F468225

General Info

Members Datasets Scaffolds Average Seq Length
602 235 1204 134

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0245520|Ga0501080_0245520_257_724
Length 155
Sequence VHHGQYIPPDPSKGDDTTVGGYAAVHGRPAALEGRDGFSYSIEILSDDVDEPNAPPAERFGAYLMFVQWARLGAQRPEGHLETPFLTRAETPEAAERALGAMPLREAQAVLDGLLRARDGASTRRWWNVLEDNDEPGRQDDADEAPPTPDGGGRA

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
224 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
225 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0245520 3300049742 Bacteria 1633
2 Ga0065704_10425993 3300005289 Bacteria 727
3 Ga0065715_10107941 3300005293 Bacteria 2739
4 Ga0065707_10098289 3300005295 Bacteria 3097
5 Ga0070658_10001473 3300005327 Bacteria 20012
6 Ga0070658_10018352 3300005327 Bacteria 5601
7 Ga0070658_10037752 3300005327 Bacteria 3894
8 Ga0070658_10086949 3300005327 Bacteria 2572
9 Ga0070658_10102079 3300005327 Bacteria 2372
10 Ga0070658_10251119 3300005327 Bacteria 1500
11 Ga0070676_10043123 3300005328 Bacteria 2621
12 Ga0070676_10080142 3300005328 Bacteria 1978
13 Ga0070676_10170404 3300005328 Bacteria 1408
14 Ga0070676_10729817 3300005328 Bacteria 726
15 Ga0070683_100001659 3300005329 Bacteria 17249
16 Ga0070683_100078115 3300005329 Bacteria 3096
17 Ga0070683_100091053 3300005329 Bacteria 2864
18 Ga0070683_100098917 3300005329 Bacteria 2745
19 Ga0070690_100052882 3300005330 Bacteria 2597
20 Ga0070670_100147064 3300005331 Bacteria 2039
21 Ga0070670_100299606 3300005331 Unclassified 1406
22 Ga0070670_100616848 3300005331 Bacteria 971
23 Ga0070670_100745117 3300005331 Bacteria 882
24 Ga0070670_100836906 3300005331 Bacteria 832
25 Ga0070677_10108176 3300005333 Bacteria 1237
26 Ga0068869_100037218 3300005334 Bacteria 3459
27 Ga0068869_100681904 3300005334 Bacteria 875
28 Ga0070666_10272449 3300005335 Bacteria 1202
29 Ga0070666_10427264 3300005335 Bacteria 955
30 Ga0070680_100069444 3300005336 Bacteria 2893
31 Ga0070680_100247631 3300005336 Bacteria 1507
32 Ga0070680_100352969 3300005336 Bacteria 1251
33 Ga0070680_100974934 3300005336 Bacteria 732
34 Ga0070680_101701124 3300005336 Unclassified 547
35 Ga0070682_100225283 3300005337 Bacteria 1337
36 Ga0068868_100013320 3300005338 Bacteria 6027
37 Ga0068868_100542428 3300005338 Bacteria 1024
38 Ga0068868_100766653 3300005338 Bacteria 868
39 Ga0070660_100027454 3300005339 Bacteria 4248
40 Ga0070660_100282401 3300005339 Bacteria 1359
41 Ga0070660_100415861 3300005339 Bacteria 1113
42 Ga0070660_101238616 3300005339 Bacteria 633
43 Ga0070689_100009822 3300005340 Bacteria 6802
44 Ga0070689_100013450 3300005340 Bacteria 5921
45 Ga0070687_100000802 3300005343 Bacteria 10454
46 Ga0070687_100158632 3300005343 Bacteria 1335
47 Ga0070661_100030223 3300005344 Bacteria 3913
48 Ga0070661_100082144 3300005344 Bacteria 2380
49 Ga0070661_100084197 3300005344 Bacteria 2350
50 Ga0070661_100097337 3300005344 Bacteria 2185
51 Ga0070661_100247100 3300005344 Bacteria 1376
52 Ga0070692_10003001 3300005345 Bacteria 6720
53 Ga0070692_10395699 3300005345 Bacteria 871
54 Ga0070692_10699691 3300005345 Bacteria 682
55 Ga0070668_100007377 3300005347 Bacteria 8157
56 Ga0070668_100018175 3300005347 Bacteria 5275
57 Ga0070668_100036663 3300005347 Bacteria 3742
58 Ga0070668_101122493 3300005347 Bacteria 710
59 Ga0070669_100001372 3300005353 Bacteria 17568
60 Ga0070669_100007096 3300005353 Bacteria 8048
61 Ga0070669_100017943 3300005353 Bacteria 5054
62 Ga0070669_100053223 3300005353 Bacteria 2963
63 Ga0070669_101176192 3300005353 Unclassified 662
64 Ga0070675_100002568 3300005354 Bacteria 13597
65 Ga0070675_100073756 3300005354 Bacteria 2834
66 Ga0070675_100078342 3300005354 Bacteria 2752
67 Ga0070675_100097432 3300005354 Bacteria 2473
68 Ga0070675_100487310 3300005354 Bacteria 1110
69 Ga0070671_100017231 3300005355 Bacteria 5849
70 Ga0070671_100062920 3300005355 Bacteria 3089
71 Ga0070671_100555896 3300005355 Bacteria 990
72 Ga0070671_100719399 3300005355 Bacteria 867
73 Ga0070671_100996695 3300005355 Bacteria 734
74 Ga0070674_100438197 3300005356 Bacteria 1076
75 Ga0070674_100783788 3300005356 Bacteria 822
76 Ga0070674_100846117 3300005356 Bacteria 793
77 Ga0070673_100228901 3300005364 Bacteria 1612
78 Ga0070673_100253476 3300005364 Bacteria 1535
79 Ga0070673_100366619 3300005364 Bacteria 1282
80 Ga0070688_100041983 3300005365 Bacteria 2811
81 Ga0070688_100446351 3300005365 Bacteria 966
82 Ga0070688_100571617 3300005365 Bacteria 862
83 Ga0070659_100019307 3300005366 Bacteria 5162
84 Ga0070659_100031600 3300005366 Bacteria 4102
85 Ga0070659_100215422 3300005366 Bacteria 1584
86 Ga0070659_100241581 3300005366 Bacteria 1495
87 Ga0070659_100504340 3300005366 Bacteria 1032
88 Ga0070667_100038557 3300005367 Bacteria 4005
89 Ga0070667_100079612 3300005367 Bacteria 2801
90 Ga0070667_100633382 3300005367 Bacteria 987
91 Ga0070714_100005432 3300005435 Bacteria 9725
92 Ga0070701_10017507 3300005438 Bacteria 3350
93 Ga0070701_10153246 3300005438 Bacteria 1329
94 Ga0070711_101085297 3300005439 Bacteria 689
95 Ga0070705_100241204 3300005440 Unclassified 1263
96 Ga0070700_100592238 3300005441 Bacteria 867
97 Ga0070700_102006185 3300005441 Unclassified 502
98 Ga0070678_100701868 3300005456 Bacteria 911
99 Ga0070678_101575835 3300005456 Bacteria 616
100 Ga0070662_100002381 3300005457 Bacteria 11551
101 Ga0070662_100020319 3300005457 Bacteria 4521
102 Ga0070662_100059667 3300005457 Bacteria 2780
103 Ga0070662_100215280 3300005457 Bacteria 1530
104 Ga0070662_100294817 3300005457 Bacteria 1316
105 Ga0070662_100615610 3300005457 Bacteria 914
106 Ga0070681_10000370 3300005458 Bacteria 36255
107 Ga0070681_10397859 3300005458 Bacteria 1289
108 Ga0070681_10471360 3300005458 Bacteria 1168
109 Ga0068867_100006263 3300005459 Bacteria 8416
110 Ga0068867_100124205 3300005459 Bacteria 1998
111 Ga0068867_100147384 3300005459 Bacteria 1846
112 Ga0070685_10016788 3300005466 Bacteria 3906
113 Ga0070698_100035236 3300005471 Bacteria 5177
114 Ga0070699_100163092 3300005518 Bacteria 1973
115 Ga0070679_100052445 3300005530 Bacteria 4062
116 Ga0070679_100453671 3300005530 Bacteria 1227
117 Ga0070684_100007089 3300005535 Bacteria 8711
118 Ga0070684_100131093 3300005535 Bacteria 2261
119 Ga0070684_100137630 3300005535 Bacteria 2207
120 Ga0070684_100262979 3300005535 Bacteria 1578
121 Ga0070684_100282529 3300005535 Bacteria 1521
122 Ga0070684_100310532 3300005535 Bacteria 1448
123 Ga0070684_100661152 3300005535 Bacteria 973
124 Ga0070684_100869630 3300005535 Bacteria 844
125 Ga0068853_100095293 3300005539 Bacteria 2624
126 Ga0068853_100137076 3300005539 Bacteria 2195
127 Ga0068853_100947624 3300005539 Bacteria 828
128 Ga0068853_101385276 3300005539 Bacteria 680
129 Ga0070672_100001374 3300005543 Bacteria 15030
130 Ga0070672_100013452 3300005543 Bacteria 5780
131 Ga0070672_100118730 3300005543 Bacteria 2163
132 Ga0070672_100317120 3300005543 Bacteria 1324
133 Ga0070672_100416384 3300005543 Bacteria 1153
134 Ga0070672_100437884 3300005543 Bacteria 1125
135 Ga0070672_100597547 3300005543 Bacteria 961
136 Ga0070686_100096427 3300005544 Bacteria 1989
137 Ga0070693_100491426 3300005547 Bacteria 869
138 Ga0070665_100270301 3300005548 Bacteria 1701
139 Ga0070665_100980122 3300005548 Unclassified 858
140 Ga0070665_101932858 3300005548 Unclassified 596
141 Ga0068855_100005995 3300005563 Bacteria 14827
142 Ga0068855_100031675 3300005563 Bacteria 6314
143 Ga0068855_102328546 3300005563 Bacteria 536
144 Ga0070664_100010857 3300005564 Bacteria 7385
145 Ga0070664_100079820 3300005564 Bacteria 2817
146 Ga0070664_100143058 3300005564 Bacteria 2107
147 Ga0070664_100172209 3300005564 Bacteria 1921
148 Ga0070664_100279101 3300005564 Bacteria 1506
149 Ga0070664_100619550 3300005564 Bacteria 1004
150 Ga0070664_100769152 3300005564 Bacteria 899
151 Ga0068857_100010410 3300005577 Bacteria 8082
152 Ga0068857_100063293 3300005577 Bacteria 3288
153 Ga0068857_100092624 3300005577 Bacteria 2706
154 Ga0068854_100267575 3300005578 Bacteria 1371
155 Ga0068854_100545135 3300005578 Bacteria 983
156 Ga0068856_100747698 3300005614 Bacteria 998
157 Ga0068856_101180782 3300005614 Bacteria 782
158 Ga0070702_100287080 3300005615 Unclassified 1132
159 Ga0068852_100024062 3300005616 Bacteria 4915
160 Ga0068852_100036239 3300005616 Bacteria 4126
161 Ga0068852_100863841 3300005616 Bacteria 921
162 Ga0068852_100875215 3300005616 Bacteria 915
163 Ga0068852_101278779 3300005616 Bacteria 755
164 Ga0068859_100009419 3300005617 Bacteria 9866
165 Ga0068859_100031183 3300005617 Bacteria 5351
166 Ga0068859_101418490 3300005617 Bacteria 766
167 Ga0068864_100080152 3300005618 Bacteria 2860
168 Ga0068864_100135664 3300005618 Bacteria 2216
169 Ga0068864_100608983 3300005618 Bacteria 1061
170 Ga0068864_100806474 3300005618 Bacteria 923
171 Ga0068864_101164902 3300005618 Bacteria 769
172 Ga0068861_100010045 3300005719 Bacteria 6562
173 Ga0068861_101127514 3300005719 Bacteria 755
174 Ga0068851_10047198 3300005834 Bacteria 2180
175 Ga0068851_10568666 3300005834 Bacteria 687
176 Ga0068870_10469715 3300005840 Bacteria 833
177 Ga0068870_11008550 3300005840 Bacteria 594
178 Ga0068863_100037990 3300005841 Bacteria 4582
179 Ga0068863_100604391 3300005841 Bacteria 1086
180 Ga0068863_101614402 3300005841 Unclassified 658
181 Ga0068858_100230343 3300005842 Bacteria 1756
182 Ga0068858_100293621 3300005842 Bacteria 1550
183 Ga0068858_100297646 3300005842 Bacteria 1539
184 Ga0068858_100307306 3300005842 Bacteria 1514
185 Ga0068860_100091873 3300005843 Bacteria 2892
186 Ga0068860_101130125 3300005843 Unclassified 803
187 Ga0068860_101446236 3300005843 Bacteria 709
188 Ga0068862_100007406 3300005844 Bacteria 9100
189 Ga0068862_100881035 3300005844 Bacteria 879
190 Ga0070715_10417286 3300006163 Bacteria 750
191 Ga0070712_100225976 3300006175 Bacteria 1484
192 Ga0070712_101327540 3300006175 Unclassified 627
193 Ga0068871_100053967 3300006358 Bacteria 3259
194 Ga0068871_101203286 3300006358 Unclassified 711
195 Ga0075428_100033012 3300006844 Bacteria 5716
196 Ga0075428_100137148 3300006844 Bacteria 2660
197 Ga0075428_100321396 3300006844 Bacteria 1663
198 Ga0075428_100701301 3300006844 Unclassified 1078
199 Ga0075430_100011881 3300006846 Bacteria 7412
200 Ga0075430_100106122 3300006846 Bacteria 2344
201 Ga0075430_100495253 3300006846 Bacteria 1008
202 Ga0075431_100037625 3300006847 Bacteria 4983
203 Ga0075431_100045160 3300006847 Bacteria 4543
204 Ga0075431_100054153 3300006847 Bacteria 4137
205 Ga0075431_100379355 3300006847 Bacteria 1418
206 Ga0075431_100412950 3300006847 Unclassified 1350
207 Ga0075431_101770877 3300006847 Unclassified 574
208 Ga0075433_10013413 3300006852 Bacteria 6663
209 Ga0075433_11304787 3300006852 Unclassified 629
210 Ga0075434_100001742 3300006871 Bacteria 18691
211 Ga0075434_100072418 3300006871 Bacteria 3438
212 Ga0075429_100142922 3300006880 Unclassified 2094
213 Ga0075429_100392352 3300006880 Unclassified 1215
214 Ga0075429_100717046 3300006880 Bacteria 876
215 Ga0075429_100729907 3300006880 Bacteria 868
216 Ga0075429_100879522 3300006880 Bacteria 784
217 Ga0068865_100007362 3300006881 Bacteria 6770
218 Ga0068865_100058596 3300006881 Bacteria 2690
219 Ga0097620_100009419 3300006931 Bacteria 9866
220 Ga0097620_100031183 3300006931 Bacteria 5351
221 Ga0097620_101418910 3300006931 Bacteria 766
222 Ga0075435_100209768 3300007076 Bacteria 1652
223 Ga0111539_10038786 3300009094 Bacteria 5746
224 Ga0111539_10146008 3300009094 Bacteria 2770
225 Ga0114129_10018361 3300009147 Bacteria 9961
226 Ga0114129_10100319 3300009147 Bacteria 4006
227 Ga0114129_13321418 3300009147 Unclassified 520
228 Ga0105243_10270860 3300009148 Bacteria 1525
229 Ga0105242_10019096 3300009176 Bacteria 5369
230 Ga0105242_12182869 3300009176 Bacteria 599
231 Ga0105248_10010437 3300009177 Bacteria 10231
232 Ga0105248_10374327 3300009177 Bacteria 1603
233 Ga0105248_11638675 3300009177 Unclassified 729
234 Ga0105248_12323636 3300009177 Bacteria 610
235 Ga0105249_10000576 3300009553 Bacteria 33690
236 Ga0105246_11031252 3300011119 Bacteria 747
237 Ga0157322_1039212 3300012490 Unclassified 538
238 Ga0157373_10012820 3300013100 Bacteria 6156
239 Ga0157373_10071291 3300013100 Bacteria 2454
240 Ga0157371_10265072 3300013102 Bacteria 1239
241 Ga0157371_10809365 3300013102 Bacteria 706
242 Ga0157370_11315718 3300013104 Unclassified 651
243 Ga0157370_11818736 3300013104 Unclassified 547
244 Ga0157369_10068754 3300013105 Bacteria 3805
245 Ga0157369_10114313 3300013105 Bacteria 2867
246 Ga0157369_10301134 3300013105 Bacteria 1668
247 Ga0157369_12141713 3300013105 Archaea 567
248 Ga0157374_10100717 3300013296 Bacteria 2769
249 Ga0157374_11151793 3300013296 Unclassified 796
250 Ga0157374_12140559 3300013296 Bacteria 586
251 Ga0157378_10010044 3300013297 Bacteria 8248
252 Ga0157378_10586703 3300013297 Bacteria 1124
253 Ga0157378_11377275 3300013297 Bacteria 748
254 Ga0157378_11489068 3300013297 Bacteria 721
255 Ga0163162_10013854 3300013306 Bacteria 7875
256 Ga0163162_10210476 3300013306 Bacteria 2074
257 Ga0163162_10671220 3300013306 Bacteria 1159
258 Ga0157372_10009810 3300013307 Bacteria 10185
259 Ga0157372_10028566 3300013307 Bacteria 6087
260 Ga0157372_10033178 3300013307 Bacteria 5668
261 Ga0157372_10033545 3300013307 Bacteria 5639
262 Ga0157372_10298169 3300013307 Bacteria 1875
263 Ga0157372_10404331 3300013307 Bacteria 1591
264 Ga0157372_10651380 3300013307 Bacteria 1227
265 Ga0157372_12876724 3300013307 Unclassified 551
266 Ga0157375_10141240 3300013308 Bacteria 2535
267 Ga0157375_10341162 3300013308 Bacteria 1664
268 Ga0157375_10620967 3300013308 Bacteria 1239
269 Ga0157375_11252021 3300013308 Bacteria 871
270 Ga0163163_10004173 3300014325 Bacteria 12311
271 Ga0163163_12382335 3300014325 Bacteria 588
272 Ga0157380_10006634 3300014326 Bacteria 8164
273 Ga0157380_10264380 3300014326 Bacteria 1564
274 Ga0157380_10279139 3300014326 Bacteria 1527
275 Ga0157379_10514819 3300014968 Bacteria 1110
276 Ga0157379_10909026 3300014968 Bacteria 835
277 Ga0157376_10315915 3300014969 Bacteria 1484
278 Ga0157376_11633934 3300014969 Bacteria 679
279 Ga0182007_10107631 3300015262 Bacteria 926
280 Ga0182007_10198443 3300015262 Bacteria 700
281 Ga0163161_10171585 3300017792 Bacteria 1659
282 Ga0163161_10353811 3300017792 Bacteria 1168
283 Ga0206353_10597265 3300020082 Bacteria 1890
284 Ga0207697_10002027 3300025315 Bacteria 10710
285 Ga0207656_10075706 3300025321 Bacteria 1504
286 Ga0207656_10133342 3300025321 Bacteria 1165
287 Ga0207682_10009052 3300025893 Bacteria 3934
288 Ga0207642_10018207 3300025899 Bacteria 2691
289 Ga0207688_10053248 3300025901 Bacteria 2269
290 Ga0207688_10408835 3300025901 Bacteria 842
291 Ga0207688_10609812 3300025901 Bacteria 688
292 Ga0207647_10016535 3300025904 Bacteria 5032
293 Ga0207647_10305600 3300025904 Bacteria 905
294 Ga0207645_10007146 3300025907 Bacteria 7923
295 Ga0207645_10008124 3300025907 Bacteria 7354
296 Ga0207645_10107952 3300025907 Bacteria 1801
297 Ga0207643_10001593 3300025908 Bacteria 12824
298 Ga0207705_10006562 3300025909 Bacteria 8619
299 Ga0207705_10067628 3300025909 Bacteria 2586
300 Ga0207707_10030528 3300025912 Bacteria 4715
301 Ga0207707_10252345 3300025912 Bacteria 1532
302 Ga0207707_10546226 3300025912 Bacteria 985
303 Ga0207695_10982113 3300025913 Bacteria 724
304 Ga0207693_10221267 3300025915 Bacteria 1487
305 Ga0207663_11326148 3300025916 Bacteria 580
306 Ga0207660_10101530 3300025917 Bacteria 2149
307 Ga0207660_10248944 3300025917 Bacteria 1402
308 Ga0207660_10398170 3300025917 Bacteria 1109
309 Ga0207660_11354001 3300025917 Bacteria 577
310 Ga0207662_10005528 3300025918 Bacteria 6749
311 Ga0207662_10008224 3300025918 Bacteria 5707
312 Ga0207662_10322093 3300025918 Bacteria 1032
313 Ga0207657_10002102 3300025919 Bacteria 21546
314 Ga0207657_10023864 3300025919 Bacteria 5682
315 Ga0207657_10082546 3300025919 Bacteria 2697
316 Ga0207657_10289526 3300025919 Bacteria 1299
317 Ga0207657_11186814 3300025919 Bacteria 581
318 Ga0207649_10002564 3300025920 Bacteria 10105
319 Ga0207649_10021049 3300025920 Bacteria 3748
320 Ga0207649_10027370 3300025920 Bacteria 3345
321 Ga0207649_10038353 3300025920 Bacteria 2900
322 Ga0207649_10082539 3300025920 Bacteria 2084
323 Ga0207649_10147472 3300025920 Bacteria 1616
324 Ga0207649_10286466 3300025920 Unclassified 1200
325 Ga0207652_10008415 3300025921 Bacteria 8303
326 Ga0207652_10353886 3300025921 Bacteria 1325
327 Ga0207652_10377265 3300025921 Bacteria 1280
328 Ga0207681_10003037 3300025923 Bacteria 10552
329 Ga0207681_10051617 3300025923 Bacteria 2786
330 Ga0207681_10238546 3300025923 Bacteria 1414
331 Ga0207650_10027763 3300025925 Bacteria 4054
332 Ga0207650_11488300 3300025925 Bacteria 575
333 Ga0207659_10002217 3300025926 Bacteria 11564
334 Ga0207659_10009347 3300025926 Bacteria 6122
335 Ga0207659_10142619 3300025926 Bacteria 1861
336 Ga0207700_10767629 3300025928 Bacteria 862
337 Ga0207664_10679312 3300025929 Bacteria 926
338 Ga0207644_10138114 3300025931 Bacteria 1874
339 Ga0207644_10253632 3300025931 Bacteria 1404
340 Ga0207644_10486535 3300025931 Bacteria 1017
341 Ga0207644_10618549 3300025931 Bacteria 900
342 Ga0207644_10880444 3300025931 Bacteria 750
343 Ga0207690_10003913 3300025932 Bacteria 8803
344 Ga0207690_10013048 3300025932 Bacteria 4984
345 Ga0207690_10076725 3300025932 Bacteria 2321
346 Ga0207690_10160912 3300025932 Bacteria 1673
347 Ga0207690_10177771 3300025932 Bacteria 1600
348 Ga0207690_10261961 3300025932 Bacteria 1340
349 Ga0207690_10489424 3300025932 Bacteria 994
350 Ga0207690_10695567 3300025932 Bacteria 836
351 Ga0207706_10000478 3300025933 Bacteria 42804
352 Ga0207706_10054211 3300025933 Bacteria 3539
353 Ga0207706_10132441 3300025933 Bacteria 2193
354 Ga0207706_10170080 3300025933 Bacteria 1915
355 Ga0207706_10888001 3300025933 Bacteria 753
356 Ga0207686_10066375 3300025934 Bacteria 2304
357 Ga0207686_10376699 3300025934 Bacteria 1075
358 Ga0207709_10185429 3300025935 Bacteria 1473
359 Ga0207709_10710033 3300025935 Unclassified 805
360 Ga0207670_10172128 3300025936 Bacteria 1624
361 Ga0207669_10015809 3300025937 Bacteria 3817
362 Ga0207669_10031081 3300025937 Bacteria 2978
363 Ga0207669_10047776 3300025937 Bacteria 2538
364 Ga0207669_10056959 3300025937 Unclassified 2377
365 Ga0207669_10130488 3300025937 Bacteria 1726
366 Ga0207669_10596627 3300025937 Bacteria 897
367 Ga0207704_10005402 3300025938 Bacteria 5890
368 Ga0207704_10130812 3300025938 Bacteria 1737
369 Ga0207691_10000259 3300025940 Bacteria 52644
370 Ga0207691_10014187 3300025940 Bacteria 7603
371 Ga0207691_10078090 3300025940 Bacteria 2980
372 Ga0207691_10095193 3300025940 Bacteria 2664
373 Ga0207691_10135780 3300025940 Bacteria 2169
374 Ga0207691_10144928 3300025940 Bacteria 2091
375 Ga0207691_11138294 3300025940 Bacteria 648
376 Ga0207711_11125519 3300025941 Bacteria 726
377 Ga0207689_10004032 3300025942 Bacteria 13349
378 Ga0207661_10026484 3300025944 Bacteria 4419
379 Ga0207661_10034047 3300025944 Bacteria 3959
380 Ga0207661_10059403 3300025944 Bacteria 3081
381 Ga0207661_10230084 3300025944 Bacteria 1641
382 Ga0207661_10838753 3300025944 Bacteria 846
383 Ga0207679_10004404 3300025945 Bacteria 8769
384 Ga0207679_10026030 3300025945 Bacteria 4030
385 Ga0207679_10032053 3300025945 Bacteria 3685
386 Ga0207679_10045900 3300025945 Bacteria 3163
387 Ga0207679_10097118 3300025945 Bacteria 2294
388 Ga0207679_10153124 3300025945 Bacteria 1879
389 Ga0207667_10010833 3300025949 Bacteria 10634
390 Ga0207667_10234734 3300025949 Bacteria 1877
391 Ga0207667_12012990 3300025949 Unclassified 538
392 Ga0207651_10218033 3300025960 Bacteria 1540
393 Ga0207651_10371165 3300025960 Unclassified 1210
394 Ga0207651_10604129 3300025960 Bacteria 959
395 Ga0207651_11490061 3300025960 Bacteria 609
396 Ga0207712_10006076 3300025961 Bacteria 7623
397 Ga0207712_11708265 3300025961 Bacteria 564
398 Ga0207668_10005645 3300025972 Bacteria 7368
399 Ga0207668_10681453 3300025972 Unclassified 902
400 Ga0207640_10266227 3300025981 Bacteria 1338
401 Ga0207658_10111544 3300025986 Bacteria 2163
402 Ga0207658_10437117 3300025986 Bacteria 1156
403 Ga0207677_10307552 3300026023 Bacteria 1312
404 Ga0207677_10433225 3300026023 Bacteria 1123
405 Ga0207703_10238951 3300026035 Bacteria 1632
406 Ga0207703_10353727 3300026035 Bacteria 1353
407 Ga0207703_10365959 3300026035 Bacteria 1331
408 Ga0207639_10203860 3300026041 Bacteria 1698
409 Ga0207639_10706541 3300026041 Bacteria 936
410 Ga0207639_11247563 3300026041 Bacteria 698
411 Ga0207639_11250805 3300026041 Unclassified 697
412 Ga0207678_10271923 3300026067 Bacteria 1453
413 Ga0207678_10546734 3300026067 Unclassified 1012
414 Ga0207678_10569757 3300026067 Bacteria 991
415 Ga0207702_11141033 3300026078 Bacteria 773
416 Ga0207702_11497787 3300026078 Bacteria 668
417 Ga0207641_10094330 3300026088 Bacteria 2624
418 Ga0207641_10100654 3300026088 Bacteria 2546
419 Ga0207641_10457819 3300026088 Bacteria 1234
420 Ga0207648_10006464 3300026089 Bacteria 11641
421 Ga0207648_10013039 3300026089 Bacteria 7752
422 Ga0207648_10326987 3300026089 Bacteria 1379
423 Ga0207676_10014032 3300026095 Bacteria 5754
424 Ga0207676_10060726 3300026095 Bacteria 2991
425 Ga0207676_10089016 3300026095 Bacteria 2529
426 Ga0207676_10526430 3300026095 Bacteria 1126
427 Ga0207676_10674822 3300026095 Bacteria 999
428 Ga0207676_10981309 3300026095 Bacteria 832
429 Ga0207674_10003188 3300026116 Bacteria 20190
430 Ga0207674_10005695 3300026116 Bacteria 14776
431 Ga0207674_10006061 3300026116 Bacteria 14300
432 Ga0207674_10006575 3300026116 Bacteria 13663
433 Ga0207675_100000044 3300026118 Bacteria 88380
434 Ga0207675_100382410 3300026118 Bacteria 1384
435 Ga0207683_10096303 3300026121 Bacteria 2639
436 Ga0207683_10352649 3300026121 Bacteria 1350
437 Ga0207698_10040869 3300026142 Bacteria 3451
438 Ga0207698_10174776 3300026142 Bacteria 1895
439 Ga0207698_10331137 3300026142 Bacteria 1430
440 Ga0207698_11039920 3300026142 Bacteria 830
441 Ga0207428_10127142 3300027907 Bacteria 1952
442 Ga0207428_10212184 3300027907 Bacteria 1454
443 Ga0268266_10097815 3300028379 Bacteria 2582
444 Ga0268266_10351556 3300028379 Bacteria 1385
445 Ga0268265_10010210 3300028380 Bacteria 6339
446 Ga0268264_10021926 3300028381 Bacteria 5213
447 Ga0268264_10205053 3300028381 Bacteria 1806
448 Ga0268264_10364090 3300028381 Bacteria 1380
449 Ga0265332_10003244 3300031238 Bacteria 7905
450 Ga0265327_10027777 3300031251 Bacteria 3250
451 Ga0265316_10483385 3300031344 Bacteria 886
452 Ga0307408_100004891 3300031548 Bacteria 9022
453 Ga0307408_100250541 3300031548 Bacteria 1460
454 Ga0307408_100809808 3300031548 Bacteria 851
455 Ga0307408_101654989 3300031548 Unclassified 609
456 Ga0265314_10004259 3300031711 Bacteria 13398
457 Ga0307405_10005186 3300031731 Bacteria 6253
458 Ga0307405_10006166 3300031731 Bacteria 5874
459 Ga0307413_10001080 3300031824 Bacteria 9953
460 Ga0307413_10073518 3300031824 Bacteria 2161
461 Ga0307413_11282414 3300031824 Bacteria 640
462 Ga0307410_10034938 3300031852 Bacteria 3260
463 Ga0307410_10053182 3300031852 Bacteria 2739
464 Ga0307410_10085218 3300031852 Bacteria 2229
465 Ga0307410_10112229 3300031852 Bacteria 1974
466 Ga0307410_10319678 3300031852 Bacteria 1231
467 Ga0307410_10976105 3300031852 Unclassified 729
468 Ga0307406_10001581 3300031901 Bacteria 12542
469 Ga0307406_10025745 3300031901 Bacteria 3524
470 Ga0307406_10092431 3300031901 Bacteria 2040
471 Ga0307406_10219373 3300031901 Bacteria 1412
472 Ga0307406_10888342 3300031901 Bacteria 758
473 Ga0307406_11140748 3300031901 Bacteria 675
474 Ga0307406_11565942 3300031901 Bacteria 581
475 Ga0307407_10050828 3300031903 Bacteria 2373
476 Ga0307407_10577007 3300031903 Bacteria 834
477 Ga0307407_10649706 3300031903 Bacteria 790
478 Ga0307407_10927377 3300031903 Bacteria 669
479 Ga0307407_11515539 3300031903 Unclassified 530
480 Ga0307412_10018447 3300031911 Bacteria 4198
481 Ga0307412_10135264 3300031911 Bacteria 1797
482 Ga0307412_10191087 3300031911 Bacteria 1548
483 Ga0307412_10318722 3300031911 Bacteria 1236
484 Ga0307409_100037638 3300031995 Bacteria 3568
485 Ga0307409_100092361 3300031995 Bacteria 2483
486 Ga0307409_100168978 3300031995 Bacteria 1922
487 Ga0307409_100292505 3300031995 Bacteria 1511
488 Ga0307409_100543971 3300031995 Bacteria 1139
489 Ga0307409_100726740 3300031995 Unclassified 995
490 Ga0307416_100054244 3300032002 Bacteria 3221
491 Ga0307416_100375219 3300032002 Bacteria 1450
492 Ga0307416_100428516 3300032002 Bacteria 1369
493 Ga0307416_100527164 3300032002 Bacteria 1251
494 Ga0307416_101047846 3300032002 Bacteria 919
495 Ga0307416_103470014 3300032002 Bacteria 527
496 Ga0307414_10037315 3300032004 Bacteria 3252
497 Ga0307414_10052915 3300032004 Bacteria 2829
498 Ga0307414_10179497 3300032004 Bacteria 1701
499 Ga0307414_10795048 3300032004 Bacteria 862
500 Ga0307414_12199504 3300032004 Bacteria 515
501 Ga0307411_10177839 3300032005 Unclassified 1612
502 Ga0307411_10203521 3300032005 Bacteria 1522
503 Ga0307411_10439339 3300032005 Bacteria 1088
504 Ga0307411_10683559 3300032005 Bacteria 892
505 Ga0307415_100002233 3300032126 Bacteria 9580
506 Ga0307415_100032410 3300032126 Bacteria 3378
507 Ga0307415_100051378 3300032126 Bacteria 2797
508 Ga0307415_100057278 3300032126 Bacteria 2677
509 Ga0307415_100263269 3300032126 Unclassified 1408
510 Ga0307415_100350544 3300032126 Bacteria 1242
511 Ga0307415_100542425 3300032126 Bacteria 1025
512 Ga0307415_100682899 3300032126 Bacteria 924
513 Ga0373930_0145588 3300034816 Bacteria 591
514 Ga0373936_0556425 3300035113 Bacteria 536
515 Ga0373955_0672112 3300035172 Bacteria 635
516 Ga0373927_0157610 3300035695 Bacteria 1487
517 Ga0395900_0729064 3300037418 Bacteria 923
518 Ga0395905_0645692 3300037471 Bacteria 960
519 Ga0439448_0191923 3300042005 Unclassified 715
520 Ga0439435_0218148 3300042436 Bacteria 634
521 Ga0439444_0085647 3300042437 Bacteria 696
522 Ga0451577_0000001 3300042876 Bacteria 2461803
523 Ga0451576_0366006 3300045051 Bacteria 1510
524 Ga0495629_0124238 3300046459 Bacteria 1798
525 Ga0495582_0018459 3300046473 Bacteria 3814
526 Ga0495662_0084413 3300046476 Bacteria 1546
527 Ga0495594_0442864 3300046499 Unclassified 739
528 Ga0495665_0390570 3300046531 Bacteria 706
529 Ga0495598_0159333 3300046537 Bacteria 793
530 Ga0495621_0218392 3300046539 Unclassified 771
531 Ga0495659_0127002 3300046664 Unclassified 1009
532 Ga0495657_0044989 3300046675 Bacteria 2998
533 Ga0495623_0169858 3300046679 Bacteria 1275
534 Ga0495669_0113689 3300046684 Bacteria 1265
535 Ga0495669_0368464 3300046684 Unclassified 695
536 Ga0495613_0142174 3300046689 Bacteria 1714
537 Ga0495613_0900609 3300046689 Unclassified 572
538 Ga0495600_0221446 3300046809 Bacteria 1210
539 Ga0495581_0052712 3300047315 Bacteria 2350
540 Ga0495675_0092720 3300047444 Bacteria 1895
541 Ga0495675_0263956 3300047444 Bacteria 1031
542 Ga0495675_0274331 3300047444 Bacteria 1007
543 Ga0495677_0260652 3300047445 Bacteria 679
544 Ga0495677_0383004 3300047445 Unclassified 556
545 Ga0495685_049548 3300047447 Bacteria 1426
546 Ga0496100_0045732 3300048903 Bacteria 2811
547 Ga0496101_0041931 3300048904 Bacteria 3266
548 Ga0496101_0401858 3300048904 Bacteria 1079
549 Ga0496104_0103093 3300048907 Bacteria 2733
550 Ga0496104_1866594 3300048907 Unclassified 503
551 Ga0496105_0174354 3300048908 Bacteria 1762
552 Ga0496106_0360711 3300048909 Bacteria 1167
553 Ga0496108_0049416 3300048911 Bacteria 3518
554 Ga0496108_0056936 3300048911 Bacteria 3285
555 Ga0496108_0274277 3300048911 Bacteria 1468
556 Ga0496109_0878818 3300048912 Bacteria 834
557 Ga0496110_0246758 3300048913 Bacteria 1625
558 Ga0496110_0700940 3300048913 Bacteria 914
559 Ga0496111_0881322 3300048914 Unclassified 645
560 Ga0496112_0099680 3300048915 Bacteria 2875
561 Ga0496113_0033692 3300048916 Bacteria 3732
562 Ga0496113_0327691 3300048916 Bacteria 1228
563 Ga0496114_1092625 3300048917 Bacteria 682
564 Ga0501299_103586 3300049522 Unclassified 664
565 Ga0501032_0157764 3300049569 Bacteria 1490
566 Ga0501034_0439791 3300049571 Bacteria 1223
567 Ga0501038_0059525 3300049574 Bacteria 3272
568 Ga0501043_0133370 3300049579 Bacteria 1946
569 Ga0501047_0237880 3300049581 Bacteria 1672
570 Ga0501067_0051521 3300049583 Bacteria 2282
571 Ga0501067_0834781 3300049583 Bacteria 519
572 Ga0501070_0015757 3300049586 Bacteria 6357
573 Ga0501207_051599 3300049654 Bacteria 736
574 Ga0501080_0568596 3300049742 Unclassified 1009
575 Ga0501268_070402 3300049765 Bacteria 707
576 Ga0501270_143334 3300049767 Unclassified 539
577 Ga0501035_0016786 3300049822 Bacteria 6750
578 Ga0501044_0213054 3300049823 Bacteria 1885
579 nmdc:mga05p37_22428_c1 3300050507 Bacteria 7657
580 nmdc:mga05p37_41311_c1 3300050507 Bacteria 5662
581 nmdc:mga09592_235843_c1 3300050508 Unclassified 1585
582 nmdc:mga09592_463859_c1 3300050508 Unclassified 605
583 nmdc:mga09592_74374_c1 3300050508 Bacteria 2887
584 nmdc:mga09592_887086_c1 3300050508 Bacteria 750
585 nmdc:mga0qj67_11553_c1 3300050509 Bacteria 6620
586 nmdc:mga0qj67_157685_c1 3300050509 Bacteria 1842
587 nmdc:mga0qj67_22559_c1 3300050509 Bacteria 4836
588 nmdc:mga0qj67_31430_c1 3300050509 Bacteria 4135
589 nmdc:mga0qj67_52141_c1 3300050509 Bacteria 3237
590 nmdc:mga06r32_1468962_c1 3300050510 Bacteria 622
591 nmdc:mga06r32_1927923_c1 3300050510 Unclassified 525
592 nmdc:mga06r32_23096_c1 3300050510 Bacteria 5754
593 nmdc:mga06r32_26666_c1 3300050510 Bacteria 5390
594 nmdc:mga06r32_45437_c1 3300050510 Bacteria 4186
595 nmdc:mga06r32_838325_c1 3300050510 Unclassified 878
596 nmdc:mga06r32_87155_c1 3300050510 Bacteria 3046
597 nmdc:mga08y16_133500_c1 3300050511 Bacteria 2580
598 nmdc:mga08y16_375913_c1 3300050511 Bacteria 1457
599 nmdc:mga08y16_387609_c1 3300050511 Bacteria 1432
600 nmdc:mga0rr50_620867_c1 3300050513 Bacteria 922
601 nmdc:mga0a205_9691_c1 3300050515 Bacteria 8820
602 Ga0590071_016058 3300059421 Bacteria 1755
603 Ga0501080_0245520
604 Ga0065704_10425993
605 Ga0065715_10107941
606 Ga0065707_10098289
607 Ga0070658_10001473
608 Ga0070658_10018352
609 Ga0070658_10037752
610 Ga0070658_10086949
611 Ga0070658_10102079
612 Ga0070658_10251119
613 Ga0070676_10043123
614 Ga0070676_10080142
615 Ga0070676_10170404
616 Ga0070676_10729817
617 Ga0070683_100001659
618 Ga0070683_100078115
619 Ga0070683_100091053
620 Ga0070683_100098917
621 Ga0070690_100052882
622 Ga0070670_100147064
623 Ga0070670_100299606
624 Ga0070670_100616848
625 Ga0070670_100745117
626 Ga0070670_100836906
627 Ga0070677_10108176
628 Ga0068869_100037218
629 Ga0068869_100681904
630 Ga0070666_10272449
631 Ga0070666_10427264
632 Ga0070680_100069444
633 Ga0070680_100247631
634 Ga0070680_100352969
635 Ga0070680_100974934
636 Ga0070680_101701124
637 Ga0070682_100225283
638 Ga0068868_100013320
639 Ga0068868_100542428
640 Ga0068868_100766653
641 Ga0070660_100027454
642 Ga0070660_100282401
643 Ga0070660_100415861
644 Ga0070660_101238616
645 Ga0070689_100009822
646 Ga0070689_100013450
647 Ga0070687_100000802
648 Ga0070687_100158632
649 Ga0070661_100030223
650 Ga0070661_100082144
651 Ga0070661_100084197
652 Ga0070661_100097337
653 Ga0070661_100247100
654 Ga0070692_10003001
655 Ga0070692_10395699
656 Ga0070692_10699691
657 Ga0070668_100007377
658 Ga0070668_100018175
659 Ga0070668_100036663
660 Ga0070668_101122493
661 Ga0070669_100001372
662 Ga0070669_100007096
663 Ga0070669_100017943
664 Ga0070669_100053223
665 Ga0070669_101176192
666 Ga0070675_100002568
667 Ga0070675_100073756
668 Ga0070675_100078342
669 Ga0070675_100097432
670 Ga0070675_100487310
671 Ga0070671_100017231
672 Ga0070671_100062920
673 Ga0070671_100555896
674 Ga0070671_100719399
675 Ga0070671_100996695
676 Ga0070674_100438197
677 Ga0070674_100783788
678 Ga0070674_100846117
679 Ga0070673_100228901
680 Ga0070673_100253476
681 Ga0070673_100366619
682 Ga0070688_100041983
683 Ga0070688_100446351
684 Ga0070688_100571617
685 Ga0070659_100019307
686 Ga0070659_100031600
687 Ga0070659_100215422
688 Ga0070659_100241581
689 Ga0070659_100504340
690 Ga0070667_100038557
691 Ga0070667_100079612
692 Ga0070667_100633382
693 Ga0070714_100005432
694 Ga0070701_10017507
695 Ga0070701_10153246
696 Ga0070711_101085297
697 Ga0070705_100241204
698 Ga0070700_100592238
699 Ga0070700_102006185
700 Ga0070678_100701868
701 Ga0070678_101575835
702 Ga0070662_100002381
703 Ga0070662_100020319
704 Ga0070662_100059667
705 Ga0070662_100215280
706 Ga0070662_100294817
707 Ga0070662_100615610
708 Ga0070681_10000370
709 Ga0070681_10397859
710 Ga0070681_10471360
711 Ga0068867_100006263
712 Ga0068867_100124205
713 Ga0068867_100147384
714 Ga0070685_10016788
715 Ga0070698_100035236
716 Ga0070699_100163092
717 Ga0070679_100052445
718 Ga0070679_100453671
719 Ga0070684_100007089
720 Ga0070684_100131093
721 Ga0070684_100137630
722 Ga0070684_100262979
723 Ga0070684_100282529
724 Ga0070684_100310532
725 Ga0070684_100661152
726 Ga0070684_100869630
727 Ga0068853_100095293
728 Ga0068853_100137076
729 Ga0068853_100947624
730 Ga0068853_101385276
731 Ga0070672_100001374
732 Ga0070672_100013452
733 Ga0070672_100118730
734 Ga0070672_100317120
735 Ga0070672_100416384
736 Ga0070672_100437884
737 Ga0070672_100597547
738 Ga0070686_100096427
739 Ga0070693_100491426
740 Ga0070665_100270301
741 Ga0070665_100980122
742 Ga0070665_101932858
743 Ga0068855_100005995
744 Ga0068855_100031675
745 Ga0068855_102328546
746 Ga0070664_100010857
747 Ga0070664_100079820
748 Ga0070664_100143058
749 Ga0070664_100172209
750 Ga0070664_100279101
751 Ga0070664_100619550
752 Ga0070664_100769152
753 Ga0068857_100010410
754 Ga0068857_100063293
755 Ga0068857_100092624
756 Ga0068854_100267575
757 Ga0068854_100545135
758 Ga0068856_100747698
759 Ga0068856_101180782
760 Ga0070702_100287080
761 Ga0068852_100024062
762 Ga0068852_100036239
763 Ga0068852_100863841
764 Ga0068852_100875215
765 Ga0068852_101278779
766 Ga0068859_100009419
767 Ga0068859_100031183
768 Ga0068859_101418490
769 Ga0068864_100080152
770 Ga0068864_100135664
771 Ga0068864_100608983
772 Ga0068864_100806474
773 Ga0068864_101164902
774 Ga0068861_100010045
775 Ga0068861_101127514
776 Ga0068851_10047198
777 Ga0068851_10568666
778 Ga0068870_10469715
779 Ga0068870_11008550
780 Ga0068863_100037990
781 Ga0068863_100604391
782 Ga0068863_101614402
783 Ga0068858_100230343
784 Ga0068858_100293621
785 Ga0068858_100297646
786 Ga0068858_100307306
787 Ga0068860_100091873
788 Ga0068860_101130125
789 Ga0068860_101446236
790 Ga0068862_100007406
791 Ga0068862_100881035
792 Ga0070715_10417286
793 Ga0070712_100225976
794 Ga0070712_101327540
795 Ga0068871_100053967
796 Ga0068871_101203286
797 Ga0075428_100033012
798 Ga0075428_100137148
799 Ga0075428_100321396
800 Ga0075428_100701301
801 Ga0075430_100011881
802 Ga0075430_100106122
803 Ga0075430_100495253
804 Ga0075431_100037625
805 Ga0075431_100045160
806 Ga0075431_100054153
807 Ga0075431_100379355
808 Ga0075431_100412950
809 Ga0075431_101770877
810 Ga0075433_10013413
811 Ga0075433_11304787
812 Ga0075434_100001742
813 Ga0075434_100072418
814 Ga0075429_100142922
815 Ga0075429_100392352
816 Ga0075429_100717046
817 Ga0075429_100729907
818 Ga0075429_100879522
819 Ga0068865_100007362
820 Ga0068865_100058596
821 Ga0097620_100009419
822 Ga0097620_100031183
823 Ga0097620_101418910
824 Ga0075435_100209768
825 Ga0111539_10038786
826 Ga0111539_10146008
827 Ga0114129_10018361
828 Ga0114129_10100319
829 Ga0114129_13321418
830 Ga0105243_10270860
831 Ga0105242_10019096
832 Ga0105242_12182869
833 Ga0105248_10010437
834 Ga0105248_10374327
835 Ga0105248_11638675
836 Ga0105248_12323636
837 Ga0105249_10000576
838 Ga0105246_11031252
839 Ga0157322_1039212
840 Ga0157373_10012820
841 Ga0157373_10071291
842 Ga0157371_10265072
843 Ga0157371_10809365
844 Ga0157370_11315718
845 Ga0157370_11818736
846 Ga0157369_10068754
847 Ga0157369_10114313
848 Ga0157369_10301134
849 Ga0157369_12141713
850 Ga0157374_10100717
851 Ga0157374_11151793
852 Ga0157374_12140559
853 Ga0157378_10010044
854 Ga0157378_10586703
855 Ga0157378_11377275
856 Ga0157378_11489068
857 Ga0163162_10013854
858 Ga0163162_10210476
859 Ga0163162_10671220
860 Ga0157372_10009810
861 Ga0157372_10028566
862 Ga0157372_10033178
863 Ga0157372_10033545
864 Ga0157372_10298169
865 Ga0157372_10404331
866 Ga0157372_10651380
867 Ga0157372_12876724
868 Ga0157375_10141240
869 Ga0157375_10341162
870 Ga0157375_10620967
871 Ga0157375_11252021
872 Ga0163163_10004173
873 Ga0163163_12382335
874 Ga0157380_10006634
875 Ga0157380_10264380
876 Ga0157380_10279139
877 Ga0157379_10514819
878 Ga0157379_10909026
879 Ga0157376_10315915
880 Ga0157376_11633934
881 Ga0182007_10107631
882 Ga0182007_10198443
883 Ga0163161_10171585
884 Ga0163161_10353811
885 Ga0206353_10597265
886 Ga0207697_10002027
887 Ga0207656_10075706
888 Ga0207656_10133342
889 Ga0207682_10009052
890 Ga0207642_10018207
891 Ga0207688_10053248
892 Ga0207688_10408835
893 Ga0207688_10609812
894 Ga0207647_10016535
895 Ga0207647_10305600
896 Ga0207645_10007146
897 Ga0207645_10008124
898 Ga0207645_10107952
899 Ga0207643_10001593
900 Ga0207705_10006562
901 Ga0207705_10067628
902 Ga0207707_10030528
903 Ga0207707_10252345
904 Ga0207707_10546226
905 Ga0207695_10982113
906 Ga0207693_10221267
907 Ga0207663_11326148
908 Ga0207660_10101530
909 Ga0207660_10248944
910 Ga0207660_10398170
911 Ga0207660_11354001
912 Ga0207662_10005528
913 Ga0207662_10008224
914 Ga0207662_10322093
915 Ga0207657_10002102
916 Ga0207657_10023864
917 Ga0207657_10082546
918 Ga0207657_10289526
919 Ga0207657_11186814
920 Ga0207649_10002564
921 Ga0207649_10021049
922 Ga0207649_10027370
923 Ga0207649_10038353
924 Ga0207649_10082539
925 Ga0207649_10147472
926 Ga0207649_10286466
927 Ga0207652_10008415
928 Ga0207652_10353886
929 Ga0207652_10377265
930 Ga0207681_10003037
931 Ga0207681_10051617
932 Ga0207681_10238546
933 Ga0207650_10027763
934 Ga0207650_11488300
935 Ga0207659_10002217
936 Ga0207659_10009347
937 Ga0207659_10142619
938 Ga0207700_10767629
939 Ga0207664_10679312
940 Ga0207644_10138114
941 Ga0207644_10253632
942 Ga0207644_10486535
943 Ga0207644_10618549
944 Ga0207644_10880444
945 Ga0207690_10003913
946 Ga0207690_10013048
947 Ga0207690_10076725
948 Ga0207690_10160912
949 Ga0207690_10177771
950 Ga0207690_10261961
951 Ga0207690_10489424
952 Ga0207690_10695567
953 Ga0207706_10000478
954 Ga0207706_10054211
955 Ga0207706_10132441
956 Ga0207706_10170080
957 Ga0207706_10888001
958 Ga0207686_10066375
959 Ga0207686_10376699
960 Ga0207709_10185429
961 Ga0207709_10710033
962 Ga0207670_10172128
963 Ga0207669_10015809
964 Ga0207669_10031081
965 Ga0207669_10047776
966 Ga0207669_10056959
967 Ga0207669_10130488
968 Ga0207669_10596627
969 Ga0207704_10005402
970 Ga0207704_10130812
971 Ga0207691_10000259
972 Ga0207691_10014187
973 Ga0207691_10078090
974 Ga0207691_10095193
975 Ga0207691_10135780
976 Ga0207691_10144928
977 Ga0207691_11138294
978 Ga0207711_11125519
979 Ga0207689_10004032
980 Ga0207661_10026484
981 Ga0207661_10034047
982 Ga0207661_10059403
983 Ga0207661_10230084
984 Ga0207661_10838753
985 Ga0207679_10004404
986 Ga0207679_10026030
987 Ga0207679_10032053
988 Ga0207679_10045900
989 Ga0207679_10097118
990 Ga0207679_10153124
991 Ga0207667_10010833
992 Ga0207667_10234734
993 Ga0207667_12012990
994 Ga0207651_10218033
995 Ga0207651_10371165
996 Ga0207651_10604129
997 Ga0207651_11490061
998 Ga0207712_10006076
999 Ga0207712_11708265
1000 Ga0207668_10005645
1001 Ga0207668_10681453
1002 Ga0207640_10266227
1003 Ga0207658_10111544
1004 Ga0207658_10437117
1005 Ga0207677_10307552
1006 Ga0207677_10433225
1007 Ga0207703_10238951
1008 Ga0207703_10353727
1009 Ga0207703_10365959
1010 Ga0207639_10203860
1011 Ga0207639_10706541
1012 Ga0207639_11247563
1013 Ga0207639_11250805
1014 Ga0207678_10271923
1015 Ga0207678_10546734
1016 Ga0207678_10569757
1017 Ga0207702_11141033
1018 Ga0207702_11497787
1019 Ga0207641_10094330
1020 Ga0207641_10100654
1021 Ga0207641_10457819
1022 Ga0207648_10006464
1023 Ga0207648_10013039
1024 Ga0207648_10326987
1025 Ga0207676_10014032
1026 Ga0207676_10060726
1027 Ga0207676_10089016
1028 Ga0207676_10526430
1029 Ga0207676_10674822
1030 Ga0207676_10981309
1031 Ga0207674_10003188
1032 Ga0207674_10005695
1033 Ga0207674_10006061
1034 Ga0207674_10006575
1035 Ga0207675_100000044
1036 Ga0207675_100382410
1037 Ga0207683_10096303
1038 Ga0207683_10352649
1039 Ga0207698_10040869
1040 Ga0207698_10174776
1041 Ga0207698_10331137
1042 Ga0207698_11039920
1043 Ga0207428_10127142
1044 Ga0207428_10212184
1045 Ga0268266_10097815
1046 Ga0268266_10351556
1047 Ga0268265_10010210
1048 Ga0268264_10021926
1049 Ga0268264_10205053
1050 Ga0268264_10364090
1051 Ga0265332_10003244
1052 Ga0265327_10027777
1053 Ga0265316_10483385
1054 Ga0307408_100004891
1055 Ga0307408_100250541
1056 Ga0307408_100809808
1057 Ga0307408_101654989
1058 Ga0265314_10004259
1059 Ga0307405_10005186
1060 Ga0307405_10006166
1061 Ga0307413_10001080
1062 Ga0307413_10073518
1063 Ga0307413_11282414
1064 Ga0307410_10034938
1065 Ga0307410_10053182
1066 Ga0307410_10085218
1067 Ga0307410_10112229
1068 Ga0307410_10319678
1069 Ga0307410_10976105
1070 Ga0307406_10001581
1071 Ga0307406_10025745
1072 Ga0307406_10092431
1073 Ga0307406_10219373
1074 Ga0307406_10888342
1075 Ga0307406_11140748
1076 Ga0307406_11565942
1077 Ga0307407_10050828
1078 Ga0307407_10577007
1079 Ga0307407_10649706
1080 Ga0307407_10927377
1081 Ga0307407_11515539
1082 Ga0307412_10018447
1083 Ga0307412_10135264
1084 Ga0307412_10191087
1085 Ga0307412_10318722
1086 Ga0307409_100037638
1087 Ga0307409_100092361
1088 Ga0307409_100168978
1089 Ga0307409_100292505
1090 Ga0307409_100543971
1091 Ga0307409_100726740
1092 Ga0307416_100054244
1093 Ga0307416_100375219
1094 Ga0307416_100428516
1095 Ga0307416_100527164
1096 Ga0307416_101047846
1097 Ga0307416_103470014
1098 Ga0307414_10037315
1099 Ga0307414_10052915
1100 Ga0307414_10179497
1101 Ga0307414_10795048
1102 Ga0307414_12199504
1103 Ga0307411_10177839
1104 Ga0307411_10203521
1105 Ga0307411_10439339
1106 Ga0307411_10683559
1107 Ga0307415_100002233
1108 Ga0307415_100032410
1109 Ga0307415_100051378
1110 Ga0307415_100057278
1111 Ga0307415_100263269
1112 Ga0307415_100350544
1113 Ga0307415_100542425
1114 Ga0307415_100682899
1115 Ga0373930_0145588
1116 Ga0373936_0556425
1117 Ga0373955_0672112
1118 Ga0373927_0157610
1119 Ga0395900_0729064
1120 Ga0395905_0645692
1121 Ga0439448_0191923
1122 Ga0439435_0218148
1123 Ga0439444_0085647
1124 Ga0451577_0000001
1125 Ga0451576_0366006
1126 Ga0495629_0124238
1127 Ga0495582_0018459
1128 Ga0495662_0084413
1129 Ga0495594_0442864
1130 Ga0495665_0390570
1131 Ga0495598_0159333
1132 Ga0495621_0218392
1133 Ga0495659_0127002
1134 Ga0495657_0044989
1135 Ga0495623_0169858
1136 Ga0495669_0113689
1137 Ga0495669_0368464
1138 Ga0495613_0142174
1139 Ga0495613_0900609
1140 Ga0495600_0221446
1141 Ga0495581_0052712
1142 Ga0495675_0092720
1143 Ga0495675_0263956
1144 Ga0495675_0274331
1145 Ga0495677_0260652
1146 Ga0495677_0383004
1147 Ga0495685_049548
1148 Ga0496100_0045732
1149 Ga0496101_0041931
1150 Ga0496101_0401858
1151 Ga0496104_0103093
1152 Ga0496104_1866594
1153 Ga0496105_0174354
1154 Ga0496106_0360711
1155 Ga0496108_0049416
1156 Ga0496108_0056936
1157 Ga0496108_0274277
1158 Ga0496109_0878818
1159 Ga0496110_0246758
1160 Ga0496110_0700940
1161 Ga0496111_0881322
1162 Ga0496112_0099680
1163 Ga0496113_0033692
1164 Ga0496113_0327691
1165 Ga0496114_1092625
1166 Ga0501299_103586
1167 Ga0501032_0157764
1168 Ga0501034_0439791
1169 Ga0501038_0059525
1170 Ga0501043_0133370
1171 Ga0501047_0237880
1172 Ga0501067_0051521
1173 Ga0501067_0834781
1174 Ga0501070_0015757
1175 Ga0501207_051599
1176 Ga0501080_0568596
1177 Ga0501268_070402
1178 Ga0501270_143334
1179 Ga0501035_0016786
1180 Ga0501044_0213054
1181 nmdc:mga05p37_22428_c1
1182 nmdc:mga05p37_41311_c1
1183 nmdc:mga09592_235843_c1
1184 nmdc:mga09592_463859_c1
1185 nmdc:mga09592_74374_c1
1186 nmdc:mga09592_887086_c1
1187 nmdc:mga0qj67_11553_c1
1188 nmdc:mga0qj67_157685_c1
1189 nmdc:mga0qj67_22559_c1
1190 nmdc:mga0qj67_31430_c1
1191 nmdc:mga0qj67_52141_c1
1192 nmdc:mga06r32_1468962_c1
1193 nmdc:mga06r32_1927923_c1
1194 nmdc:mga06r32_23096_c1
1195 nmdc:mga06r32_26666_c1
1196 nmdc:mga06r32_45437_c1
1197 nmdc:mga06r32_838325_c1
1198 nmdc:mga06r32_87155_c1
1199 nmdc:mga08y16_133500_c1
1200 nmdc:mga08y16_375913_c1
1201 nmdc:mga08y16_387609_c1
1202 nmdc:mga0rr50_620867_c1
1203 nmdc:mga0a205_9691_c1
1204 Ga0590071_016058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ex5-assembly1.cif.gz_B group i intron-encoded homing endonuclease i-ceui complexed with dna 0.6911 39 65
6h6e-assembly1.cif.gz_E ptc3 holotoxin complex from photorhabdus luminecens in prepore state (tcda1, tcdb2, tccc3) 0.6887 36 79
4z1z-assembly1.cif.gz_A crystal structure of meganuclease i-smami bound to uncleaveable dna with a ttct central four 0.6818 39 65
5e5s-assembly1.cif.gz_A i-smami k103a mutant 0.6542 36 65
6gqf-assembly3.cif.gz_C the structure of mouse astera (gramd1a) with 25-hydroxy cholesterol 0.5948 29 66
ID Description Score Start End Superfamily
2ex5B00 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.6911 39 65 3.10.28.10
af_K7M5J7_70_166_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6399 28 63 2.40.50.140
af_Q4CP60_57_255_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.6115 28 79 2.120.10.10
af_Q9VSH0_18_192_3.30.460.90 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6038 20 77 3.30.460.90
af_Q18LB7_139_289_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.5993 28 47 3.10.100.10
ID Description Score Start End GO Terms
AF-C1ABL7-F1-model_v4 Uncharacterized protein 0.9737 1 114
AF-A0A2V7TL12-F1-model_v4 Uncharacterized protein 0.9694 14 114
AF-A0A0S8H6F0-F1-model_v4 Chromo domain-containing protein 0.969 15 109
AF-A0A7Y3ECU1-F1-model_v4 Uncharacterized protein 0.966 15 113
AF-A0A800K4X0-F1-model_v4 Uncharacterized protein 0.9507 15 116

Map