F468148

General Info

Members Datasets Scaffolds Average Seq Length
602 210 1178 191

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100457202|Ga0070679_1004572021
Length 220
Sequence MQTHQDSPLQGKRIAVLMTDGVEQVEYTSPRAFLEEHGAEVVLISPKPSGEEVQGFHHLSPGDRFRVEMDVRNADASDFDALVLPGGVANPDQLRLSQDAISFIRNFANEDKPIAAICHGPWTLIDAGVAQGKRMTSWPSLRQDLRNAGAEWIDQQVVVDGRLVTSRKPDDIPAFDEALLRELTGASSEDDETIQQSEEDAKISIGQNYIQEHPGSQQTG

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
38 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
70 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
71 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 5.81
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 3.65
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100457202 3300005530 Bacteria 1221
2 Ga0055525_1000074 3300003759 Bacteria 178058
3 Ga0065165_1001586 3300005262 Bacteria 23398
4 Ga0070658_10103799 3300005327 Bacteria 2351
5 Ga0070658_10158592 3300005327 Bacteria 1897
6 Ga0070658_10483739 3300005327 Bacteria 1068
7 Ga0070683_100009996 3300005329 Bacteria 8136
8 Ga0070683_100964717 3300005329 Bacteria 818
9 Ga0070660_100033746 3300005339 Bacteria 3860
10 Ga0070659_100119752 3300005366 Bacteria 2131
11 Ga0070714_100095483 3300005435 Bacteria 2611
12 Ga0070714_101200832 3300005435 Bacteria 740
13 Ga0070713_100289629 3300005436 Bacteria 1504
14 Ga0070681_10446533 3300005458 Bacteria 1205
15 Ga0070681_10537673 3300005458 Bacteria 1082
16 Ga0070684_100026020 3300005535 Bacteria 4925
17 Ga0070684_100123326 3300005535 Bacteria 2332
18 Ga0068853_100017722 3300005539 Bacteria 5877
19 Ga0068855_100006551 3300005563 Bacteria 14154
20 Ga0068855_100021511 3300005563 Bacteria 7735
21 Ga0068855_100057110 3300005563 Bacteria 4576
22 Ga0068855_100306641 3300005563 Bacteria 1757
23 Ga0068855_100633401 3300005563 Bacteria 1150
24 Ga0070664_100172789 3300005564 Bacteria 1917
25 Ga0070664_100859405 3300005564 Bacteria 850
26 Ga0068857_100096569 3300005577 Bacteria 2648
27 Ga0068856_100009695 3300005614 Bacteria 9353
28 Ga0068852_100237673 3300005616 Bacteria 1740
29 Ga0075435_100095868 3300007076 Bacteria 2454
30 Ga0075435_100272442 3300007076 Bacteria 1444
31 Ga0105240_10043451 3300009093 Bacteria 5718
32 Ga0105240_10063077 3300009093 Bacteria 4611
33 Ga0105240_10371434 3300009093 Bacteria 1617
34 Ga0105245_10468401 3300009098 Bacteria 1271
35 Ga0105241_10018687 3300009174 Bacteria 5103
36 Ga0105242_10152072 3300009176 Unclassified 2019
37 Ga0105242_10200743 3300009176 Bacteria 1771
38 Ga0105237_10476329 3300009545 Bacteria 1255
39 Ga0105238_10017600 3300009551 Bacteria 7264
40 Ga0105238_10417029 3300009551 Bacteria 1337
41 Ga0105239_10325088 3300010375 Bacteria 1735
42 Ga0157370_10775858 3300013104 Bacteria 873
43 Ga0157369_10002199 3300013105 Bacteria 23484
44 Ga0157374_10002400 3300013296 Bacteria 15790
45 Ga0157374_10402728 3300013296 Bacteria 1365
46 Ga0157378_10971419 3300013297 Bacteria 883
47 Ga0163162_11249589 3300013306 Bacteria 843
48 Ga0157372_10001977 3300013307 Bacteria 22272
49 Ga0157372_10173602 3300013307 Bacteria 2494
50 Ga0157376_11362567 3300014969 Bacteria 740
51 Ga0206351_10282115 3300020077 Bacteria 993
52 Ga0206350_10830367 3300020080 Bacteria 1476
53 Ga0206354_10615528 3300020081 Bacteria 1032
54 Ga0224712_10364861 3300022467 Bacteria 684
55 Ga0224712_10458244 3300022467 Bacteria 613
56 Ga0224712_10462760 3300022467 Bacteria 610
57 Ga0256720_128494 3300023438 Bacteria 1177
58 Ga0209563_100003 3300025230 Bacteria 1932942
59 Ga0209677_102572 3300025253 Bacteria 6678
60 Ga0209148_1001147 3300025254 Bacteria 15420
61 Ga0207705_10017656 3300025909 Bacteria 5106
62 Ga0207705_10025236 3300025909 Bacteria 4243
63 Ga0207654_10016799 3300025911 Bacteria 3816
64 Ga0207707_10373506 3300025912 Bacteria 1227
65 Ga0207695_10094143 3300025913 Bacteria 3004
66 Ga0207695_10126405 3300025913 Bacteria 2518
67 Ga0207657_10003340 3300025919 Bacteria 17159
68 Ga0207657_10134593 3300025919 Bacteria 2023
69 Ga0207649_10104966 3300025920 Bacteria 1877
70 Ga0207652_10401977 3300025921 Bacteria 1236
71 Ga0207694_10220914 3300025924 Bacteria 1546
72 Ga0207694_10541039 3300025924 Bacteria 977
73 Ga0207687_10368302 3300025927 Bacteria 1174
74 Ga0207700_10627388 3300025928 Bacteria 957
75 Ga0207664_10123434 3300025929 Bacteria 2171
76 Ga0207690_10014816 3300025932 Bacteria 4717
77 Ga0207690_10397985 3300025932 Bacteria 1098
78 Ga0207686_10117439 3300025934 Bacteria 1805
79 Ga0207661_10016407 3300025944 Bacteria 5464
80 Ga0207661_10882991 3300025944 Bacteria 823
81 Ga0207679_10107358 3300025945 Bacteria 2196
82 Ga0207667_10018055 3300025949 Bacteria 7922
83 Ga0207667_10081087 3300025949 Bacteria 3362
84 Ga0207667_10120269 3300025949 Bacteria 2706
85 Ga0207639_10899048 3300026041 Bacteria 828
86 Ga0207678_10452597 3300026067 Bacteria 1116
87 Ga0207702_10006475 3300026078 Bacteria 10097
88 Ga0207674_10066829 3300026116 Bacteria 3620
89 Ga0207698_10002998 3300026142 Bacteria 10131
90 Ga0307508_10000069 3300031616 Bacteria 119428
91 Ga0307518_10115065 3300031838 Bacteria 1911
92 Ga0395899_0007727 3300037312 Bacteria 8292
93 Ga0395899_0009068 3300037312 Bacteria 7646
94 Ga0395899_0050353 3300037312 Bacteria 3092
95 Ga0395899_0078821 3300037312 Bacteria 2400
96 Ga0395899_0085071 3300037312 Bacteria 2298
97 Ga0395899_0295185 3300037312 Bacteria 1098
98 Ga0395900_0000338 3300037418 Bacteria 69123
99 Ga0395900_0013761 3300037418 Bacteria 8257
100 Ga0395900_0021172 3300037418 Bacteria 6646
101 Ga0395900_0022377 3300037418 Bacteria 6464
102 Ga0395900_0061625 3300037418 Bacteria 3856
103 Ga0395900_0071860 3300037418 Bacteria 3557
104 Ga0395900_0073158 3300037418 Bacteria 3523
105 Ga0395900_0153135 3300037418 Bacteria 2355
106 Ga0395900_0339857 3300037418 Bacteria 1477
107 Ga0395898_0013421 3300037466 Bacteria 8438
108 Ga0395898_0036327 3300037466 Bacteria 4892
109 Ga0395898_0151963 3300037466 Bacteria 2215
110 Ga0395898_0207106 3300037466 Bacteria 1871
111 Ga0395898_0502193 3300037466 Bacteria 1153
112 Ga0395898_0997179 3300037466 Bacteria 773
113 Ga0395905_0012527 3300037471 Bacteria 8160
114 Ga0395905_0020855 3300037471 Bacteria 6206
115 Ga0395905_0077228 3300037471 Bacteria 3120
116 Ga0395905_0249682 3300037471 Bacteria 1657
117 Ga0395905_0366097 3300037471 Bacteria 1334
118 Ga0395905_0679594 3300037471 Bacteria 932
119 Ga0395901_0001241 3300038443 Bacteria 27240
120 Ga0395901_0012316 3300038443 Bacteria 8679
121 Ga0395901_0067924 3300038443 Bacteria 3713
122 Ga0395901_0347026 3300038443 Bacteria 1532
123 Ga0395901_0486921 3300038443 Bacteria 1257
124 Ga0439448_0135363 3300042005 Bacteria 851
125 Ga0439450_059229 3300042008 Bacteria 923
126 Ga0439458_0020400 3300042157 Bacteria 1530
127 Ga0466972_0011790 3300044658 Bacteria 4390
128 Ga0453683_0091570 3300044673 Bacteria 1906
129 Ga0466965_0008545 3300044683 Bacteria 4737
130 Ga0466965_0010717 3300044683 Bacteria 4284
131 Ga0466965_0036944 3300044683 Bacteria 2397
132 Ga0466965_0120522 3300044683 Bacteria 1354
133 Ga0466966_0004652 3300044684 Bacteria 9040
134 Ga0466966_0008966 3300044684 Bacteria 6629
135 Ga0466966_0036425 3300044684 Bacteria 3176
136 Ga0466966_0228287 3300044684 Bacteria 1123
137 Ga0466966_0266204 3300044684 Bacteria 1031
138 Ga0466961_0149214 3300044693 Bacteria 1460
139 Ga0466961_0183581 3300044693 Bacteria 1298
140 Ga0466964_0005924 3300044706 Bacteria 4551
141 Ga0466964_0027805 3300044706 Bacteria 2223
142 Ga0466964_0275610 3300044706 Bacteria 839
143 Ga0453684_0319015 3300044712 Bacteria 1761
144 Ga0466971_0081702 3300044719 Bacteria 1474
145 Ga0466968_0001147 3300044735 Bacteria 9388
146 Ga0466970_0420410 3300044765 Bacteria 764
147 Ga0466957_0000022 3300044842 Bacteria 60843
148 Ga0466957_0002796 3300044842 Bacteria 9439
149 Ga0466957_0054332 3300044842 Bacteria 2444
150 Ga0466957_0478003 3300044842 Bacteria 861
151 Ga0466960_0031427 3300044901 Bacteria 2450
152 Ga0466959_0136129 3300045049 Bacteria 1738
153 Ga0466959_0138491 3300045049 Bacteria 1721
154 Ga0466959_0154249 3300045049 Bacteria 1617
155 Ga0466959_0228870 3300045049 Bacteria 1287
156 Ga0451576_0365138 3300045051 Bacteria 1512
157 Ga0466958_0024788 3300045836 Bacteria 3530
158 Ga0466958_0028816 3300045836 Bacteria 3294
159 Ga0466958_0195857 3300045836 Bacteria 1285
160 Ga0466958_0394302 3300045836 Bacteria 893
161 Ga0466967_0173125 3300045976 Bacteria 2032
162 Ga0495617_025100 3300046452 Bacteria 2010
163 Ga0495627_005200 3300046453 Bacteria 5290
164 Ga0495627_009701 3300046453 Bacteria 3531
165 Ga0495603_0011758 3300046455 Bacteria 5296
166 Ga0495590_0000070 3300046457 Bacteria 71704
167 Ga0495590_0000180 3300046457 Bacteria 37213
168 Ga0495591_000814 3300046458 Bacteria 22076
169 Ga0495591_011827 3300046458 Bacteria 3280
170 Ga0495629_0057186 3300046459 Bacteria 2727
171 Ga0495638_0020495 3300046460 Bacteria 4368
172 Ga0495653_0026020 3300046463 Bacteria 4696
173 Ga0495650_0006806 3300046471 Bacteria 7051
174 Ga0495582_0000647 3300046473 Bacteria 19151
175 Ga0495582_0012372 3300046473 Bacteria 4700
176 Ga0495605_0000408 3300046474 Bacteria 39353
177 Ga0495605_0004465 3300046474 Bacteria 8209
178 Ga0495605_0007843 3300046474 Bacteria 6048
179 Ga0495605_0016520 3300046474 Bacteria 3993
180 Ga0495605_0020960 3300046474 Bacteria 3468
181 Ga0495605_0039174 3300046474 Bacteria 2375
182 Ga0495605_0098894 3300046474 Bacteria 1343
183 Ga0495639_0037555 3300046475 Bacteria 2172
184 Ga0495584_0001552 3300046491 Bacteria 13647
185 Ga0495584_0001829 3300046491 Bacteria 12370
186 Ga0495584_0004823 3300046491 Bacteria 7207
187 Ga0495584_0008969 3300046491 Bacteria 5169
188 Ga0495584_0010689 3300046491 Bacteria 4714
189 Ga0495584_0026932 3300046491 Bacteria 2913
190 Ga0495584_0028000 3300046491 Bacteria 2854
191 Ga0495584_0041421 3300046491 Bacteria 2325
192 Ga0495584_0074133 3300046491 Bacteria 1710
193 Ga0495584_0117133 3300046491 Bacteria 1348
194 Ga0495584_0151185 3300046491 Bacteria 1179
195 Ga0495584_0195377 3300046491 Bacteria 1028
196 Ga0495584_0434540 3300046491 Bacteria 667
197 Ga0495585_0000107 3300046492 Bacteria 89033
198 Ga0495585_0000318 3300046492 Bacteria 47858
199 Ga0495585_0002852 3300046492 Bacteria 12033
200 Ga0495585_0005426 3300046492 Bacteria 8041
201 Ga0495585_0057741 3300046492 Bacteria 2141
202 Ga0495585_0062405 3300046492 Bacteria 2047
203 Ga0495585_0095863 3300046492 Bacteria 1592
204 Ga0495585_0116437 3300046492 Bacteria 1417
205 Ga0495585_0125934 3300046492 Bacteria 1351
206 Ga0495585_0142005 3300046492 Bacteria 1257
207 Ga0495585_0190807 3300046492 Bacteria 1048
208 Ga0495585_0221454 3300046492 Bacteria 954
209 Ga0495585_0376833 3300046492 Bacteria 686
210 Ga0495594_0038250 3300046499 Bacteria 2620
211 Ga0495594_0051281 3300046499 Bacteria 2270
212 Ga0495594_0058079 3300046499 Bacteria 2136
213 Ga0495596_0000999 3300046500 Bacteria 16815
214 Ga0495596_0001264 3300046500 Bacteria 14651
215 Ga0495596_0002710 3300046500 Bacteria 9315
216 Ga0495596_0003800 3300046500 Bacteria 7534
217 Ga0495596_0004142 3300046500 Bacteria 7128
218 Ga0495596_0014750 3300046500 Bacteria 3288
219 Ga0495596_0015691 3300046500 Bacteria 3164
220 Ga0495596_0030866 3300046500 Bacteria 2143
221 Ga0495596_0041320 3300046500 Bacteria 1818
222 Ga0495596_0058203 3300046500 Bacteria 1507
223 Ga0495596_0083577 3300046500 Bacteria 1239
224 Ga0495596_0109703 3300046500 Bacteria 1071
225 Ga0495596_0200917 3300046500 Bacteria 774
226 Ga0495607_0001075 3300046501 Bacteria 24954
227 Ga0495607_0002737 3300046501 Bacteria 14066
228 Ga0495607_0003324 3300046501 Bacteria 12347
229 Ga0495607_0006975 3300046501 Bacteria 7867
230 Ga0495607_0007409 3300046501 Bacteria 7596
231 Ga0495607_0013706 3300046501 Bacteria 5299
232 Ga0495607_0039148 3300046501 Bacteria 2833
233 Ga0495607_0067124 3300046501 Bacteria 2016
234 Ga0495607_0132769 3300046501 Bacteria 1293
235 Ga0495583_0000191 3300046506 Bacteria 102390
236 Ga0495583_0001722 3300046506 Bacteria 21007
237 Ga0495583_0002041 3300046506 Bacteria 18382
238 Ga0495583_0018724 3300046506 Bacteria 3637
239 Ga0495583_0022880 3300046506 Bacteria 3176
240 Ga0495583_0052615 3300046506 Bacteria 1851
241 Ga0495583_0067747 3300046506 Bacteria 1576
242 Ga0495583_0073364 3300046506 Bacteria 1500
243 Ga0495583_0078109 3300046506 Bacteria 1442
244 Ga0495583_0130924 3300046506 Bacteria 1049
245 Ga0495606_0000727 3300046507 Bacteria 50923
246 Ga0495606_0019075 3300046507 Bacteria 5117
247 Ga0495606_0038716 3300046507 Bacteria 3222
248 Ga0495606_0040687 3300046507 Bacteria 3123
249 Ga0495606_0052699 3300046507 Bacteria 2644
250 Ga0495606_0053492 3300046507 Bacteria 2619
251 Ga0495606_0096385 3300046507 Bacteria 1809
252 Ga0495610_0004019 3300046512 Bacteria 11094
253 Ga0495616_0001218 3300046513 Bacteria 18122
254 Ga0495616_0009934 3300046513 Bacteria 5530
255 Ga0495616_0016205 3300046513 Bacteria 4128
256 Ga0495616_0017615 3300046513 Bacteria 3936
257 Ga0495620_0004453 3300046515 Bacteria 7894
258 Ga0495630_0129479 3300046517 Bacteria 1916
259 Ga0495631_0000313 3300046518 Bacteria 33611
260 Ga0495631_0005272 3300046518 Bacteria 6793
261 Ga0495631_0005704 3300046518 Bacteria 6492
262 Ga0495631_0006913 3300046518 Bacteria 5816
263 Ga0495631_0013570 3300046518 Bacteria 3952
264 Ga0495631_0017000 3300046518 Bacteria 3450
265 Ga0495631_0018785 3300046518 Bacteria 3250
266 Ga0495631_0022714 3300046518 Bacteria 2915
267 Ga0495631_0158379 3300046518 Bacteria 971
268 Ga0495631_0211287 3300046518 Bacteria 829
269 Ga0495632_0000090 3300046519 Bacteria 93838
270 Ga0495632_0000107 3300046519 Bacteria 85396
271 Ga0495632_0005534 3300046519 Bacteria 8328
272 Ga0495632_0013789 3300046519 Bacteria 4596
273 Ga0495632_0014585 3300046519 Bacteria 4439
274 Ga0495632_0018673 3300046519 Bacteria 3799
275 Ga0495632_0035312 3300046519 Bacteria 2552
276 Ga0495632_0105381 3300046519 Bacteria 1327
277 Ga0495637_0000536 3300046520 Bacteria 27298
278 Ga0495637_0013812 3300046520 Bacteria 3825
279 Ga0495643_0007245 3300046522 Bacteria 7186
280 Ga0495643_0012486 3300046522 Bacteria 5124
281 Ga0495643_0015173 3300046522 Bacteria 4561
282 Ga0495643_0028935 3300046522 Bacteria 3102
283 Ga0495643_0031731 3300046522 Bacteria 2937
284 Ga0495643_0039581 3300046522 Bacteria 2577
285 Ga0495643_0108946 3300046522 Bacteria 1410
286 Ga0495643_0141116 3300046522 Bacteria 1201
287 Ga0495644_0006768 3300046523 Bacteria 4440
288 Ga0495644_0011210 3300046523 Bacteria 3455
289 Ga0495644_0011319 3300046523 Bacteria 3435
290 Ga0495644_0024286 3300046523 Bacteria 2305
291 Ga0495644_0034517 3300046523 Bacteria 1909
292 Ga0495644_0089119 3300046523 Bacteria 1164
293 Ga0495648_0005153 3300046524 Bacteria 10931
294 Ga0495648_0022563 3300046524 Bacteria 4330
295 Ga0495648_0035935 3300046524 Bacteria 3206
296 Ga0495648_0044707 3300046524 Bacteria 2762
297 Ga0495648_0047226 3300046524 Bacteria 2662
298 Ga0495648_0056934 3300046524 Bacteria 2348
299 Ga0495648_0167381 3300046524 Bacteria 1130
300 Ga0495648_0363962 3300046524 Bacteria 657
301 Ga0495666_0004086 3300046526 Bacteria 7373
302 Ga0495666_0007221 3300046526 Bacteria 5574
303 Ga0495642_0002985 3300046528 Bacteria 6744
304 Ga0495642_0003081 3300046528 Bacteria 6629
305 Ga0495642_0004853 3300046528 Bacteria 5198
306 Ga0495642_0014174 3300046528 Bacteria 3089
307 Ga0495642_0042267 3300046528 Bacteria 1856
308 Ga0495642_0045006 3300046528 Bacteria 1803
309 Ga0495642_0060762 3300046528 Bacteria 1567
310 Ga0495642_0104933 3300046528 Bacteria 1205
311 Ga0495642_0211816 3300046528 Bacteria 845
312 Ga0495652_0013176 3300046529 Bacteria 7444
313 Ga0495654_0009148 3300046530 Bacteria 5432
314 Ga0495654_0031569 3300046530 Bacteria 2689
315 Ga0495654_0085747 3300046530 Bacteria 1469
316 Ga0495654_0118971 3300046530 Bacteria 1197
317 Ga0495665_0015373 3300046531 Bacteria 4122
318 Ga0495665_0120480 3300046531 Bacteria 1374
319 Ga0495640_0031933 3300046533 Bacteria 3755
320 Ga0495640_0262879 3300046533 Bacteria 1078
321 Ga0495586_0006267 3300046535 Bacteria 6355
322 Ga0495586_0040145 3300046535 Bacteria 2516
323 Ga0495586_0269988 3300046535 Bacteria 972
324 Ga0495609_0000026 3300046538 Bacteria 251973
325 Ga0495609_0001130 3300046538 Bacteria 18463
326 Ga0495609_0003169 3300046538 Bacteria 9577
327 Ga0495609_0022505 3300046538 Bacteria 2902
328 Ga0495609_0027901 3300046538 Bacteria 2578
329 Ga0495597_0001806 3300046542 Bacteria 14660
330 Ga0495597_0001896 3300046542 Bacteria 14234
331 Ga0495597_0005414 3300046542 Bacteria 6757
332 Ga0495597_0014682 3300046542 Bacteria 3725
333 Ga0495597_0016808 3300046542 Bacteria 3452
334 Ga0495597_0141298 3300046542 Bacteria 993
335 Ga0495645_0030866 3300046543 Bacteria 3904
336 Ga0495622_0049112 3300046557 Bacteria 1959
337 Ga0495622_0053013 3300046557 Bacteria 1882
338 Ga0495633_0004711 3300046558 Bacteria 8574
339 Ga0495633_0007543 3300046558 Bacteria 6245
340 Ga0495633_0008961 3300046558 Bacteria 5574
341 Ga0495633_0021923 3300046558 Bacteria 3188
342 Ga0495633_0027092 3300046558 Bacteria 2804
343 Ga0495633_0129192 3300046558 Bacteria 1169
344 Ga0495656_0019235 3300046615 Bacteria 2634
345 Ga0495656_0033291 3300046615 Bacteria 2103
346 Ga0495656_0179029 3300046615 Bacteria 1041
347 Ga0495668_0001131 3300046616 Bacteria 27355
348 Ga0495668_0002349 3300046616 Bacteria 15742
349 Ga0495668_0003307 3300046616 Bacteria 12194
350 Ga0495668_0030253 3300046616 Bacteria 3058
351 Ga0495668_0030329 3300046616 Bacteria 3053
352 Ga0495668_0047415 3300046616 Bacteria 2386
353 Ga0495668_0054641 3300046616 Bacteria 2206
354 Ga0495668_0059320 3300046616 Bacteria 2111
355 Ga0495668_0142170 3300046616 Bacteria 1313
356 Ga0495668_0429734 3300046616 Bacteria 726
357 Ga0495634_0002131 3300046642 Bacteria 16684
358 Ga0495611_0000597 3300046648 Bacteria 20827
359 Ga0495611_0000676 3300046648 Bacteria 19441
360 Ga0495611_0003635 3300046648 Bacteria 6756
361 Ga0495611_0007056 3300046648 Bacteria 4770
362 Ga0495611_0055746 3300046648 Bacteria 1788
363 Ga0495625_0003033 3300046660 Bacteria 17226
364 Ga0495625_0200281 3300046660 Bacteria 1318
365 Ga0495635_0004992 3300046663 Bacteria 9234
366 Ga0495635_0153657 3300046663 Bacteria 1567
367 Ga0495659_0070226 3300046664 Bacteria 1311
368 Ga0495661_0000913 3300046665 Bacteria 27093
369 Ga0495661_0000917 3300046665 Bacteria 27026
370 Ga0495661_0003443 3300046665 Bacteria 11680
371 Ga0495661_0007403 3300046665 Bacteria 7650
372 Ga0495661_0009367 3300046665 Bacteria 6722
373 Ga0495661_0011394 3300046665 Bacteria 6035
374 Ga0495661_0035230 3300046665 Bacteria 3142
375 Ga0495661_0039774 3300046665 Bacteria 2920
376 Ga0495661_0045700 3300046665 Bacteria 2676
377 Ga0495661_0065353 3300046665 Bacteria 2143
378 Ga0495661_0070425 3300046665 Bacteria 2046
379 Ga0495661_0073710 3300046665 Bacteria 1988
380 Ga0495661_0122670 3300046665 Bacteria 1433
381 Ga0495661_0125159 3300046665 Bacteria 1415
382 Ga0495661_0156559 3300046665 Bacteria 1226
383 Ga0495661_0183852 3300046665 Bacteria 1106
384 Ga0495661_0196901 3300046665 Bacteria 1057
385 Ga0495661_0225879 3300046665 Bacteria 967
386 Ga0495588_0001260 3300046674 Bacteria 10861
387 Ga0495588_0005109 3300046674 Bacteria 5831
388 Ga0495588_0022548 3300046674 Bacteria 3112
389 Ga0495588_0123366 3300046674 Bacteria 1366
390 Ga0495588_0226226 3300046674 Bacteria 987
391 Ga0495646_0124171 3300046680 Bacteria 1459
392 Ga0495669_0000677 3300046684 Bacteria 14816
393 Ga0495669_0029265 3300046684 Bacteria 2415
394 Ga0495669_0048539 3300046684 Bacteria 1899
395 Ga0495669_0059292 3300046684 Bacteria 1728
396 Ga0495613_0018184 3300046689 Bacteria 5240
397 Ga0495613_0032941 3300046689 Bacteria 3850
398 Ga0495624_0112096 3300046690 Bacteria 1677
399 Ga0495670_0000164 3300046691 Bacteria 29058
400 Ga0495670_0000713 3300046691 Bacteria 15834
401 Ga0495670_0001557 3300046691 Bacteria 11211
402 Ga0495670_0005544 3300046691 Bacteria 6192
403 Ga0495670_0013188 3300046691 Bacteria 4064
404 Ga0495670_0023631 3300046691 Bacteria 3034
405 Ga0495671_0001727 3300046692 Bacteria 14178
406 Ga0495671_0033421 3300046692 Bacteria 2620
407 Ga0495649_0000093 3300046694 Bacteria 77036
408 Ga0495649_0001214 3300046694 Bacteria 19895
409 Ga0495649_0007724 3300046694 Bacteria 6531
410 Ga0495649_0068361 3300046694 Bacteria 1906
411 Ga0495649_0108945 3300046694 Bacteria 1469
412 Ga0495649_0113581 3300046694 Bacteria 1435
413 Ga0495589_0000182 3300046794 Bacteria 55624
414 Ga0495589_0000337 3300046794 Bacteria 36745
415 Ga0495589_0000462 3300046794 Bacteria 29692
416 Ga0495589_0025656 3300046794 Bacteria 2990
417 Ga0495589_0026838 3300046794 Bacteria 2916
418 Ga0495589_0032369 3300046794 Bacteria 2629
419 Ga0495589_0032519 3300046794 Bacteria 2622
420 Ga0495589_0037030 3300046794 Bacteria 2444
421 Ga0495589_0045901 3300046794 Bacteria 2169
422 Ga0495589_0059974 3300046794 Bacteria 1869
423 Ga0495589_0245443 3300046794 Bacteria 837
424 Ga0495600_0007314 3300046809 Bacteria 6747
425 Ga0495660_0000085 3300046810 Bacteria 100369
426 Ga0495660_0014179 3300046810 Bacteria 4616
427 Ga0495660_0032124 3300046810 Bacteria 2948
428 Ga0495660_0035214 3300046810 Bacteria 2798
429 Ga0495660_0068726 3300046810 Bacteria 1884
430 Ga0495660_0269427 3300046810 Bacteria 783
431 Ga0495581_0005128 3300047315 Bacteria 7582
432 Ga0495604_0038325 3300047317 Bacteria 3771
433 Ga0495604_0099552 3300047317 Bacteria 2139
434 Ga0495672_0000217 3300047320 Bacteria 82349
435 Ga0495672_0004417 3300047320 Bacteria 11528
436 Ga0495672_0004784 3300047320 Bacteria 10918
437 Ga0495672_0006684 3300047320 Bacteria 8857
438 Ga0495672_0020932 3300047320 Bacteria 4275
439 Ga0495672_0025490 3300047320 Bacteria 3784
440 Ga0495672_0074406 3300047320 Bacteria 1913
441 Ga0495676_0000082 3300047321 Bacteria 68690
442 Ga0495676_0082849 3300047321 Bacteria 2426
443 Ga0495680_0013604 3300047322 Bacteria 7089
444 Ga0495683_0000662 3300047323 Bacteria 25479
445 Ga0495683_0005975 3300047323 Bacteria 6686
446 Ga0495683_0006170 3300047323 Bacteria 6570
447 Ga0495683_0012552 3300047323 Bacteria 4447
448 Ga0495683_0025122 3300047323 Bacteria 3055
449 Ga0495683_0049352 3300047323 Bacteria 2108
450 Ga0495683_0086873 3300047323 Bacteria 1519
451 Ga0495687_000037 3300047443 Bacteria 252363
452 Ga0495687_000155 3300047443 Bacteria 104610
453 Ga0495687_000530 3300047443 Bacteria 45616
454 Ga0495687_001978 3300047443 Bacteria 17476
455 Ga0495687_004394 3300047443 Bacteria 9559
456 Ga0495687_155749 3300047443 Bacteria 775
457 Ga0495675_0013093 3300047444 Bacteria 5232
458 Ga0495675_0045785 3300047444 Bacteria 2786
459 Ga0495675_0536522 3300047444 Bacteria 668
460 Ga0495677_0000130 3300047445 Bacteria 36684
461 Ga0495677_0000675 3300047445 Bacteria 13807
462 Ga0495677_0001090 3300047445 Bacteria 10882
463 Ga0495677_0002009 3300047445 Bacteria 8117
464 Ga0495677_0002840 3300047445 Bacteria 6749
465 Ga0495677_0003976 3300047445 Bacteria 5713
466 Ga0495677_0005200 3300047445 Bacteria 4950
467 Ga0495677_0022907 3300047445 Bacteria 2267
468 Ga0495677_0027129 3300047445 Bacteria 2077
469 Ga0495677_0043560 3300047445 Bacteria 1645
470 Ga0495677_0045354 3300047445 Bacteria 1612
471 Ga0495677_0116625 3300047445 Bacteria 1017
472 Ga0495679_003055 3300047446 Bacteria 8223
473 Ga0495679_006054 3300047446 Bacteria 5281
474 Ga0495679_016265 3300047446 Bacteria 2695
475 Ga0495679_017419 3300047446 Bacteria 2571
476 Ga0495679_033135 3300047446 Bacteria 1652
477 Ga0495679_078965 3300047446 Bacteria 937
478 Ga0495685_007325 3300047447 Bacteria 3640
479 Ga0495685_227553 3300047447 Bacteria 594
480 Ga0495673_0043353 3300047469 Bacteria 2014
481 Ga0495681_0000363 3300047470 Bacteria 35486
482 Ga0495681_0000431 3300047470 Bacteria 32175
483 Ga0495681_0003283 3300047470 Bacteria 11278
484 Ga0495681_0011068 3300047470 Bacteria 5407
485 Ga0495681_0018326 3300047470 Bacteria 3860
486 Ga0495681_0020550 3300047470 Bacteria 3581
487 Ga0495681_0032245 3300047470 Bacteria 2640
488 Ga0495681_0070814 3300047470 Bacteria 1580
489 Ga0495681_0097171 3300047470 Bacteria 1292
490 Ga0495681_0128053 3300047470 Bacteria 1083
491 Ga0495686_0000142 3300047472 Bacteria 143655
492 Ga0495686_0233075 3300047472 Bacteria 1041
493 Ga0495593_0016058 3300047673 Bacteria 4227
494 Ga0495602_0175736 3300048088 Bacteria 1657
495 Ga0495614_0000278 3300048089 Bacteria 20125
496 Ga0495614_0008680 3300048089 Bacteria 4519
497 Ga0495626_0000078 3300048091 Bacteria 130020
498 Ga0495626_0000327 3300048091 Bacteria 50207
499 Ga0495626_0001405 3300048091 Bacteria 19255
500 Ga0495626_0003726 3300048091 Bacteria 9629
501 Ga0495626_0003776 3300048091 Bacteria 9530
502 Ga0495626_0004091 3300048091 Bacteria 9071
503 Ga0495626_0010254 3300048091 Bacteria 5015
504 Ga0495626_0012718 3300048091 Bacteria 4401
505 Ga0495626_0013206 3300048091 Bacteria 4298
506 Ga0495626_0028756 3300048091 Bacteria 2691
507 Ga0495626_0041682 3300048091 Bacteria 2160
508 Ga0495626_0054744 3300048091 Bacteria 1831
509 Ga0495626_0066438 3300048091 Bacteria 1630
510 Ga0495626_0081137 3300048091 Bacteria 1440
511 Ga0495626_0093868 3300048091 Bacteria 1316
512 Ga0496100_0029294 3300048903 Bacteria 3403
513 Ga0496102_0105931 3300048905 Bacteria 2616
514 Ga0496102_0775706 3300048905 Bacteria 881
515 Ga0496102_1121944 3300048905 Bacteria 706
516 Ga0496103_0162903 3300048906 Bacteria 1431
517 Ga0496106_0292393 3300048909 Bacteria 1306
518 Ga0496107_0087227 3300048910 Bacteria 2278
519 Ga0496108_0091439 3300048911 Bacteria 2587
520 Ga0496109_0177884 3300048912 Bacteria 1997
521 Ga0496109_0357107 3300048912 Bacteria 1381
522 Ga0496109_0867960 3300048912 Bacteria 840
523 Ga0496110_0002266 3300048913 Bacteria 14368
524 Ga0496110_0635177 3300048913 Bacteria 967
525 Ga0496110_0708350 3300048913 Bacteria 908
526 Ga0496110_1241865 3300048913 Bacteria 654
527 Ga0496111_0061874 3300048914 Bacteria 2714
528 Ga0496111_0284392 3300048914 Bacteria 1227
529 Ga0496112_0066210 3300048915 Bacteria 3565
530 Ga0496113_0010385 3300048916 Bacteria 6154
531 Ga0496113_0019662 3300048916 Bacteria 4730
532 Ga0496115_0044126 3300048918 Bacteria 3555
533 Ga0496115_0094361 3300048918 Bacteria 2448
534 Ga0496122_0000740 3300048925 Bacteria 63678
535 Ga0496122_0002477 3300048925 Bacteria 26088
536 Ga0496123_0004015 3300048926 Bacteria 15906
537 Ga0496123_0008100 3300048926 Bacteria 9718
538 Ga0496124_0016398 3300048927 Bacteria 7046
539 Ga0496124_0089683 3300048927 Bacteria 2510
540 Ga0496124_0125852 3300048927 Bacteria 2042
541 Ga0496124_0325768 3300048927 Bacteria 1098
542 Ga0496125_0010600 3300048928 Bacteria 9311
543 Ga0496125_0106376 3300048928 Bacteria 2048
544 Ga0496125_0295164 3300048928 Bacteria 996
545 Ga0495678_000163 3300049459 Bacteria 78292
546 Ga0495678_000172 3300049459 Bacteria 75395
547 Ga0495678_000457 3300049459 Bacteria 40543
548 Ga0495678_079793 3300049459 Bacteria 1178
549 Ga0495682_0000292 3300049460 Bacteria 38485
550 Ga0495682_0075275 3300049460 Bacteria 1214
551 Ga0495682_0187450 3300049460 Bacteria 735
552 Ga0501031_0020131 3300049568 Bacteria 4349
553 Ga0501034_0037485 3300049571 Bacteria 4910
554 Ga0501035_0002946 3300049822 Bacteria 16379
555 Ga0501044_1103626 3300049823 Bacteria 662
556 nmdc:mga0n895_288431_c1 3300050512 Bacteria 1664
557 nmdc:mga0rr50_211430_c1 3300050513 Bacteria 1598
558 nmdc:mga0rr50_33835_c1 3300050513 Bacteria 3654
559 nmdc:mga08x19_2372_c2 3300050514 Bacteria 4140
560 Ga0587082_014536 3300059504 Bacteria 1202
561 Ga0587083_0003425 3300059505 Bacteria 2102
562 Ga0587083_0013567 3300059505 Bacteria 1389
563 Ga0587083_0168902 3300059505 Bacteria 604
564 Ga0587088_023975 3300059508 Bacteria 1042
565 Ga0587089_059522 3300059509 Bacteria 629
566 Ga0587090_074878 3300059510 Bacteria 668
567 Ga0587091_038467 3300059511 Bacteria 933
568 Ga0587091_041091 3300059511 Bacteria 912
569 Ga0587091_075285 3300059511 Bacteria 747
570 Ga0587098_040526 3300059604 Bacteria 676
571 Ga0587098_046134 3300059604 Bacteria 648
572 Ga0587106_096988 3300059605 Bacteria 597
573 Ga0587099_037786 3300059622 Bacteria 609
574 Ga0587067_006889 3300059640 Bacteria 1604
575 Ga0587068_003650 3300059641 Bacteria 1987
576 Ga0587069_007459 3300059642 Bacteria 1352
577 Ga0587072_006722 3300059643 Bacteria 1762
578 Ga0587072_008854 3300059643 Bacteria 1600
579 Ga0587072_049857 3300059643 Bacteria 836
580 Ga0587072_061090 3300059643 Bacteria 776
581 Ga0587075_018178 3300059644 Bacteria 1018
582 Ga0587075_030472 3300059644 Bacteria 856
583 Ga0587076_010073 3300059645 Bacteria 1357
584 Ga0587079_005324 3300059647 Bacteria 1812
585 Ga0587079_015687 3300059647 Bacteria 1291
586 Ga0587102_037521 3300059649 Bacteria 615
587 Ga0587107_026609 3300059652 Bacteria 850
588 Ga0466962_0092792 3300061719 Bacteria 1447
589 2809142265 2808606418 Bacteria 6724496
590 Ga0070679_100457202
591 Ga0055525_1000074
592 Ga0065165_1001586
593 Ga0070658_10103799
594 Ga0070658_10158592
595 Ga0070658_10483739
596 Ga0070683_100009996
597 Ga0070683_100964717
598 Ga0070660_100033746
599 Ga0070659_100119752
600 Ga0070714_100095483
601 Ga0070714_101200832
602 Ga0070713_100289629
603 Ga0070681_10446533
604 Ga0070681_10537673
605 Ga0070684_100026020
606 Ga0070684_100123326
607 Ga0068853_100017722
608 Ga0068855_100006551
609 Ga0068855_100021511
610 Ga0068855_100057110
611 Ga0068855_100306641
612 Ga0068855_100633401
613 Ga0070664_100172789
614 Ga0070664_100859405
615 Ga0068857_100096569
616 Ga0068856_100009695
617 Ga0068852_100237673
618 Ga0075435_100095868
619 Ga0075435_100272442
620 Ga0105240_10043451
621 Ga0105240_10063077
622 Ga0105240_10371434
623 Ga0105245_10468401
624 Ga0105241_10018687
625 Ga0105242_10152072
626 Ga0105242_10200743
627 Ga0105237_10476329
628 Ga0105238_10017600
629 Ga0105238_10417029
630 Ga0105239_10325088
631 Ga0157370_10775858
632 Ga0157369_10002199
633 Ga0157374_10002400
634 Ga0157374_10402728
635 Ga0157378_10971419
636 Ga0163162_11249589
637 Ga0157372_10001977
638 Ga0157372_10173602
639 Ga0157376_11362567
640 Ga0206351_10282115
641 Ga0206350_10830367
642 Ga0206354_10615528
643 Ga0224712_10364861
644 Ga0224712_10458244
645 Ga0224712_10462760
646 Ga0256720_128494
647 Ga0209563_100003
648 Ga0209677_102572
649 Ga0209148_1001147
650 Ga0207705_10017656
651 Ga0207705_10025236
652 Ga0207654_10016799
653 Ga0207707_10373506
654 Ga0207695_10094143
655 Ga0207695_10126405
656 Ga0207657_10003340
657 Ga0207657_10134593
658 Ga0207649_10104966
659 Ga0207652_10401977
660 Ga0207694_10220914
661 Ga0207694_10541039
662 Ga0207687_10368302
663 Ga0207700_10627388
664 Ga0207664_10123434
665 Ga0207690_10014816
666 Ga0207690_10397985
667 Ga0207686_10117439
668 Ga0207661_10016407
669 Ga0207661_10882991
670 Ga0207679_10107358
671 Ga0207667_10018055
672 Ga0207667_10081087
673 Ga0207667_10120269
674 Ga0207639_10899048
675 Ga0207678_10452597
676 Ga0207702_10006475
677 Ga0207674_10066829
678 Ga0207698_10002998
679 Ga0307508_10000069
680 Ga0307518_10115065
681 Ga0395899_0007727
682 Ga0395899_0009068
683 Ga0395899_0050353
684 Ga0395899_0078821
685 Ga0395899_0085071
686 Ga0395899_0295185
687 Ga0395900_0000338
688 Ga0395900_0013761
689 Ga0395900_0021172
690 Ga0395900_0022377
691 Ga0395900_0061625
692 Ga0395900_0071860
693 Ga0395900_0073158
694 Ga0395900_0153135
695 Ga0395900_0339857
696 Ga0395898_0013421
697 Ga0395898_0036327
698 Ga0395898_0151963
699 Ga0395898_0207106
700 Ga0395898_0502193
701 Ga0395898_0997179
702 Ga0395905_0012527
703 Ga0395905_0020855
704 Ga0395905_0077228
705 Ga0395905_0249682
706 Ga0395905_0366097
707 Ga0395905_0679594
708 Ga0395901_0001241
709 Ga0395901_0012316
710 Ga0395901_0067924
711 Ga0395901_0347026
712 Ga0395901_0486921
713 Ga0439448_0135363
714 Ga0439450_059229
715 Ga0439458_0020400
716 Ga0466972_0011790
717 Ga0453683_0091570
718 Ga0466965_0008545
719 Ga0466965_0010717
720 Ga0466965_0036944
721 Ga0466965_0120522
722 Ga0466966_0004652
723 Ga0466966_0008966
724 Ga0466966_0036425
725 Ga0466966_0228287
726 Ga0466966_0266204
727 Ga0466961_0149214
728 Ga0466961_0183581
729 Ga0466964_0005924
730 Ga0466964_0027805
731 Ga0466964_0275610
732 Ga0453684_0319015
733 Ga0466971_0081702
734 Ga0466968_0001147
735 Ga0466970_0420410
736 Ga0466957_0000022
737 Ga0466957_0002796
738 Ga0466957_0054332
739 Ga0466957_0478003
740 Ga0466960_0031427
741 Ga0466959_0136129
742 Ga0466959_0138491
743 Ga0466959_0154249
744 Ga0466959_0228870
745 Ga0451576_0365138
746 Ga0466958_0024788
747 Ga0466958_0028816
748 Ga0466958_0195857
749 Ga0466958_0394302
750 Ga0466967_0173125
751 Ga0495617_025100
752 Ga0495627_005200
753 Ga0495627_009701
754 Ga0495603_0011758
755 Ga0495590_0000070
756 Ga0495590_0000180
757 Ga0495591_000814
758 Ga0495591_011827
759 Ga0495629_0057186
760 Ga0495638_0020495
761 Ga0495653_0026020
762 Ga0495650_0006806
763 Ga0495582_0000647
764 Ga0495582_0012372
765 Ga0495605_0000408
766 Ga0495605_0004465
767 Ga0495605_0007843
768 Ga0495605_0016520
769 Ga0495605_0020960
770 Ga0495605_0039174
771 Ga0495605_0098894
772 Ga0495639_0037555
773 Ga0495584_0001552
774 Ga0495584_0001829
775 Ga0495584_0004823
776 Ga0495584_0008969
777 Ga0495584_0010689
778 Ga0495584_0026932
779 Ga0495584_0028000
780 Ga0495584_0041421
781 Ga0495584_0074133
782 Ga0495584_0117133
783 Ga0495584_0151185
784 Ga0495584_0195377
785 Ga0495584_0434540
786 Ga0495585_0000107
787 Ga0495585_0000318
788 Ga0495585_0002852
789 Ga0495585_0005426
790 Ga0495585_0057741
791 Ga0495585_0062405
792 Ga0495585_0095863
793 Ga0495585_0116437
794 Ga0495585_0125934
795 Ga0495585_0142005
796 Ga0495585_0190807
797 Ga0495585_0221454
798 Ga0495585_0376833
799 Ga0495594_0038250
800 Ga0495594_0051281
801 Ga0495594_0058079
802 Ga0495596_0000999
803 Ga0495596_0001264
804 Ga0495596_0002710
805 Ga0495596_0003800
806 Ga0495596_0004142
807 Ga0495596_0014750
808 Ga0495596_0015691
809 Ga0495596_0030866
810 Ga0495596_0041320
811 Ga0495596_0058203
812 Ga0495596_0083577
813 Ga0495596_0109703
814 Ga0495596_0200917
815 Ga0495607_0001075
816 Ga0495607_0002737
817 Ga0495607_0003324
818 Ga0495607_0006975
819 Ga0495607_0007409
820 Ga0495607_0013706
821 Ga0495607_0039148
822 Ga0495607_0067124
823 Ga0495607_0132769
824 Ga0495583_0000191
825 Ga0495583_0001722
826 Ga0495583_0002041
827 Ga0495583_0018724
828 Ga0495583_0022880
829 Ga0495583_0052615
830 Ga0495583_0067747
831 Ga0495583_0073364
832 Ga0495583_0078109
833 Ga0495583_0130924
834 Ga0495606_0000727
835 Ga0495606_0019075
836 Ga0495606_0038716
837 Ga0495606_0040687
838 Ga0495606_0052699
839 Ga0495606_0053492
840 Ga0495606_0096385
841 Ga0495610_0004019
842 Ga0495616_0001218
843 Ga0495616_0009934
844 Ga0495616_0016205
845 Ga0495616_0017615
846 Ga0495620_0004453
847 Ga0495630_0129479
848 Ga0495631_0000313
849 Ga0495631_0005272
850 Ga0495631_0005704
851 Ga0495631_0006913
852 Ga0495631_0013570
853 Ga0495631_0017000
854 Ga0495631_0018785
855 Ga0495631_0022714
856 Ga0495631_0158379
857 Ga0495631_0211287
858 Ga0495632_0000090
859 Ga0495632_0000107
860 Ga0495632_0005534
861 Ga0495632_0013789
862 Ga0495632_0014585
863 Ga0495632_0018673
864 Ga0495632_0035312
865 Ga0495632_0105381
866 Ga0495637_0000536
867 Ga0495637_0013812
868 Ga0495643_0007245
869 Ga0495643_0012486
870 Ga0495643_0015173
871 Ga0495643_0028935
872 Ga0495643_0031731
873 Ga0495643_0039581
874 Ga0495643_0108946
875 Ga0495643_0141116
876 Ga0495644_0006768
877 Ga0495644_0011210
878 Ga0495644_0011319
879 Ga0495644_0024286
880 Ga0495644_0034517
881 Ga0495644_0089119
882 Ga0495648_0005153
883 Ga0495648_0022563
884 Ga0495648_0035935
885 Ga0495648_0044707
886 Ga0495648_0047226
887 Ga0495648_0056934
888 Ga0495648_0167381
889 Ga0495648_0363962
890 Ga0495666_0004086
891 Ga0495666_0007221
892 Ga0495642_0002985
893 Ga0495642_0003081
894 Ga0495642_0004853
895 Ga0495642_0014174
896 Ga0495642_0042267
897 Ga0495642_0045006
898 Ga0495642_0060762
899 Ga0495642_0104933
900 Ga0495642_0211816
901 Ga0495652_0013176
902 Ga0495654_0009148
903 Ga0495654_0031569
904 Ga0495654_0085747
905 Ga0495654_0118971
906 Ga0495665_0015373
907 Ga0495665_0120480
908 Ga0495640_0031933
909 Ga0495640_0262879
910 Ga0495586_0006267
911 Ga0495586_0040145
912 Ga0495586_0269988
913 Ga0495609_0000026
914 Ga0495609_0001130
915 Ga0495609_0003169
916 Ga0495609_0022505
917 Ga0495609_0027901
918 Ga0495597_0001806
919 Ga0495597_0001896
920 Ga0495597_0005414
921 Ga0495597_0014682
922 Ga0495597_0016808
923 Ga0495597_0141298
924 Ga0495645_0030866
925 Ga0495622_0049112
926 Ga0495622_0053013
927 Ga0495633_0004711
928 Ga0495633_0007543
929 Ga0495633_0008961
930 Ga0495633_0021923
931 Ga0495633_0027092
932 Ga0495633_0129192
933 Ga0495656_0019235
934 Ga0495656_0033291
935 Ga0495656_0179029
936 Ga0495668_0001131
937 Ga0495668_0002349
938 Ga0495668_0003307
939 Ga0495668_0030253
940 Ga0495668_0030329
941 Ga0495668_0047415
942 Ga0495668_0054641
943 Ga0495668_0059320
944 Ga0495668_0142170
945 Ga0495668_0429734
946 Ga0495634_0002131
947 Ga0495611_0000597
948 Ga0495611_0000676
949 Ga0495611_0003635
950 Ga0495611_0007056
951 Ga0495611_0055746
952 Ga0495625_0003033
953 Ga0495625_0200281
954 Ga0495635_0004992
955 Ga0495635_0153657
956 Ga0495659_0070226
957 Ga0495661_0000913
958 Ga0495661_0000917
959 Ga0495661_0003443
960 Ga0495661_0007403
961 Ga0495661_0009367
962 Ga0495661_0011394
963 Ga0495661_0035230
964 Ga0495661_0039774
965 Ga0495661_0045700
966 Ga0495661_0065353
967 Ga0495661_0070425
968 Ga0495661_0073710
969 Ga0495661_0122670
970 Ga0495661_0125159
971 Ga0495661_0156559
972 Ga0495661_0183852
973 Ga0495661_0196901
974 Ga0495661_0225879
975 Ga0495588_0001260
976 Ga0495588_0005109
977 Ga0495588_0022548
978 Ga0495588_0123366
979 Ga0495588_0226226
980 Ga0495646_0124171
981 Ga0495669_0000677
982 Ga0495669_0029265
983 Ga0495669_0048539
984 Ga0495669_0059292
985 Ga0495613_0018184
986 Ga0495613_0032941
987 Ga0495624_0112096
988 Ga0495670_0000164
989 Ga0495670_0000713
990 Ga0495670_0001557
991 Ga0495670_0005544
992 Ga0495670_0013188
993 Ga0495670_0023631
994 Ga0495671_0001727
995 Ga0495671_0033421
996 Ga0495649_0000093
997 Ga0495649_0001214
998 Ga0495649_0007724
999 Ga0495649_0068361
1000 Ga0495649_0108945
1001 Ga0495649_0113581
1002 Ga0495589_0000182
1003 Ga0495589_0000337
1004 Ga0495589_0000462
1005 Ga0495589_0025656
1006 Ga0495589_0026838
1007 Ga0495589_0032369
1008 Ga0495589_0032519
1009 Ga0495589_0037030
1010 Ga0495589_0045901
1011 Ga0495589_0059974
1012 Ga0495589_0245443
1013 Ga0495600_0007314
1014 Ga0495660_0000085
1015 Ga0495660_0014179
1016 Ga0495660_0032124
1017 Ga0495660_0035214
1018 Ga0495660_0068726
1019 Ga0495660_0269427
1020 Ga0495581_0005128
1021 Ga0495604_0038325
1022 Ga0495604_0099552
1023 Ga0495672_0000217
1024 Ga0495672_0004417
1025 Ga0495672_0004784
1026 Ga0495672_0006684
1027 Ga0495672_0020932
1028 Ga0495672_0025490
1029 Ga0495672_0074406
1030 Ga0495676_0000082
1031 Ga0495676_0082849
1032 Ga0495680_0013604
1033 Ga0495683_0000662
1034 Ga0495683_0005975
1035 Ga0495683_0006170
1036 Ga0495683_0012552
1037 Ga0495683_0025122
1038 Ga0495683_0049352
1039 Ga0495683_0086873
1040 Ga0495687_000037
1041 Ga0495687_000155
1042 Ga0495687_000530
1043 Ga0495687_001978
1044 Ga0495687_004394
1045 Ga0495687_155749
1046 Ga0495675_0013093
1047 Ga0495675_0045785
1048 Ga0495675_0536522
1049 Ga0495677_0000130
1050 Ga0495677_0000675
1051 Ga0495677_0001090
1052 Ga0495677_0002009
1053 Ga0495677_0002840
1054 Ga0495677_0003976
1055 Ga0495677_0005200
1056 Ga0495677_0022907
1057 Ga0495677_0027129
1058 Ga0495677_0043560
1059 Ga0495677_0045354
1060 Ga0495677_0116625
1061 Ga0495679_003055
1062 Ga0495679_006054
1063 Ga0495679_016265
1064 Ga0495679_017419
1065 Ga0495679_033135
1066 Ga0495679_078965
1067 Ga0495685_007325
1068 Ga0495685_227553
1069 Ga0495673_0043353
1070 Ga0495681_0000363
1071 Ga0495681_0000431
1072 Ga0495681_0003283
1073 Ga0495681_0011068
1074 Ga0495681_0018326
1075 Ga0495681_0020550
1076 Ga0495681_0032245
1077 Ga0495681_0070814
1078 Ga0495681_0097171
1079 Ga0495681_0128053
1080 Ga0495686_0000142
1081 Ga0495686_0233075
1082 Ga0495593_0016058
1083 Ga0495602_0175736
1084 Ga0495614_0000278
1085 Ga0495614_0008680
1086 Ga0495626_0000078
1087 Ga0495626_0000327
1088 Ga0495626_0001405
1089 Ga0495626_0003726
1090 Ga0495626_0003776
1091 Ga0495626_0004091
1092 Ga0495626_0010254
1093 Ga0495626_0012718
1094 Ga0495626_0013206
1095 Ga0495626_0028756
1096 Ga0495626_0041682
1097 Ga0495626_0054744
1098 Ga0495626_0066438
1099 Ga0495626_0081137
1100 Ga0495626_0093868
1101 Ga0496100_0029294
1102 Ga0496102_0105931
1103 Ga0496102_0775706
1104 Ga0496102_1121944
1105 Ga0496103_0162903
1106 Ga0496106_0292393
1107 Ga0496107_0087227
1108 Ga0496108_0091439
1109 Ga0496109_0177884
1110 Ga0496109_0357107
1111 Ga0496109_0867960
1112 Ga0496110_0002266
1113 Ga0496110_0635177
1114 Ga0496110_0708350
1115 Ga0496110_1241865
1116 Ga0496111_0061874
1117 Ga0496111_0284392
1118 Ga0496112_0066210
1119 Ga0496113_0010385
1120 Ga0496113_0019662
1121 Ga0496115_0044126
1122 Ga0496115_0094361
1123 Ga0496122_0000740
1124 Ga0496122_0002477
1125 Ga0496123_0004015
1126 Ga0496123_0008100
1127 Ga0496124_0016398
1128 Ga0496124_0089683
1129 Ga0496124_0125852
1130 Ga0496124_0325768
1131 Ga0496125_0010600
1132 Ga0496125_0106376
1133 Ga0496125_0295164
1134 Ga0495678_000163
1135 Ga0495678_000172
1136 Ga0495678_000457
1137 Ga0495678_079793
1138 Ga0495682_0000292
1139 Ga0495682_0075275
1140 Ga0495682_0187450
1141 Ga0501031_0020131
1142 Ga0501034_0037485
1143 Ga0501035_0002946
1144 Ga0501044_1103626
1145 nmdc:mga0n895_288431_c1
1146 nmdc:mga0rr50_211430_c1
1147 nmdc:mga0rr50_33835_c1
1148 nmdc:mga08x19_2372_c2
1149 Ga0587082_014536
1150 Ga0587083_0003425
1151 Ga0587083_0013567
1152 Ga0587083_0168902
1153 Ga0587088_023975
1154 Ga0587089_059522
1155 Ga0587090_074878
1156 Ga0587091_038467
1157 Ga0587091_041091
1158 Ga0587091_075285
1159 Ga0587098_040526
1160 Ga0587098_046134
1161 Ga0587106_096988
1162 Ga0587099_037786
1163 Ga0587067_006889
1164 Ga0587068_003650
1165 Ga0587069_007459
1166 Ga0587072_006722
1167 Ga0587072_008854
1168 Ga0587072_049857
1169 Ga0587072_061090
1170 Ga0587075_018178
1171 Ga0587075_030472
1172 Ga0587076_010073
1173 Ga0587079_005324
1174 Ga0587079_015687
1175 Ga0587102_037521
1176 Ga0587107_026609
1177 Ga0466962_0092792
1178 2809142265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

12

182

0.97

PF00117

GATase

Glutamine amidotransferase class-I

63

146

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9835 9 183
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9746 13 183
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9737 13 181
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9727 11 183
1oi4-assembly1.cif.gz_A crystal structure of yhbo from escherichia coli 0.9724 12 183
ID Description Score Start End Superfamily
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9815 9 183 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9746 13 183 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9714 12 183 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9594 12 184 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9574 13 183 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A542MAR7-F1-model_v4 Protease I 0.9987 1 184 GO:0006508
GO:0008233
AF-A0A6L8KZ09-F1-model_v4 DJ-1/PfpI/YhbO family deglycase/protease 0.9987 6 185 GO:0006508
GO:0008233
AF-A0A3D9KTM2-F1-model_v4 deleted 0.9985 6 184
AF-A0A3D2M3T5-F1-model_v4 Protease 0.9949 71 187 GO:0006508
GO:0008233
AF-A0A378LTN8-F1-model_v4 Intracellular protease, ThiJ/PfpI family (EC 3.2.-.-) 0.994 9 185 GO:0006508
GO:0008233
GO:0016798

Map