F468154

General Info

Members Datasets Scaffolds Average Seq Length
602 266 1204 194

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100419607|Ga0068858_1004196072
Length 222
Sequence MHDGLARAIDQRHSRPSRPIVISHVSGTLSSKDLDRVEVMTSGGVAYELLIPLGVFESLPRAGEAVSLHTHLVVKEDGWQLFGFSNAFEKRVFQRVLNAKGVGPALALGLLSTLTAERVVRALRDKDLATLQSVPRVGRKKAEQLILDLADKLDDLQVSGSPPGPGGPRPEGAGAEDAIRALVSLGYSTGDAERAVRQAIDEAGTGSGAAELFRRALGNIRG

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.16
Rhizosphere 98.5
Stem 0
Stem Tuber 0
Unclassified 6.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100419607 3300005842 Bacteria 1287
2 Ga0065715_10253935 3300005293 Bacteria 1158
3 Ga0070676_10159744 3300005328 Bacteria 1449
4 Ga0070676_10289217 3300005328 Bacteria 1107
5 Ga0070683_100010906 3300005329 Bacteria 7824
6 Ga0070683_100014475 3300005329 Bacteria 6900
7 Ga0070683_100017781 3300005329 Bacteria 6281
8 Ga0070683_100028499 3300005329 Bacteria 5047
9 Ga0070683_100217056 3300005329 Unclassified 1818
10 Ga0070683_100248484 3300005329 Bacteria 1692
11 Ga0070683_100262275 3300005329 Bacteria 1644
12 Ga0070683_100290123 3300005329 Bacteria 1556
13 Ga0070683_100359481 3300005329 Bacteria 1387
14 Ga0070683_100558546 3300005329 Bacteria 1095
15 Ga0070683_100659630 3300005329 Bacteria 1002
16 Ga0070683_100717238 3300005329 Bacteria 958
17 Ga0070683_100974848 3300005329 Bacteria 814
18 Ga0070690_100089422 3300005330 Bacteria 2026
19 Ga0070690_100146370 3300005330 Bacteria 1608
20 Ga0070690_100594021 3300005330 Bacteria 839
21 Ga0070670_100027151 3300005331 Bacteria 4924
22 Ga0070670_100127429 3300005331 Bacteria 2197
23 Ga0070677_10028480 3300005333 Bacteria 2111
24 Ga0070677_10037113 3300005333 Bacteria 1899
25 Ga0070677_10056053 3300005333 Bacteria 1611
26 Ga0068869_100121024 3300005334 Bacteria 2002
27 Ga0070666_10448962 3300005335 Bacteria 931
28 Ga0070680_100000286 3300005336 Bacteria 33685
29 Ga0070680_100005594 3300005336 Bacteria 9516
30 Ga0070680_100012687 3300005336 Bacteria 6549
31 Ga0070680_100753221 3300005336 Bacteria 839
32 Ga0070682_100223902 3300005337 Bacteria 1341
33 Ga0068868_100006828 3300005338 Bacteria 8101
34 Ga0070660_100111027 3300005339 Bacteria 2181
35 Ga0070660_100266009 3300005339 Bacteria 1401
36 Ga0070660_100609067 3300005339 Unclassified 913
37 Ga0070689_100033198 3300005340 Bacteria 3930
38 Ga0070689_100076575 3300005340 Bacteria 2621
39 Ga0070689_100115906 3300005340 Bacteria 2136
40 Ga0070689_100203512 3300005340 Bacteria 1617
41 Ga0070689_100284717 3300005340 Bacteria 1372
42 Ga0070691_10019852 3300005341 Bacteria 3102
43 Ga0070687_100030702 3300005343 Bacteria 2629
44 Ga0070687_100035687 3300005343 Bacteria 2471
45 Ga0070687_100490065 3300005343 Bacteria 825
46 Ga0070661_100003155 3300005344 Bacteria 11344
47 Ga0070661_100006991 3300005344 Bacteria 7788
48 Ga0070661_100050859 3300005344 Bacteria 3032
49 Ga0070661_100261000 3300005344 Bacteria 1339
50 Ga0070661_100370063 3300005344 Bacteria 1128
51 Ga0070692_10075463 3300005345 Bacteria 1805
52 Ga0070668_100003777 3300005347 Bacteria 11185
53 Ga0070668_100006082 3300005347 Bacteria 8951
54 Ga0070668_100084687 3300005347 Bacteria 2490
55 Ga0070668_100409109 3300005347 Bacteria 1160
56 Ga0070668_100507204 3300005347 Bacteria 1045
57 Ga0070669_100001677 3300005353 Bacteria 16034
58 Ga0070669_100002574 3300005353 Bacteria 13124
59 Ga0070669_100033241 3300005353 Bacteria 3729
60 Ga0070669_100061743 3300005353 Bacteria 2754
61 Ga0070669_100359337 3300005353 Bacteria 1184
62 Ga0070675_100001146 3300005354 Bacteria 19122
63 Ga0070675_100007735 3300005354 Bacteria 8319
64 Ga0070675_100052695 3300005354 Bacteria 3345
65 Ga0070675_100053304 3300005354 Bacteria 3326
66 Ga0070675_100096449 3300005354 Bacteria 2484
67 Ga0070671_100075572 3300005355 Bacteria 2814
68 Ga0070671_100189406 3300005355 Bacteria 1743
69 Ga0070674_100030478 3300005356 Bacteria 3565
70 Ga0070674_100143674 3300005356 Bacteria 1794
71 Ga0070673_100049143 3300005364 Bacteria 3292
72 Ga0070673_100081953 3300005364 Bacteria 2617
73 Ga0070673_100126347 3300005364 Bacteria 2140
74 Ga0070659_100002746 3300005366 Bacteria 12527
75 Ga0070659_100034104 3300005366 Bacteria 3958
76 Ga0070659_100123754 3300005366 Bacteria 2097
77 Ga0070659_100202460 3300005366 Bacteria 1635
78 Ga0070659_100255305 3300005366 Bacteria 1453
79 Ga0070659_100334130 3300005366 Bacteria 1269
80 Ga0070667_100017073 3300005367 Bacteria 6011
81 Ga0070667_100024814 3300005367 Bacteria 4981
82 Ga0070667_100115643 3300005367 Bacteria 2330
83 Ga0070667_100633317 3300005367 Unclassified 987
84 Ga0070667_100934489 3300005367 Bacteria 808
85 Ga0070714_100045763 3300005435 Bacteria 3710
86 Ga0070714_100132544 3300005435 Bacteria 2228
87 Ga0070713_100189424 3300005436 Bacteria 1853
88 Ga0070713_100848713 3300005436 Unclassified 877
89 Ga0070710_10363594 3300005437 Bacteria 961
90 Ga0070701_10052584 3300005438 Bacteria 2117
91 Ga0070711_100046624 3300005439 Bacteria 2954
92 Ga0070700_100014801 3300005441 Bacteria 4409
93 Ga0070700_100188955 3300005441 Bacteria 1439
94 Ga0070694_100345159 3300005444 Bacteria 1152
95 Ga0070708_100000005 3300005445 Bacteria 159112
96 Ga0070663_100101366 3300005455 Bacteria 2148
97 Ga0070663_100862783 3300005455 Unclassified 780
98 Ga0070678_100156276 3300005456 Bacteria 1843
99 Ga0070678_100391753 3300005456 Bacteria 1205
100 Ga0070662_100001478 3300005457 Bacteria 14471
101 Ga0070681_10000349 3300005458 Bacteria 37198
102 Ga0070681_10000943 3300005458 Bacteria 24490
103 Ga0070681_10003731 3300005458 Bacteria 14294
104 Ga0070681_10030968 3300005458 Bacteria 5370
105 Ga0070681_10031597 3300005458 Bacteria 5315
106 Ga0070681_10316284 3300005458 Bacteria 1471
107 Ga0068867_100076083 3300005459 Bacteria 2519
108 Ga0068867_100236913 3300005459 Bacteria 1478
109 Ga0068867_100522577 3300005459 Unclassified 1024
110 Ga0070685_10253310 3300005466 Bacteria 1167
111 Ga0070706_100028311 3300005467 Bacteria 5159
112 Ga0070707_100821671 3300005468 Bacteria 893
113 Ga0070698_100061958 3300005471 Bacteria 3774
114 Ga0070698_100363067 3300005471 Bacteria 1380
115 Ga0070679_100000151 3300005530 Bacteria 56102
116 Ga0070679_100005103 3300005530 Bacteria 12134
117 Ga0070679_100011086 3300005530 Bacteria 8577
118 Ga0070679_100029955 3300005530 Bacteria 5370
119 Ga0070679_100031176 3300005530 Bacteria 5266
120 Ga0070679_100052155 3300005530 Bacteria 4075
121 Ga0070679_100348981 3300005530 Bacteria 1428
122 Ga0070684_100005131 3300005535 Bacteria 10011
123 Ga0070684_100023177 3300005535 Bacteria 5187
124 Ga0070684_100034451 3300005535 Bacteria 4330
125 Ga0070684_100036341 3300005535 Bacteria 4221
126 Ga0070684_100188749 3300005535 Bacteria 1875
127 Ga0070684_100267714 3300005535 Bacteria 1564
128 Ga0070684_100279061 3300005535 Bacteria 1531
129 Ga0070684_100473415 3300005535 Bacteria 1159
130 Ga0070684_100484641 3300005535 Bacteria 1145
131 Ga0068853_100004121 3300005539 Bacteria 11207
132 Ga0068853_100063995 3300005539 Bacteria 3187
133 Ga0070672_100002903 3300005543 Bacteria 11023
134 Ga0070672_100011351 3300005543 Bacteria 6212
135 Ga0070672_100051951 3300005543 Bacteria 3198
136 Ga0070696_100009338 3300005546 Bacteria 6566
137 Ga0070696_100033195 3300005546 Bacteria 3544
138 Ga0070696_100065376 3300005546 Bacteria 2550
139 Ga0070693_100006323 3300005547 Bacteria 5740
140 Ga0070693_100656495 3300005547 Bacteria 763
141 Ga0070665_100025200 3300005548 Bacteria 5994
142 Ga0070665_100170656 3300005548 Unclassified 2176
143 Ga0070665_100410180 3300005548 Bacteria 1363
144 Ga0070665_100429684 3300005548 Unclassified 1330
145 Ga0070665_101040184 3300005548 Bacteria 831
146 Ga0068855_100007696 3300005563 Bacteria 13011
147 Ga0068855_100016878 3300005563 Bacteria 8780
148 Ga0068855_100049296 3300005563 Bacteria 4967
149 Ga0068855_100067778 3300005563 Bacteria 4156
150 Ga0070664_100006667 3300005564 Bacteria 9315
151 Ga0070664_100022043 3300005564 Bacteria 5253
152 Ga0070664_100049717 3300005564 Bacteria 3546
153 Ga0070664_100068570 3300005564 Bacteria 3032
154 Ga0070664_100091811 3300005564 Bacteria 2628
155 Ga0070664_100128849 3300005564 Bacteria 2222
156 Ga0070664_100196649 3300005564 Bacteria 1797
157 Ga0070664_100798758 3300005564 Bacteria 882
158 Ga0068857_100030587 3300005577 Bacteria 4755
159 Ga0068857_100051731 3300005577 Bacteria 3645
160 Ga0068857_100146948 3300005577 Bacteria 2133
161 Ga0068857_100293785 3300005577 Bacteria 1497
162 Ga0068854_100027963 3300005578 Bacteria 3892
163 Ga0068856_100111373 3300005614 Bacteria 2735
164 Ga0068856_100132175 3300005614 Bacteria 2501
165 Ga0068852_100021489 3300005616 Bacteria 5155
166 Ga0068852_100030795 3300005616 Bacteria 4421
167 Ga0068852_100609454 3300005616 Bacteria 1097
168 Ga0068859_100045317 3300005617 Bacteria 4418
169 Ga0068859_100058360 3300005617 Bacteria 3887
170 Ga0068864_100037264 3300005618 Bacteria 4149
171 Ga0068864_100071311 3300005618 Bacteria 3025
172 Ga0068864_100178018 3300005618 Bacteria 1942
173 Ga0068864_100579779 3300005618 Unclassified 1087
174 Ga0068866_10025576 3300005718 Bacteria 2776
175 Ga0068861_100001302 3300005719 Bacteria 15618
176 Ga0068851_10059263 3300005834 Bacteria 1958
177 Ga0068870_10015810 3300005840 Unclassified 3590
178 Ga0068870_10022193 3300005840 Bacteria 3117
179 Ga0068870_10166824 3300005840 Bacteria 1311
180 Ga0068870_10341789 3300005840 Bacteria 957
181 Ga0068863_100003184 3300005841 Bacteria 16227
182 Ga0068863_100610984 3300005841 Bacteria 1080
183 Ga0068858_100113692 3300005842 Bacteria 2528
184 Ga0068860_100016688 3300005843 Bacteria 7162
185 Ga0068860_100181560 3300005843 Bacteria 2034
186 Ga0068862_100000266 3300005844 Bacteria 58197
187 Ga0068862_100069652 3300005844 Bacteria 3036
188 Ga0070716_100300314 3300006173 Unclassified 1117
189 Ga0070712_100057030 3300006175 Bacteria 2742
190 Ga0070712_100455318 3300006175 Bacteria 1066
191 Ga0068871_100130239 3300006358 Bacteria 2132
192 Ga0068871_100356637 3300006358 Bacteria 1295
193 Ga0075430_100033997 3300006846 Bacteria 4326
194 Ga0075430_100129905 3300006846 Unclassified 2100
195 Ga0075431_100007439 3300006847 Bacteria 10907
196 Ga0075431_100055433 3300006847 Unclassified 4089
197 Ga0075431_100270923 3300006847 Bacteria 1720
198 Ga0075431_100373074 3300006847 Bacteria 1432
199 Ga0075433_10004723 3300006852 Bacteria 10622
200 Ga0075434_100001329 3300006871 Bacteria 20692
201 Ga0075429_100120497 3300006880 Bacteria 2293
202 Ga0068865_100106445 3300006881 Bacteria 2062
203 Ga0068865_100158765 3300006881 Bacteria 1723
204 Ga0097620_100045317 3300006931 Bacteria 4418
205 Ga0097620_100058364 3300006931 Bacteria 3887
206 Ga0105240_10045083 3300009093 Bacteria 5596
207 Ga0105240_10217322 3300009093 Bacteria 2229
208 Ga0105240_10732790 3300009093 Bacteria 1076
209 Ga0111539_10236535 3300009094 Bacteria 2126
210 Ga0105245_10004990 3300009098 Bacteria 11666
211 Ga0105245_10855640 3300009098 Unclassified 949
212 Ga0114129_10016119 3300009147 Bacteria 10632
213 Ga0114129_10347061 3300009147 Bacteria 1967
214 Ga0114129_11080049 3300009147 Unclassified 1006
215 Ga0105243_10361218 3300009148 Unclassified 1337
216 Ga0105243_10501604 3300009148 Bacteria 1150
217 Ga0105241_10000597 3300009174 Bacteria 27165
218 Ga0105241_10041439 3300009174 Bacteria 3479
219 Ga0105241_10179125 3300009174 Bacteria 1757
220 Ga0105242_10112869 3300009176 Bacteria 2320
221 Ga0105242_10211031 3300009176 Bacteria 1730
222 Ga0105248_10028628 3300009177 Bacteria 6208
223 Ga0105248_10203521 3300009177 Bacteria 2231
224 Ga0105248_10253350 3300009177 Bacteria 1981
225 Ga0105248_10278427 3300009177 Bacteria 1883
226 Ga0105238_10049283 3300009551 Bacteria 4242
227 Ga0105238_10055993 3300009551 Bacteria 3957
228 Ga0105238_10232408 3300009551 Bacteria 1820
229 Ga0105238_10288471 3300009551 Bacteria 1623
230 Ga0105249_10000027 3300009553 Bacteria 231352
231 Ga0105249_10000199 3300009553 Bacteria 68792
232 Ga0105249_10009497 3300009553 Bacteria 8520
233 Ga0105239_10008766 3300010375 Bacteria 11449
234 Ga0105239_10176357 3300010375 Bacteria 2391
235 Ga0105246_10776727 3300011119 Bacteria 848
236 Ga0157373_10027628 3300013100 Bacteria 4094
237 Ga0157373_10036287 3300013100 Bacteria 3539
238 Ga0157373_10316639 3300013100 Bacteria 1109
239 Ga0157371_10009474 3300013102 Bacteria 7661
240 Ga0157370_10001812 3300013104 Bacteria 26345
241 Ga0157370_10011844 3300013104 Bacteria 9097
242 Ga0157370_10100629 3300013104 Bacteria 2708
243 Ga0157369_10174841 3300013105 Bacteria 2261
244 Ga0157369_10811547 3300013105 Bacteria 961
245 Ga0157369_11022651 3300013105 Bacteria 846
246 Ga0157374_10671545 3300013296 Bacteria 1048
247 Ga0157378_10122460 3300013297 Bacteria 2399
248 Ga0157378_10213425 3300013297 Bacteria 1831
249 Ga0163162_10001871 3300013306 Bacteria 19802
250 Ga0163162_10072098 3300013306 Bacteria 3508
251 Ga0163162_10275238 3300013306 Unclassified 1815
252 Ga0157372_10005666 3300013307 Bacteria 13290
253 Ga0157372_10021204 3300013307 Bacteria 7020
254 Ga0157372_10055806 3300013307 Bacteria 4412
255 Ga0157372_10089009 3300013307 Bacteria 3507
256 Ga0157372_10422174 3300013307 Bacteria 1554
257 Ga0157372_10936386 3300013307 Bacteria 1004
258 Ga0157375_10006529 3300013308 Bacteria 10152
259 Ga0157375_10223236 3300013308 Bacteria 2043
260 Ga0157375_10255802 3300013308 Bacteria 1912
261 Ga0157375_10333555 3300013308 Bacteria 1682
262 Ga0157375_10370682 3300013308 Bacteria 1598
263 Ga0157375_10987200 3300013308 Bacteria 982
264 Ga0163163_10272226 3300014325 Bacteria 1744
265 Ga0157380_10006275 3300014326 Bacteria 8346
266 Ga0157380_10138678 3300014326 Bacteria 2086
267 Ga0182008_10001320 3300014497 Bacteria 16896
268 Ga0182008_10014885 3300014497 Bacteria 4069
269 Ga0157379_10002067 3300014968 Bacteria 16678
270 Ga0157379_10304401 3300014968 Bacteria 1453
271 Ga0157376_10021001 3300014969 Bacteria 5065
272 Ga0157376_10296788 3300014969 Bacteria 1528
273 Ga0163161_10158875 3300017792 Bacteria 1723
274 Ga0207682_10035904 3300025893 Bacteria 2004
275 Ga0207642_10018197 3300025899 Bacteria 2691
276 Ga0207688_10035301 3300025901 Bacteria 2770
277 Ga0207699_10038455 3300025906 Bacteria 2742
278 Ga0207699_10054305 3300025906 Bacteria 2379
279 Ga0207699_10220452 3300025906 Bacteria 1294
280 Ga0207645_10009768 3300025907 Bacteria 6622
281 Ga0207645_10033308 3300025907 Bacteria 3311
282 Ga0207645_10306952 3300025907 Bacteria 1057
283 Ga0207643_10012045 3300025908 Bacteria 4671
284 Ga0207705_10667703 3300025909 Bacteria 808
285 Ga0207684_10024531 3300025910 Bacteria 5141
286 Ga0207654_10002401 3300025911 Bacteria 9565
287 Ga0207654_10143945 3300025911 Bacteria 1523
288 Ga0207654_10182420 3300025911 Bacteria 1370
289 Ga0207707_10002094 3300025912 Bacteria 18051
290 Ga0207707_10009329 3300025912 Bacteria 8509
291 Ga0207707_10015994 3300025912 Bacteria 6544
292 Ga0207707_10047784 3300025912 Bacteria 3727
293 Ga0207707_10096762 3300025912 Bacteria 2579
294 Ga0207695_10011445 3300025913 Bacteria 10747
295 Ga0207695_10053998 3300025913 Bacteria 4199
296 Ga0207695_10404506 3300025913 Bacteria 1249
297 Ga0207693_10010020 3300025915 Bacteria 7701
298 Ga0207663_10060442 3300025916 Bacteria 2401
299 Ga0207660_10000238 3300025917 Bacteria 35589
300 Ga0207660_10003400 3300025917 Bacteria 10373
301 Ga0207660_10120373 3300025917 Bacteria 1987
302 Ga0207660_10286107 3300025917 Bacteria 1309
303 Ga0207662_10001932 3300025918 Bacteria 10213
304 Ga0207662_10011685 3300025918 Bacteria 4877
305 Ga0207657_10047775 3300025919 Bacteria 3739
306 Ga0207657_10061821 3300025919 Bacteria 3209
307 Ga0207657_10141274 3300025919 Bacteria 1967
308 Ga0207657_10349604 3300025919 Bacteria 1166
309 Ga0207649_10062724 3300025920 Bacteria 2344
310 Ga0207649_10196907 3300025920 Bacteria 1420
311 Ga0207649_10317443 3300025920 Bacteria 1144
312 Ga0207652_10001643 3300025921 Bacteria 19623
313 Ga0207652_10024236 3300025921 Bacteria 5033
314 Ga0207652_10130837 3300025921 Bacteria 2238
315 Ga0207652_10173181 3300025921 Bacteria 1937
316 Ga0207681_10002755 3300025923 Bacteria 11120
317 Ga0207681_10012770 3300025923 Bacteria 5189
318 Ga0207681_10162752 3300025923 Bacteria 1684
319 Ga0207694_10029125 3300025924 Bacteria 4212
320 Ga0207694_10054593 3300025924 Bacteria 3100
321 Ga0207694_10097117 3300025924 Bacteria 2330
322 Ga0207650_10064892 3300025925 Bacteria 2734
323 Ga0207650_10497179 3300025925 Bacteria 1019
324 Ga0207659_10037459 3300025926 Bacteria 3368
325 Ga0207659_10077550 3300025926 Bacteria 2446
326 Ga0207659_10082286 3300025926 Bacteria 2383
327 Ga0207687_10116479 3300025927 Bacteria 1992
328 Ga0207687_10161917 3300025927 Bacteria 1718
329 Ga0207687_10192621 3300025927 Bacteria 1588
330 Ga0207700_10556447 3300025928 Bacteria 1018
331 Ga0207700_10573887 3300025928 Bacteria 1003
332 Ga0207664_10082122 3300025929 Bacteria 2624
333 Ga0207664_10097084 3300025929 Bacteria 2427
334 Ga0207664_10110021 3300025929 Bacteria 2290
335 Ga0207664_10122391 3300025929 Bacteria 2179
336 Ga0207690_10017737 3300025932 Bacteria 4353
337 Ga0207706_10000565 3300025933 Bacteria 39296
338 Ga0207686_10137321 3300025934 Bacteria 1685
339 Ga0207709_10691884 3300025935 Unclassified 815
340 Ga0207670_10038288 3300025936 Bacteria 3131
341 Ga0207670_10082556 3300025936 Bacteria 2252
342 Ga0207670_10212752 3300025936 Bacteria 1475
343 Ga0207669_10080150 3300025937 Bacteria 2087
344 Ga0207669_10149867 3300025937 Bacteria 1632
345 Ga0207669_10205650 3300025937 Bacteria 1433
346 Ga0207704_10312406 3300025938 Unclassified 1209
347 Ga0207665_10088870 3300025939 Bacteria 2139
348 Ga0207665_10538192 3300025939 Unclassified 906
349 Ga0207691_10000109 3300025940 Bacteria 73421
350 Ga0207691_10039283 3300025940 Bacteria 4378
351 Ga0207711_10039226 3300025941 Bacteria 4028
352 Ga0207711_10085028 3300025941 Bacteria 2771
353 Ga0207711_10388619 3300025941 Bacteria 1295
354 Ga0207711_10393916 3300025941 Unclassified 1286
355 Ga0207711_10571052 3300025941 Bacteria 1055
356 Ga0207689_10006952 3300025942 Bacteria 9947
357 Ga0207689_10077064 3300025942 Bacteria 2741
358 Ga0207661_10002268 3300025944 Bacteria 13262
359 Ga0207661_10002343 3300025944 Bacteria 13045
360 Ga0207661_10008622 3300025944 Bacteria 7285
361 Ga0207661_10041032 3300025944 Bacteria 3641
362 Ga0207661_10046253 3300025944 Bacteria 3451
363 Ga0207661_10062500 3300025944 Bacteria 3013
364 Ga0207661_10084115 3300025944 Bacteria 2634
365 Ga0207661_10105430 3300025944 Bacteria 2375
366 Ga0207661_10261322 3300025944 Bacteria 1542
367 Ga0207661_10506601 3300025944 Bacteria 1103
368 Ga0207679_10028574 3300025945 Bacteria 3872
369 Ga0207679_10048642 3300025945 Bacteria 3088
370 Ga0207679_10126112 3300025945 Bacteria 2046
371 Ga0207679_10186946 3300025945 Bacteria 1719
372 Ga0207679_10276638 3300025945 Bacteria 1438
373 Ga0207679_10675503 3300025945 Bacteria 936
374 Ga0207667_10024611 3300025949 Bacteria 6606
375 Ga0207667_10040151 3300025949 Bacteria 4983
376 Ga0207667_10189031 3300025949 Bacteria 2113
377 Ga0207667_10219552 3300025949 Bacteria 1948
378 Ga0207667_10851642 3300025949 Bacteria 906
379 Ga0207651_10040500 3300025960 Bacteria 3083
380 Ga0207712_10000276 3300025961 Bacteria 49078
381 Ga0207712_10000353 3300025961 Bacteria 40832
382 Ga0207712_10003412 3300025961 Bacteria 10041
383 Ga0207668_10005339 3300025972 Bacteria 7560
384 Ga0207668_10223524 3300025972 Bacteria 1513
385 Ga0207640_10002131 3300025981 Bacteria 10627
386 Ga0207640_10902957 3300025981 Unclassified 772
387 Ga0207658_10027940 3300025986 Bacteria 3969
388 Ga0207658_10043255 3300025986 Bacteria 3274
389 Ga0207658_10214378 3300025986 Bacteria 1616
390 Ga0207658_10596257 3300025986 Bacteria 992
391 Ga0207703_10041848 3300026035 Bacteria 3673
392 Ga0207639_10095060 3300026041 Bacteria 2394
393 Ga0207678_10027984 3300026067 Bacteria 4922
394 Ga0207678_10695162 3300026067 Bacteria 895
395 Ga0207708_10019796 3300026075 Bacteria 5075
396 Ga0207708_10022328 3300026075 Bacteria 4778
397 Ga0207702_10258305 3300026078 Bacteria 1639
398 Ga0207702_10261050 3300026078 Bacteria 1631
399 Ga0207641_10050257 3300026088 Bacteria 3526
400 Ga0207648_10029694 3300026089 Bacteria 4848
401 Ga0207676_10065616 3300026095 Bacteria 2891
402 Ga0207676_10108806 3300026095 Bacteria 2315
403 Ga0207676_10170280 3300026095 Bacteria 1897
404 Ga0207676_10240783 3300026095 Bacteria 1623
405 Ga0207674_10000388 3300026116 Bacteria 57168
406 Ga0207674_10000888 3300026116 Bacteria 39092
407 Ga0207674_10027834 3300026116 Bacteria 5973
408 Ga0207675_100000650 3300026118 Bacteria 34209
409 Ga0207675_100003901 3300026118 Bacteria 14502
410 Ga0207683_10179803 3300026121 Bacteria 1918
411 Ga0207698_10121183 3300026142 Bacteria 2214
412 Ga0207698_10148923 3300026142 Bacteria 2028
413 Ga0207428_10381551 3300027907 Bacteria 1034
414 Ga0268266_10123404 3300028379 Bacteria 2308
415 Ga0268266_10298856 3300028379 Bacteria 1501
416 Ga0268266_10482595 3300028379 Bacteria 1182
417 Ga0268265_10001272 3300028380 Bacteria 21751
418 Ga0268265_10050561 3300028380 Bacteria 3132
419 Ga0307408_100003249 3300031548 Bacteria 11177
420 Ga0307408_100041640 3300031548 Bacteria 3257
421 Ga0307408_100190749 3300031548 Bacteria 1651
422 Ga0307405_10062883 3300031731 Bacteria 2352
423 Ga0307413_10006058 3300031824 Bacteria 5477
424 Ga0307413_10045550 3300031824 Bacteria 2601
425 Ga0307410_10004554 3300031852 Bacteria 7186
426 Ga0307410_10204642 3300031852 Bacteria 1509
427 Ga0307410_10234717 3300031852 Bacteria 1418
428 Ga0307410_10356081 3300031852 Bacteria 1171
429 Ga0307410_10618859 3300031852 Bacteria 905
430 Ga0307406_10003964 3300031901 Bacteria 8046
431 Ga0307406_10198539 3300031901 Bacteria 1474
432 Ga0307406_10278511 3300031901 Bacteria 1274
433 Ga0307406_10429149 3300031901 Bacteria 1055
434 Ga0307406_10629667 3300031901 Unclassified 888
435 Ga0307406_10899076 3300031901 Bacteria 754
436 Ga0307407_10117901 3300031903 Bacteria 1677
437 Ga0307407_10197351 3300031903 Bacteria 1346
438 Ga0307407_10211147 3300031903 Bacteria 1307
439 Ga0307407_10760643 3300031903 Bacteria 734
440 Ga0307407_10811178 3300031903 Bacteria 712
441 Ga0307412_10048381 3300031911 Bacteria 2796
442 Ga0307412_10128907 3300031911 Bacteria 1834
443 Ga0307412_10658648 3300031911 Bacteria 894
444 Ga0307412_10960268 3300031911 Bacteria 753
445 Ga0307409_100028006 3300031995 Bacteria 4005
446 Ga0307409_100086500 3300031995 Bacteria 2552
447 Ga0307409_100178760 3300031995 Bacteria 1876
448 Ga0307409_100454246 3300031995 Bacteria 1237
449 Ga0307409_100651413 3300031995 Unclassified 1047
450 Ga0307416_100012192 3300032002 Bacteria 5775
451 Ga0307416_100177705 3300032002 Bacteria 1991
452 Ga0307416_100269741 3300032002 Bacteria 1670
453 Ga0307416_100467039 3300032002 Bacteria 1318
454 Ga0307416_101083907 3300032002 Bacteria 905
455 Ga0307414_10309633 3300032004 Bacteria 1340
456 Ga0307414_10486424 3300032004 Bacteria 1089
457 Ga0307411_10034283 3300032005 Bacteria 3157
458 Ga0307411_10227269 3300032005 Unclassified 1452
459 Ga0307411_10378020 3300032005 Bacteria 1164
460 Ga0307411_10452414 3300032005 Bacteria 1074
461 Ga0307411_10828638 3300032005 Bacteria 817
462 Ga0307415_100020073 3300032126 Bacteria 4071
463 Ga0307415_100027322 3300032126 Bacteria 3614
464 Ga0307415_100365100 3300032126 Bacteria 1220
465 Ga0373926_0003128 3300035083 Bacteria 5310
466 Ga0373934_0002605 3300035086 Bacteria 6641
467 Ga0373934_0003751 3300035086 Bacteria 5590
468 Ga0373941_0089079 3300035115 Bacteria 1056
469 Ga0373945_0102538 3300035116 Bacteria 1121
470 Ga0373954_0256278 3300035118 Unclassified 861
471 Ga0373956_0103183 3300035119 Unclassified 1324
472 Ga0373957_0051062 3300035120 Bacteria 1582
473 Ga0373957_0054983 3300035120 Bacteria 1530
474 Ga0373943_0104749 3300035170 Bacteria 1484
475 Ga0373943_0375182 3300035170 Unclassified 818
476 Ga0373955_0043354 3300035172 Bacteria 2420
477 Ga0373924_0172535 3300035410 Unclassified 951
478 Ga0373931_0080383 3300035691 Bacteria 1797
479 Ga0373931_0226218 3300035691 Bacteria 1128
480 Ga0373935_0003442 3300035692 Bacteria 9198
481 Ga0373927_0001846 3300035695 Bacteria 15718
482 Ga0373933_0005745 3300035724 Bacteria 6747
483 Ga0373933_0047011 3300035724 Bacteria 2565
484 Ga0373947_0003643 3300035725 Bacteria 9088
485 Ga0373947_0215808 3300035725 Bacteria 1260
486 Ga0373947_0238536 3300035725 Unclassified 1199
487 Ga0373937_0002426 3300036401 Bacteria 15506
488 Ga0373925_0002130 3300037068 Bacteria 16185
489 Ga0373925_0316751 3300037068 Unclassified 1262
490 Ga0395899_0018659 3300037312 Bacteria 5271
491 Ga0395900_0028518 3300037418 Bacteria 5720
492 Ga0395901_0899070 3300038443 Bacteria 867
493 Ga0436365_1905270 3300039437 Unclassified 815
494 Ga0439439_0077717 3300041406 Bacteria 894
495 Ga0451577_0000001 3300042876 Bacteria 2461803
496 Ga0451577_0753504 3300042876 Bacteria 881
497 Ga0439440_0126663 3300042993 Bacteria 715
498 Ga0466963_0076504 3300044694 Bacteria 2260
499 Ga0451576_0040144 3300045051 Bacteria 4955
500 Ga0451576_0122257 3300045051 Bacteria 2711
501 Ga0451576_0376843 3300045051 Bacteria 1487
502 Ga0466967_0048744 3300045976 Bacteria 3701
503 Ga0466967_0515833 3300045976 Bacteria 1174
504 Ga0495603_0000907 3300046455 Bacteria 17036
505 Ga0495629_0056141 3300046459 Bacteria 2754
506 Ga0495629_0071363 3300046459 Bacteria 2424
507 Ga0495629_0185326 3300046459 Bacteria 1442
508 Ga0495651_0082792 3300046462 Bacteria 2421
509 Ga0495653_0033366 3300046463 Bacteria 4079
510 Ga0495580_0000095 3300046472 Bacteria 58325
511 Ga0495580_0014466 3300046472 Bacteria 5986
512 Ga0495580_0077656 3300046472 Bacteria 2316
513 Ga0495580_0558984 3300046472 Bacteria 759
514 Ga0495582_0000169 3300046473 Bacteria 35465
515 Ga0495639_0024777 3300046475 Bacteria 2642
516 Ga0495639_0026845 3300046475 Bacteria 2547
517 Ga0495664_0076431 3300046477 Bacteria 2004
518 Ga0495664_0174533 3300046477 Bacteria 1304
519 Ga0495594_0024828 3300046499 Bacteria 3222
520 Ga0495594_0095740 3300046499 Bacteria 1667
521 Ga0495608_0034896 3300046511 Bacteria 3395
522 Ga0495618_0200742 3300046514 Unclassified 1262
523 Ga0495628_0011644 3300046516 Bacteria 7431
524 Ga0495628_0463297 3300046516 Bacteria 919
525 Ga0495630_0018597 3300046517 Bacteria 5106
526 Ga0495630_0315491 3300046517 Bacteria 1195
527 Ga0495652_0006831 3300046529 Bacteria 10577
528 Ga0495665_0000024 3300046531 Bacteria 59245
529 Ga0495665_0111126 3300046531 Bacteria 1437
530 Ga0495586_0057539 3300046535 Bacteria 2110
531 Ga0495586_0412259 3300046535 Bacteria 778
532 Ga0495587_0003793 3300046536 Bacteria 10029
533 Ga0495587_0007569 3300046536 Bacteria 7026
534 Ga0495645_0000080 3300046543 Bacteria 66039
535 Ga0495645_0051901 3300046543 Bacteria 2984
536 Ga0495645_0052011 3300046543 Bacteria 2980
537 Ga0495667_0009449 3300046559 Bacteria 6607
538 Ga0495667_0014131 3300046559 Bacteria 5388
539 Ga0495634_0208437 3300046642 Unclassified 1211
540 Ga0495635_0262420 3300046663 Bacteria 1163
541 Ga0495588_0036686 3300046674 Bacteria 2487
542 Ga0495588_0103510 3300046674 Unclassified 1497
543 Ga0495657_0027766 3300046675 Bacteria 3990
544 Ga0495657_0268049 3300046675 Bacteria 1024
545 Ga0495599_0000259 3300046678 Bacteria 33415
546 Ga0495599_0011632 3300046678 Bacteria 5414
547 Ga0495623_0043938 3300046679 Bacteria 2841
548 Ga0495646_0045804 3300046680 Bacteria 2669
549 Ga0495647_0136141 3300046681 Unclassified 1044
550 Ga0495658_0025169 3300046683 Bacteria 3178
551 Ga0495600_0005002 3300046809 Bacteria 7966
552 Ga0495600_0300543 3300046809 Bacteria 1013
553 Ga0495581_0000376 3300047315 Bacteria 22363
554 Ga0495604_0181222 3300047317 Bacteria 1473
555 Ga0495674_0039615 3300047319 Bacteria 4222
556 Ga0495672_0033900 3300047320 Bacteria 3161
557 Ga0495680_0082628 3300047322 Bacteria 2424
558 Ga0495675_0004708 3300047444 Bacteria 8290
559 Ga0495675_0105813 3300047444 Bacteria 1758
560 Ga0495684_0012396 3300047471 Bacteria 6573
561 Ga0495684_0132642 3300047471 Bacteria 1870
562 Ga0495593_0008589 3300047673 Bacteria 5940
563 Ga0495602_0038246 3300048088 Bacteria 4440
564 Ga0495614_0000001 3300048089 Bacteria 137656
565 Ga0496108_0115276 3300048911 Bacteria 2301
566 Ga0496108_0369217 3300048911 Bacteria 1253
567 Ga0496109_0008785 3300048912 Bacteria 8604
568 Ga0496109_0212208 3300048912 Unclassified 1821
569 Ga0496112_0160094 3300048915 Bacteria 2217
570 Ga0496113_0080331 3300048916 Bacteria 2498
571 Ga0496113_0084131 3300048916 Bacteria 2442
572 Ga0501033_0049541 3300049570 Bacteria 3118
573 Ga0501034_0510661 3300049571 Bacteria 1115
574 Ga0501041_0418106 3300049577 Unclassified 850
575 Ga0501043_0104501 3300049579 Bacteria 2226
576 Ga0501047_0080975 3300049581 Bacteria 3122
577 Ga0501070_0095993 3300049586 Bacteria 2453
578 Ga0501070_0372480 3300049586 Bacteria 1157
579 Ga0501072_0403074 3300049588 Unclassified 1085
580 Ga0501073_0293733 3300049589 Bacteria 1121
581 Ga0501075_0287429 3300049591 Bacteria 1253
582 Ga0501044_0432684 3300049823 Bacteria 1225
583 Ga0501044_0868903 3300049823 Bacteria 778
584 nmdc:mga05p37_18857_c1 3300050507 Bacteria 8339
585 nmdc:mga09592_7109_c1 3300050508 Bacteria 9097
586 nmdc:mga0qj67_151734_c1 3300050509 Bacteria 1880
587 nmdc:mga0qj67_27684_c1 3300050509 Bacteria 4395
588 nmdc:mga06r32_115260_c1 3300050510 Unclassified 2646
589 nmdc:mga06r32_25403_c1 3300050510 Bacteria 5511
590 nmdc:mga06r32_359446_c1 3300050510 Bacteria 1440
591 nmdc:mga06r32_58906_c1 3300050510 Bacteria 3692
592 nmdc:mga08y16_37302_c1 3300050511 Bacteria 5105
593 nmdc:mga0n895_152458_c1 3300050512 Unclassified 2342
594 nmdc:mga0n895_776108_c1 3300050512 Bacteria 950
595 nmdc:mga0rr50_32008_c1 3300050513 Bacteria 3741
596 nmdc:mga0a205_29723_c1 3300050515 Bacteria 5230
597 Ga0495601_0284973 3300053077 Bacteria 1077
598 Ga0495612_0016854 3300053078 Bacteria 2927
599 Ga0495595_0053566 3300053084 Bacteria 1875
600 Ga0495619_0076586 3300053085 Bacteria 2246
601 Ga0495619_0137108 3300053085 Bacteria 1683
602 Ga0500641_0395478 3300053096 Bacteria 545
603 Ga0068858_100419607
604 Ga0065715_10253935
605 Ga0070676_10159744
606 Ga0070676_10289217
607 Ga0070683_100010906
608 Ga0070683_100014475
609 Ga0070683_100017781
610 Ga0070683_100028499
611 Ga0070683_100217056
612 Ga0070683_100248484
613 Ga0070683_100262275
614 Ga0070683_100290123
615 Ga0070683_100359481
616 Ga0070683_100558546
617 Ga0070683_100659630
618 Ga0070683_100717238
619 Ga0070683_100974848
620 Ga0070690_100089422
621 Ga0070690_100146370
622 Ga0070690_100594021
623 Ga0070670_100027151
624 Ga0070670_100127429
625 Ga0070677_10028480
626 Ga0070677_10037113
627 Ga0070677_10056053
628 Ga0068869_100121024
629 Ga0070666_10448962
630 Ga0070680_100000286
631 Ga0070680_100005594
632 Ga0070680_100012687
633 Ga0070680_100753221
634 Ga0070682_100223902
635 Ga0068868_100006828
636 Ga0070660_100111027
637 Ga0070660_100266009
638 Ga0070660_100609067
639 Ga0070689_100033198
640 Ga0070689_100076575
641 Ga0070689_100115906
642 Ga0070689_100203512
643 Ga0070689_100284717
644 Ga0070691_10019852
645 Ga0070687_100030702
646 Ga0070687_100035687
647 Ga0070687_100490065
648 Ga0070661_100003155
649 Ga0070661_100006991
650 Ga0070661_100050859
651 Ga0070661_100261000
652 Ga0070661_100370063
653 Ga0070692_10075463
654 Ga0070668_100003777
655 Ga0070668_100006082
656 Ga0070668_100084687
657 Ga0070668_100409109
658 Ga0070668_100507204
659 Ga0070669_100001677
660 Ga0070669_100002574
661 Ga0070669_100033241
662 Ga0070669_100061743
663 Ga0070669_100359337
664 Ga0070675_100001146
665 Ga0070675_100007735
666 Ga0070675_100052695
667 Ga0070675_100053304
668 Ga0070675_100096449
669 Ga0070671_100075572
670 Ga0070671_100189406
671 Ga0070674_100030478
672 Ga0070674_100143674
673 Ga0070673_100049143
674 Ga0070673_100081953
675 Ga0070673_100126347
676 Ga0070659_100002746
677 Ga0070659_100034104
678 Ga0070659_100123754
679 Ga0070659_100202460
680 Ga0070659_100255305
681 Ga0070659_100334130
682 Ga0070667_100017073
683 Ga0070667_100024814
684 Ga0070667_100115643
685 Ga0070667_100633317
686 Ga0070667_100934489
687 Ga0070714_100045763
688 Ga0070714_100132544
689 Ga0070713_100189424
690 Ga0070713_100848713
691 Ga0070710_10363594
692 Ga0070701_10052584
693 Ga0070711_100046624
694 Ga0070700_100014801
695 Ga0070700_100188955
696 Ga0070694_100345159
697 Ga0070708_100000005
698 Ga0070663_100101366
699 Ga0070663_100862783
700 Ga0070678_100156276
701 Ga0070678_100391753
702 Ga0070662_100001478
703 Ga0070681_10000349
704 Ga0070681_10000943
705 Ga0070681_10003731
706 Ga0070681_10030968
707 Ga0070681_10031597
708 Ga0070681_10316284
709 Ga0068867_100076083
710 Ga0068867_100236913
711 Ga0068867_100522577
712 Ga0070685_10253310
713 Ga0070706_100028311
714 Ga0070707_100821671
715 Ga0070698_100061958
716 Ga0070698_100363067
717 Ga0070679_100000151
718 Ga0070679_100005103
719 Ga0070679_100011086
720 Ga0070679_100029955
721 Ga0070679_100031176
722 Ga0070679_100052155
723 Ga0070679_100348981
724 Ga0070684_100005131
725 Ga0070684_100023177
726 Ga0070684_100034451
727 Ga0070684_100036341
728 Ga0070684_100188749
729 Ga0070684_100267714
730 Ga0070684_100279061
731 Ga0070684_100473415
732 Ga0070684_100484641
733 Ga0068853_100004121
734 Ga0068853_100063995
735 Ga0070672_100002903
736 Ga0070672_100011351
737 Ga0070672_100051951
738 Ga0070696_100009338
739 Ga0070696_100033195
740 Ga0070696_100065376
741 Ga0070693_100006323
742 Ga0070693_100656495
743 Ga0070665_100025200
744 Ga0070665_100170656
745 Ga0070665_100410180
746 Ga0070665_100429684
747 Ga0070665_101040184
748 Ga0068855_100007696
749 Ga0068855_100016878
750 Ga0068855_100049296
751 Ga0068855_100067778
752 Ga0070664_100006667
753 Ga0070664_100022043
754 Ga0070664_100049717
755 Ga0070664_100068570
756 Ga0070664_100091811
757 Ga0070664_100128849
758 Ga0070664_100196649
759 Ga0070664_100798758
760 Ga0068857_100030587
761 Ga0068857_100051731
762 Ga0068857_100146948
763 Ga0068857_100293785
764 Ga0068854_100027963
765 Ga0068856_100111373
766 Ga0068856_100132175
767 Ga0068852_100021489
768 Ga0068852_100030795
769 Ga0068852_100609454
770 Ga0068859_100045317
771 Ga0068859_100058360
772 Ga0068864_100037264
773 Ga0068864_100071311
774 Ga0068864_100178018
775 Ga0068864_100579779
776 Ga0068866_10025576
777 Ga0068861_100001302
778 Ga0068851_10059263
779 Ga0068870_10015810
780 Ga0068870_10022193
781 Ga0068870_10166824
782 Ga0068870_10341789
783 Ga0068863_100003184
784 Ga0068863_100610984
785 Ga0068858_100113692
786 Ga0068860_100016688
787 Ga0068860_100181560
788 Ga0068862_100000266
789 Ga0068862_100069652
790 Ga0070716_100300314
791 Ga0070712_100057030
792 Ga0070712_100455318
793 Ga0068871_100130239
794 Ga0068871_100356637
795 Ga0075430_100033997
796 Ga0075430_100129905
797 Ga0075431_100007439
798 Ga0075431_100055433
799 Ga0075431_100270923
800 Ga0075431_100373074
801 Ga0075433_10004723
802 Ga0075434_100001329
803 Ga0075429_100120497
804 Ga0068865_100106445
805 Ga0068865_100158765
806 Ga0097620_100045317
807 Ga0097620_100058364
808 Ga0105240_10045083
809 Ga0105240_10217322
810 Ga0105240_10732790
811 Ga0111539_10236535
812 Ga0105245_10004990
813 Ga0105245_10855640
814 Ga0114129_10016119
815 Ga0114129_10347061
816 Ga0114129_11080049
817 Ga0105243_10361218
818 Ga0105243_10501604
819 Ga0105241_10000597
820 Ga0105241_10041439
821 Ga0105241_10179125
822 Ga0105242_10112869
823 Ga0105242_10211031
824 Ga0105248_10028628
825 Ga0105248_10203521
826 Ga0105248_10253350
827 Ga0105248_10278427
828 Ga0105238_10049283
829 Ga0105238_10055993
830 Ga0105238_10232408
831 Ga0105238_10288471
832 Ga0105249_10000027
833 Ga0105249_10000199
834 Ga0105249_10009497
835 Ga0105239_10008766
836 Ga0105239_10176357
837 Ga0105246_10776727
838 Ga0157373_10027628
839 Ga0157373_10036287
840 Ga0157373_10316639
841 Ga0157371_10009474
842 Ga0157370_10001812
843 Ga0157370_10011844
844 Ga0157370_10100629
845 Ga0157369_10174841
846 Ga0157369_10811547
847 Ga0157369_11022651
848 Ga0157374_10671545
849 Ga0157378_10122460
850 Ga0157378_10213425
851 Ga0163162_10001871
852 Ga0163162_10072098
853 Ga0163162_10275238
854 Ga0157372_10005666
855 Ga0157372_10021204
856 Ga0157372_10055806
857 Ga0157372_10089009
858 Ga0157372_10422174
859 Ga0157372_10936386
860 Ga0157375_10006529
861 Ga0157375_10223236
862 Ga0157375_10255802
863 Ga0157375_10333555
864 Ga0157375_10370682
865 Ga0157375_10987200
866 Ga0163163_10272226
867 Ga0157380_10006275
868 Ga0157380_10138678
869 Ga0182008_10001320
870 Ga0182008_10014885
871 Ga0157379_10002067
872 Ga0157379_10304401
873 Ga0157376_10021001
874 Ga0157376_10296788
875 Ga0163161_10158875
876 Ga0207682_10035904
877 Ga0207642_10018197
878 Ga0207688_10035301
879 Ga0207699_10038455
880 Ga0207699_10054305
881 Ga0207699_10220452
882 Ga0207645_10009768
883 Ga0207645_10033308
884 Ga0207645_10306952
885 Ga0207643_10012045
886 Ga0207705_10667703
887 Ga0207684_10024531
888 Ga0207654_10002401
889 Ga0207654_10143945
890 Ga0207654_10182420
891 Ga0207707_10002094
892 Ga0207707_10009329
893 Ga0207707_10015994
894 Ga0207707_10047784
895 Ga0207707_10096762
896 Ga0207695_10011445
897 Ga0207695_10053998
898 Ga0207695_10404506
899 Ga0207693_10010020
900 Ga0207663_10060442
901 Ga0207660_10000238
902 Ga0207660_10003400
903 Ga0207660_10120373
904 Ga0207660_10286107
905 Ga0207662_10001932
906 Ga0207662_10011685
907 Ga0207657_10047775
908 Ga0207657_10061821
909 Ga0207657_10141274
910 Ga0207657_10349604
911 Ga0207649_10062724
912 Ga0207649_10196907
913 Ga0207649_10317443
914 Ga0207652_10001643
915 Ga0207652_10024236
916 Ga0207652_10130837
917 Ga0207652_10173181
918 Ga0207681_10002755
919 Ga0207681_10012770
920 Ga0207681_10162752
921 Ga0207694_10029125
922 Ga0207694_10054593
923 Ga0207694_10097117
924 Ga0207650_10064892
925 Ga0207650_10497179
926 Ga0207659_10037459
927 Ga0207659_10077550
928 Ga0207659_10082286
929 Ga0207687_10116479
930 Ga0207687_10161917
931 Ga0207687_10192621
932 Ga0207700_10556447
933 Ga0207700_10573887
934 Ga0207664_10082122
935 Ga0207664_10097084
936 Ga0207664_10110021
937 Ga0207664_10122391
938 Ga0207690_10017737
939 Ga0207706_10000565
940 Ga0207686_10137321
941 Ga0207709_10691884
942 Ga0207670_10038288
943 Ga0207670_10082556
944 Ga0207670_10212752
945 Ga0207669_10080150
946 Ga0207669_10149867
947 Ga0207669_10205650
948 Ga0207704_10312406
949 Ga0207665_10088870
950 Ga0207665_10538192
951 Ga0207691_10000109
952 Ga0207691_10039283
953 Ga0207711_10039226
954 Ga0207711_10085028
955 Ga0207711_10388619
956 Ga0207711_10393916
957 Ga0207711_10571052
958 Ga0207689_10006952
959 Ga0207689_10077064
960 Ga0207661_10002268
961 Ga0207661_10002343
962 Ga0207661_10008622
963 Ga0207661_10041032
964 Ga0207661_10046253
965 Ga0207661_10062500
966 Ga0207661_10084115
967 Ga0207661_10105430
968 Ga0207661_10261322
969 Ga0207661_10506601
970 Ga0207679_10028574
971 Ga0207679_10048642
972 Ga0207679_10126112
973 Ga0207679_10186946
974 Ga0207679_10276638
975 Ga0207679_10675503
976 Ga0207667_10024611
977 Ga0207667_10040151
978 Ga0207667_10189031
979 Ga0207667_10219552
980 Ga0207667_10851642
981 Ga0207651_10040500
982 Ga0207712_10000276
983 Ga0207712_10000353
984 Ga0207712_10003412
985 Ga0207668_10005339
986 Ga0207668_10223524
987 Ga0207640_10002131
988 Ga0207640_10902957
989 Ga0207658_10027940
990 Ga0207658_10043255
991 Ga0207658_10214378
992 Ga0207658_10596257
993 Ga0207703_10041848
994 Ga0207639_10095060
995 Ga0207678_10027984
996 Ga0207678_10695162
997 Ga0207708_10019796
998 Ga0207708_10022328
999 Ga0207702_10258305
1000 Ga0207702_10261050
1001 Ga0207641_10050257
1002 Ga0207648_10029694
1003 Ga0207676_10065616
1004 Ga0207676_10108806
1005 Ga0207676_10170280
1006 Ga0207676_10240783
1007 Ga0207674_10000388
1008 Ga0207674_10000888
1009 Ga0207674_10027834
1010 Ga0207675_100000650
1011 Ga0207675_100003901
1012 Ga0207683_10179803
1013 Ga0207698_10121183
1014 Ga0207698_10148923
1015 Ga0207428_10381551
1016 Ga0268266_10123404
1017 Ga0268266_10298856
1018 Ga0268266_10482595
1019 Ga0268265_10001272
1020 Ga0268265_10050561
1021 Ga0307408_100003249
1022 Ga0307408_100041640
1023 Ga0307408_100190749
1024 Ga0307405_10062883
1025 Ga0307413_10006058
1026 Ga0307413_10045550
1027 Ga0307410_10004554
1028 Ga0307410_10204642
1029 Ga0307410_10234717
1030 Ga0307410_10356081
1031 Ga0307410_10618859
1032 Ga0307406_10003964
1033 Ga0307406_10198539
1034 Ga0307406_10278511
1035 Ga0307406_10429149
1036 Ga0307406_10629667
1037 Ga0307406_10899076
1038 Ga0307407_10117901
1039 Ga0307407_10197351
1040 Ga0307407_10211147
1041 Ga0307407_10760643
1042 Ga0307407_10811178
1043 Ga0307412_10048381
1044 Ga0307412_10128907
1045 Ga0307412_10658648
1046 Ga0307412_10960268
1047 Ga0307409_100028006
1048 Ga0307409_100086500
1049 Ga0307409_100178760
1050 Ga0307409_100454246
1051 Ga0307409_100651413
1052 Ga0307416_100012192
1053 Ga0307416_100177705
1054 Ga0307416_100269741
1055 Ga0307416_100467039
1056 Ga0307416_101083907
1057 Ga0307414_10309633
1058 Ga0307414_10486424
1059 Ga0307411_10034283
1060 Ga0307411_10227269
1061 Ga0307411_10378020
1062 Ga0307411_10452414
1063 Ga0307411_10828638
1064 Ga0307415_100020073
1065 Ga0307415_100027322
1066 Ga0307415_100365100
1067 Ga0373926_0003128
1068 Ga0373934_0002605
1069 Ga0373934_0003751
1070 Ga0373941_0089079
1071 Ga0373945_0102538
1072 Ga0373954_0256278
1073 Ga0373956_0103183
1074 Ga0373957_0051062
1075 Ga0373957_0054983
1076 Ga0373943_0104749
1077 Ga0373943_0375182
1078 Ga0373955_0043354
1079 Ga0373924_0172535
1080 Ga0373931_0080383
1081 Ga0373931_0226218
1082 Ga0373935_0003442
1083 Ga0373927_0001846
1084 Ga0373933_0005745
1085 Ga0373933_0047011
1086 Ga0373947_0003643
1087 Ga0373947_0215808
1088 Ga0373947_0238536
1089 Ga0373937_0002426
1090 Ga0373925_0002130
1091 Ga0373925_0316751
1092 Ga0395899_0018659
1093 Ga0395900_0028518
1094 Ga0395901_0899070
1095 Ga0436365_1905270
1096 Ga0439439_0077717
1097 Ga0451577_0000001
1098 Ga0451577_0753504
1099 Ga0439440_0126663
1100 Ga0466963_0076504
1101 Ga0451576_0040144
1102 Ga0451576_0122257
1103 Ga0451576_0376843
1104 Ga0466967_0048744
1105 Ga0466967_0515833
1106 Ga0495603_0000907
1107 Ga0495629_0056141
1108 Ga0495629_0071363
1109 Ga0495629_0185326
1110 Ga0495651_0082792
1111 Ga0495653_0033366
1112 Ga0495580_0000095
1113 Ga0495580_0014466
1114 Ga0495580_0077656
1115 Ga0495580_0558984
1116 Ga0495582_0000169
1117 Ga0495639_0024777
1118 Ga0495639_0026845
1119 Ga0495664_0076431
1120 Ga0495664_0174533
1121 Ga0495594_0024828
1122 Ga0495594_0095740
1123 Ga0495608_0034896
1124 Ga0495618_0200742
1125 Ga0495628_0011644
1126 Ga0495628_0463297
1127 Ga0495630_0018597
1128 Ga0495630_0315491
1129 Ga0495652_0006831
1130 Ga0495665_0000024
1131 Ga0495665_0111126
1132 Ga0495586_0057539
1133 Ga0495586_0412259
1134 Ga0495587_0003793
1135 Ga0495587_0007569
1136 Ga0495645_0000080
1137 Ga0495645_0051901
1138 Ga0495645_0052011
1139 Ga0495667_0009449
1140 Ga0495667_0014131
1141 Ga0495634_0208437
1142 Ga0495635_0262420
1143 Ga0495588_0036686
1144 Ga0495588_0103510
1145 Ga0495657_0027766
1146 Ga0495657_0268049
1147 Ga0495599_0000259
1148 Ga0495599_0011632
1149 Ga0495623_0043938
1150 Ga0495646_0045804
1151 Ga0495647_0136141
1152 Ga0495658_0025169
1153 Ga0495600_0005002
1154 Ga0495600_0300543
1155 Ga0495581_0000376
1156 Ga0495604_0181222
1157 Ga0495674_0039615
1158 Ga0495672_0033900
1159 Ga0495680_0082628
1160 Ga0495675_0004708
1161 Ga0495675_0105813
1162 Ga0495684_0012396
1163 Ga0495684_0132642
1164 Ga0495593_0008589
1165 Ga0495602_0038246
1166 Ga0495614_0000001
1167 Ga0496108_0115276
1168 Ga0496108_0369217
1169 Ga0496109_0008785
1170 Ga0496109_0212208
1171 Ga0496112_0160094
1172 Ga0496113_0080331
1173 Ga0496113_0084131
1174 Ga0501033_0049541
1175 Ga0501034_0510661
1176 Ga0501041_0418106
1177 Ga0501043_0104501
1178 Ga0501047_0080975
1179 Ga0501070_0095993
1180 Ga0501070_0372480
1181 Ga0501072_0403074
1182 Ga0501073_0293733
1183 Ga0501075_0287429
1184 Ga0501044_0432684
1185 Ga0501044_0868903
1186 nmdc:mga05p37_18857_c1
1187 nmdc:mga09592_7109_c1
1188 nmdc:mga0qj67_151734_c1
1189 nmdc:mga0qj67_27684_c1
1190 nmdc:mga06r32_115260_c1
1191 nmdc:mga06r32_25403_c1
1192 nmdc:mga06r32_359446_c1
1193 nmdc:mga06r32_58906_c1
1194 nmdc:mga08y16_37302_c1
1195 nmdc:mga0n895_152458_c1
1196 nmdc:mga0n895_776108_c1
1197 nmdc:mga0rr50_32008_c1
1198 nmdc:mga0a205_29723_c1
1199 Ga0495601_0284973
1200 Ga0495612_0016854
1201 Ga0495595_0053566
1202 Ga0495619_0076586
1203 Ga0495619_0137108
1204 Ga0500641_0395478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

22

83

0.97

PF07499

RuvA_C

RuvA, C-terminal domain

173

220

0.87

PF14520

HHH_5

Helix-hairpin-helix domain

93

151

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zte-assembly1.cif.gz_A mtruva form iv 0.9713 1 132
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9577 1 133
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9526 1 134
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9517 1 139
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9439 1 133
ID Description Score Start End Superfamily
2h5xD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9855 68 132 1.10.150.20
2h5xC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9854 68 133 1.10.150.20
2h5xB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9852 68 132 1.10.150.20
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9813 68 132 1.10.150.20
1d8lB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9536 1 64 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7X6A701-F1-model_v4 Holliday junction branch migration protein RuvA 0.9741 35 133 GO:0003677
GO:0003678
GO:0005737
GO:0006281
GO:0006310
AF-A0A660YIC9-F1-model_v4 Holliday junction branch migration protein RuvA 0.9735 1 102 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A7W1I2A7-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9721 1 121 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-V7KDP7-F1-model_v4 deleted 0.9706 1 137
AF-A0A7C2L542-F1-model_v4 Holliday junction branch migration protein RuvA 0.9691 1 133 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378

Map