ga0207667_10509330
892 Ga0207651_10283871
893 Ga0207651_10545212
894 Ga0207712_10013493
895 Ga0207712_10138167
896 Ga0207668_10370842
897 Ga0207677_10018551
898 Ga0207677_10136417
899 Ga0207703_10403108
900 Ga0207639_10008079
901 Ga0207639_10035691
902 Ga0207678_10336456
903 Ga0207708_10000259
904 Ga0207708_10068883
905 Ga0207708_10158566
906 Ga0207708_10203816
907 Ga0207702_10306473
908 Ga0207702_10526289
909 Ga0207702_10922399
910 Ga0207641_10024262
911 Ga0207648_10006891
912 Ga0207648_10655163
913 Ga0207676_10093090
914 Ga0207674_10011005
915 Ga0207675_100010104
916 Ga0207675_100715543
917 Ga0207675_100734673
918 Ga0207683_10008744
919 Ga0207683_10019287
920 Ga0207683_10118316
921 Ga0207698_10010655
922 Ga0207698_10014325
923 Ga0207428_10029093
924 Ga0207428_10050668
925 Ga0207428_10205789
926 Ga0207428_10291701
927 Ga0268266_10153900
928 Ga0307408_100338846
929 Ga0307405_10197586
930 Ga0307410_10348135
931 Ga0307410_10404406
932 Ga0307406_10233472
933 Ga0307409_100020572
934 Ga0307409_100718875
935 Ga0307416_100048445
936 Ga0307416_100067611
937 Ga0307416_100099678
938 Ga0307416_100157162
939 Ga0307416_100363176
940 Ga0307416_100623266
941 Ga0307411_10232891
942 Ga0307415_100041009
943 Ga0307415_100090212
944 Ga0373945_0066698
945 Ga0373960_0015917
946 Ga0373943_0005631
947 Ga0373943_0006334
948 Ga0373946_0021568
949 Ga0373946_0054491
950 Ga0373931_0042635
951 Ga0373935_0112068
952 Ga0373927_0038250
953 Ga0373927_0175495
954 Ga0373947_0007745
955 Ga0373947_0010306
956 Ga0373937_0001489
957 Ga0373925_0012512
958 Ga0395899_0113846
959 Ga0395900_0030023
960 Ga0395900_0262915
961 Ga0395898_0005087
962 Ga0395898_0041850
963 Ga0395898_0052071
964 Ga0395905_0021229
965 Ga0395905_0024027
966 Ga0395905_0291957
967 Ga0436360_1092592
968 Ga0451845_0702408
969 Ga0451853_1533356
970 Ga0439455_0040336
971 Ga0439463_033153
972 Ga0466965_0098019
973 Ga0453684_0599363
974 Ga0495592_0000362
975 Ga0495592_0002396
976 Ga0495603_0004603
977 Ga0495629_0012219
978 Ga0495641_0028325
979 Ga0495641_0065264
980 Ga0495651_0000037
981 Ga0495651_0071394
982 Ga0495653_0005841
983 Ga0495653_0064182
984 Ga0495580_0026665
985 Ga0495580_0053034
986 Ga0495639_0000647
987 Ga0495662_0009172
988 Ga0495664_0009342
989 Ga0495594_0000157
990 Ga0495596_0044489
991 Ga0495608_0000561
992 Ga0495616_0223399
993 Ga0495618_0007526
994 Ga0495628_0000295
995 Ga0495628_0052951
996 Ga0495628_0108261
997 Ga0495630_0161687
998 Ga0495630_0321698
999 Ga0495666_0005104
1000 Ga0495666_0196112
1001 Ga0495652_0000015
1002 Ga0495652_0098092
1003 Ga0495665_0008283
1004 Ga0495640_0008507
1005 Ga0495587_0000288
1006 Ga0495645_0000097
1007 Ga0495645_0002613
1008 Ga0495622_0144349
1009 Ga0495667_0058308
1010 Ga0495634_0051206
1011 Ga0495635_0018495
1012 Ga0495588_0000628
1013 Ga0495657_0066729
1014 Ga0495599_0000132
1015 Ga0495599_0073676
1016 Ga0495623_0000392
1017 Ga0495623_0045718
1018 Ga0495646_0000745
1019 Ga0495647_0001447
1020 Ga0495658_0000183
1021 Ga0495613_0111482
1022 Ga0495613_0116106
1023 Ga0495624_0001146
1024 Ga0495600_0019753
1025 Ga0495581_0000451
1026 Ga0495604_0000077
1027 Ga0495674_0104849
1028 Ga0495674_0112310
1029 Ga0495672_0114444
1030 Ga0495676_0024237
1031 Ga0495680_0035293
1032 Ga0495680_0184477
1033 Ga0495675_0000156
1034 Ga0495593_0008017
1035 Ga0495602_0000171
1036 Ga0495602_0019105
1037 Ga0495614_0000901
1038 Ga0496100_0015681
1039 Ga0496100_0069605
1040 Ga0496101_0068111
1041 Ga0496101_0134847
1042 Ga0496102_0021314
1043 Ga0496102_0101819
1044 Ga0496102_0163652
1045 Ga0496104_0015371
1046 Ga0496104_0119596
1047 Ga0496104_0122832
1048 Ga0496104_0147106
1049 Ga0496104_0165881
1050 Ga0496104_0272932
1051 Ga0496104_0349729
1052 Ga0496105_0046455
1053 Ga0496105_0216253
1054 Ga0496106_0148787
1055 Ga0496106_0174760
1056 Ga0496107_0050538
1057 Ga0496107_0113232
1058 Ga0496107_0156290
1059 Ga0496108_0008107
1060 Ga0496108_0030957
1061 Ga0496108_0049793
1062 Ga0496108_0150981
1063 Ga0496108_0203805
1064 Ga0496109_0002845
1065 Ga0496109_0029621
1066 Ga0496110_0000952
1067 Ga0496110_0157005
1068 Ga0496110_0640140
1069 Ga0496110_0834277
1070 Ga0496111_0008567
1071 Ga0496111_0055018
1072 Ga0496111_0057743
1073 Ga0496111_0106644
1074 Ga0496111_0256243
1075 Ga0496112_0006488
1076 Ga0496112_0046328
1077 Ga0496112_0051756
1078 Ga0496112_0127393
1079 Ga0496112_0134363
1080 Ga0496112_0152016
1081 Ga0496112_0206673
1082 Ga0496112_0416987
1083 Ga0496113_0015216
1084 Ga0496113_0017337
1085 Ga0496113_0026235
1086 Ga0496114_0016923
1087 Ga0496114_0041052
1088 Ga0496114_0050377
1089 Ga0496114_0412332
1090 Ga0496114_0523229
1091 Ga0496115_0060931
1092 Ga0501032_0151224
1093 Ga0501033_0196188
1094 Ga0501034_0014313
1095 Ga0501037_0005770
1096 Ga0501038_0094421
1097 Ga0501039_0005742
1098 Ga0501039_0018474
1099 Ga0501039_0180990
1100 Ga0501039_0200103
1101 Ga0501040_0166186
1102 Ga0501041_0162468
1103 Ga0501042_0007826
1104 Ga0501042_0053546
1105 Ga0501043_0050470
1106 Ga0501046_0107475
1107 Ga0501048_0065542
1108 Ga0501048_0115974
1109 Ga0501067_0012389
1110 Ga0501067_0041103
1111 Ga0501068_0000325
1112 Ga0501068_0020429
1113 Ga0501068_0147989
1114 Ga0501069_0030398
1115 Ga0501069_0082716
1116 Ga0501069_0131642
1117 Ga0501070_0203840
1118 Ga0501070_0244655
1119 Ga0501071_0106509
1120 Ga0501072_0021859
1121 Ga0501072_0039400
1122 Ga0501072_0052155
1123 Ga0501072_0081912
1124 Ga0501072_0085994
1125 Ga0501072_0153386
1126 Ga0501074_0038956
1127 Ga0501075_0011493
1128 Ga0501075_0061359
1129 Ga0501075_0493420
1130 Ga0501076_0016536
1131 Ga0501076_0028409
1132 Ga0501076_0101058
1133 Ga0501076_0293140
1134 Ga0501077_0074489
1135 Ga0501079_0004819
1136 Ga0501079_0021568
1137 Ga0501079_0123585
1138 Ga0501079_0244288
1139 Ga0501079_0298802
1140 Ga0501080_0313853
1141 Ga0501080_0315323
1142 Ga0501081_0098787
1143 Ga0501081_0319320
1144 Ga0501083_0156553
1145 Ga0501083_0400637
1146 Ga0501035_0129236
1147 Ga0501035_0258865
1148 Ga0501045_0018855
1149 Ga0501045_0114097
1150 nmdc:mga0yw44_21263_c1
1151 nmdc:mga05p37_113270_c1
1152 nmdc:mga05p37_169956_c1
1153 nmdc:mga05p37_199105_c1
1154 nmdc:mga05p37_3840_c1
1155 nmdc:mga05p37_41889_c2
1156 nmdc:mga05p37_48902_c1
1157 nmdc:mga05p37_6814_c1
1158 nmdc:mga05p37_72807_c1
1159 nmdc:mga05p37_749118_c1
1160 nmdc:mga09592_12284_c1
1161 nmdc:mga09592_34136_c1
1162 nmdc:mga09592_5391_c1
1163 nmdc:mga0qj67_293549_c1
1164 nmdc:mga0qj67_51184_c1
1165 nmdc:mga0qj67_5283_c1
1166 nmdc:mga0qj67_8464_c1
1167 nmdc:mga06r32_165329_c1
1168 nmdc:mga06r32_204029_c1
1169 nmdc:mga06r32_30836_c1
1170 nmdc:mga08y16_114083_c1
1171 nmdc:mga08y16_19442_c1
1172 nmdc:mga08y16_263103_c1
1173 nmdc:mga08y16_4771_c1
1174 nmdc:mga08y16_4986_c1
1175 nmdc:mga08y16_535311_c1
1176 nmdc:mga0rr50_102621_c1
1177 nmdc:mga0rr50_28019_c2
1178 nmdc:mga0a205_83639_c1
1179 nmdc:mga0a205_83896_c1
1180 Ga0495601_0000133
1181 Ga0495601_0065728
1182 Ga0495601_0067676
1183 Ga0495612_0002626
1184 Ga0495655_0015927
1185 Ga0495595_0114251
1186 Ga0495595_0178492
1187 Ga0495619_0000400
1188 Ga0495619_0124524
1189 Ga0500566_0070823
1190 Ga0500616_0000354
1191 Ga0501084_0071194
1192 Ga0501084_0120576
1193 Ga0501084_0344211
1194 Ga0501084_0390533
1195 Ga0501084_0420333
1196 Ga0501082_0004869
1197 Ga0501082_0162120
1198 Ga0530510_0009459
1199 Ga0530510_0057673
1200 Ga0530510_0090182
1201 Ga0530510_0107273
1202 Ga0530510_0150042
1203 Ga0530510_0229372
1204 Ga0530510_0235538
1205 Ga0530510_0261860
1206 Ga0530510_0466265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gfg-assembly3.cif.gz_C crystal structure of a putative adenylate cyclase (bh2851) from bacillus halodurans at 2.12 a resolution 0.8254 16 236
3sy3-assembly2.cif.gz_C gbaa_1210 protein, a putative adenylate cyclase, from bacillus anthracis 0.8011 17 229
2gfg-assembly3.cif.gz_C crystal structure of a putative adenylate cyclase (bh2851) from bacillus halodurans at 2.12 a resolution 0.798 16 236
3v85-assembly1.cif.gz_A 1.9 angstrom resolution crystal structure of the protein q9siy3 from arabidopsis thaliana 0.7878 18 235
5a68-assembly1.cif.gz_A crystal structure of the atttm3 product complex with two orthophosphates and manganese ions (form b) 0.7817 16 234
ID Description Score Start End Superfamily
2gfgC00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.8198 16 236 2.40.320.10
2gfgC00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7965 16 236 2.40.320.10
af_I1MU21_1_199_2.40.320.10 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7919 18 235 2.40.320.10
3sy3C00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7845 17 229 2.40.320.10
3sy3C00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7648 17 229 2.40.320.10
ID Description Score Start End GO Terms
AF-A0A4T0V873-F1-model_v4 Adenylate cyclase 0.9884 1 242
AF-A0A0T0ME39-F1-model_v4 Adenylate cyclase 0.9868 1 247
AF-A0A4Q6BP51-F1-model_v4 Adenylate cyclase 0.986 1 247
AF-A0A552WPD0-F1-model_v4 Adenylate cyclase 0.9845 1 252
AF-A0A6N7A0H7-F1-model_v4 Adenylate cyclase 0.9835 1 250

Map