F468102

General Info

Members Datasets Scaffolds Average Seq Length
601 275 1202 156

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0144972|Ga0496112_0144972_465_923
Length 147
Sequence MLTLLRDLRSLRRNLDLAGPDRGRSLAVRHVDAGSCNGCEHELTLVSSPYHDLQRFGLGIVADLLLVTGAVTTRMHDALLRAYDAMPEPRRVAALGDCSLGCGVLGSSSELVGRVEDVLPVDVRIPGCPPTPGAIAGALLELIDSRS

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
187 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
188 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
189 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 5.49
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0144972 3300048915 Bacteria 2343
2 JGI24738J21930_10005724 3300002075 Bacteria 2958
3 JGI24742J22300_10032726 3300002244 Bacteria 912
4 JGI24751J29686_10036013 3300002459 Bacteria 1026
5 Ga0070658_10011501 3300005327 Bacteria 7098
6 Ga0070658_10015373 3300005327 Bacteria 6125
7 Ga0070658_10026521 3300005327 Bacteria 4648
8 Ga0070658_10054576 3300005327 Bacteria 3244
9 Ga0070676_10393395 3300005328 Bacteria 962
10 Ga0070683_100023238 3300005329 Bacteria 5545
11 Ga0070683_100106864 3300005329 Bacteria 2639
12 Ga0070683_100135158 3300005329 Bacteria 2334
13 Ga0070683_100262870 3300005329 Bacteria 1642
14 Ga0070683_100268509 3300005329 Bacteria 1623
15 Ga0070683_100756818 3300005329 Bacteria 931
16 Ga0070683_101564783 3300005329 Archaea 634
17 Ga0070683_101760709 3300005329 Bacteria 596
18 Ga0070670_100012950 3300005331 Bacteria 7141
19 Ga0070666_10107125 3300005335 Bacteria 1931
20 Ga0070680_100002375 3300005336 Bacteria 13913
21 Ga0070680_100093904 3300005336 Bacteria 2486
22 Ga0070680_100386028 3300005336 Bacteria 1193
23 Ga0070682_100007700 3300005337 Bacteria 6067
24 Ga0070682_100032747 3300005337 Bacteria 3154
25 Ga0068868_100058072 3300005338 Bacteria 3057
26 Ga0070660_100005964 3300005339 Bacteria 8421
27 Ga0070660_100008512 3300005339 Bacteria 7179
28 Ga0070660_100017697 3300005339 Bacteria 5196
29 Ga0070660_100022179 3300005339 Bacteria 4692
30 Ga0070660_100081239 3300005339 Bacteria 2544
31 Ga0070660_100114680 3300005339 Bacteria 2147
32 Ga0070660_100263579 3300005339 Bacteria 1407
33 Ga0070660_100362429 3300005339 Bacteria 1195
34 Ga0070691_10006822 3300005341 Bacteria 5218
35 Ga0070687_100292611 3300005343 Bacteria 1030
36 Ga0070661_100020978 3300005344 Bacteria 4663
37 Ga0070661_100166365 3300005344 Bacteria 1673
38 Ga0070661_100221993 3300005344 Bacteria 1450
39 Ga0070692_10009031 3300005345 Bacteria 4475
40 Ga0070692_10501301 3300005345 Bacteria 787
41 Ga0070675_100010304 3300005354 Bacteria 7298
42 Ga0070674_100005903 3300005356 Bacteria 7120
43 Ga0070674_100819217 3300005356 Bacteria 805
44 Ga0070673_100014501 3300005364 Bacteria 5493
45 Ga0070659_100069406 3300005366 Bacteria 2797
46 Ga0070667_100010945 3300005367 Bacteria 7503
47 Ga0070667_100076899 3300005367 Bacteria 2850
48 Ga0070667_100109042 3300005367 Bacteria 2399
49 Ga0070714_100065485 3300005435 Bacteria 3130
50 Ga0070701_10024347 3300005438 Bacteria 2928
51 Ga0070678_100003242 3300005456 Bacteria 9037
52 Ga0070678_100014870 3300005456 Bacteria 4926
53 Ga0070662_100138544 3300005457 Bacteria 1883
54 Ga0070681_10015216 3300005458 Bacteria 7652
55 Ga0070681_10027644 3300005458 Bacteria 5703
56 Ga0070681_10063030 3300005458 Bacteria 3680
57 Ga0070681_10063888 3300005458 Bacteria 3654
58 Ga0070681_10112594 3300005458 Bacteria 2661
59 Ga0070681_10228902 3300005458 Bacteria 1773
60 Ga0070681_10249152 3300005458 Bacteria 1689
61 Ga0070681_10272042 3300005458 Bacteria 1605
62 Ga0070681_10292099 3300005458 Bacteria 1540
63 Ga0070681_10296293 3300005458 Bacteria 1527
64 Ga0068867_100008225 3300005459 Bacteria 7368
65 Ga0068867_101139849 3300005459 Bacteria 714
66 Ga0070698_100119424 3300005471 Bacteria 2597
67 Ga0070698_100156460 3300005471 Bacteria 2225
68 Ga0070698_101191694 3300005471 Bacteria 711
69 Ga0070699_100116243 3300005518 Bacteria 2351
70 Ga0070699_101600173 3300005518 Bacteria 597
71 Ga0070679_100028270 3300005530 Bacteria 5528
72 Ga0070679_100059535 3300005530 Bacteria 3807
73 Ga0070679_100103296 3300005530 Bacteria 2836
74 Ga0070679_100183576 3300005530 Bacteria 2064
75 Ga0070679_100266042 3300005530 Bacteria 1669
76 Ga0070679_100719925 3300005530 Bacteria 941
77 Ga0070679_101055232 3300005530 Bacteria 757
78 Ga0070684_100007100 3300005535 Bacteria 8703
79 Ga0070684_100011439 3300005535 Bacteria 7071
80 Ga0070684_100056516 3300005535 Bacteria 3425
81 Ga0070684_100126576 3300005535 Bacteria 2302
82 Ga0070684_100286766 3300005535 Bacteria 1509
83 Ga0070697_100252595 3300005536 Bacteria 1508
84 Ga0068853_100020768 3300005539 Bacteria 5463
85 Ga0068853_101313232 3300005539 Archaea 699
86 Ga0070672_100006412 3300005543 Bacteria 7908
87 Ga0070696_100161680 3300005546 Bacteria 1650
88 Ga0070693_100014341 3300005547 Bacteria 4059
89 Ga0070693_100421890 3300005547 Bacteria 930
90 Ga0070665_100343681 3300005548 Bacteria 1497
91 Ga0070665_101068264 3300005548 Bacteria 819
92 Ga0070704_100270394 3300005549 Bacteria 1404
93 Ga0068855_100018639 3300005563 Bacteria 8347
94 Ga0068855_100037405 3300005563 Bacteria 5771
95 Ga0068855_100047151 3300005563 Bacteria 5091
96 Ga0068855_100066818 3300005563 Bacteria 4191
97 Ga0068855_100107691 3300005563 Bacteria 3202
98 Ga0070664_100020655 3300005564 Bacteria 5425
99 Ga0070664_100202188 3300005564 Bacteria 1773
100 Ga0068857_100014956 3300005577 Bacteria 6769
101 Ga0068857_101118336 3300005577 Bacteria 761
102 Ga0068854_100021325 3300005578 Bacteria 4395
103 Ga0068856_100168035 3300005614 Bacteria 2205
104 Ga0070702_100002276 3300005615 Bacteria 8218
105 Ga0070702_100026892 3300005615 Bacteria 3097
106 Ga0068852_100094112 3300005616 Bacteria 2687
107 Ga0068866_10018214 3300005718 Bacteria 3172
108 Ga0068866_10618242 3300005718 Bacteria 734
109 Ga0068861_100049752 3300005719 Bacteria 3175
110 Ga0068851_10017586 3300005834 Bacteria 3436
111 Ga0068870_10014582 3300005840 Bacteria 3714
112 Ga0068863_100347416 3300005841 Bacteria 1444
113 Ga0068858_100047265 3300005842 Bacteria 3990
114 Ga0068858_100085350 3300005842 Bacteria 2937
115 Ga0075364_10588200 3300006051 Bacteria 760
116 Ga0070712_100514399 3300006175 Bacteria 1005
117 Ga0097621_100002019 3300006237 Bacteria 13873
118 Ga0097621_100051376 3300006237 Bacteria 3355
119 Ga0068871_100119836 3300006358 Bacteria 2222
120 Ga0075428_100322845 3300006844 Bacteria 1659
121 Ga0075430_101118525 3300006846 Bacteria 649
122 Ga0068865_100020410 3300006881 Bacteria 4295
123 Ga0068865_100173005 3300006881 Bacteria 1657
124 Ga0099794_10000091 3300007265 Bacteria 33594
125 Ga0105240_10271156 3300009093 Bacteria 1954
126 Ga0111539_10335533 3300009094 Bacteria 1760
127 Ga0105245_10017669 3300009098 Bacteria 6225
128 Ga0105245_10025903 3300009098 Bacteria 5159
129 Ga0105245_10243829 3300009098 Bacteria 1743
130 Ga0105245_11302024 3300009098 Bacteria 776
131 Ga0105247_10011824 3300009101 Bacteria 5249
132 Ga0114129_10049563 3300009147 Bacteria 5900
133 Ga0105243_10001768 3300009148 Bacteria 18573
134 Ga0105243_10073353 3300009148 Bacteria 2773
135 Ga0105241_10883082 3300009174 Bacteria 829
136 Ga0105242_10002887 3300009176 Bacteria 13453
137 Ga0105242_10025487 3300009176 Bacteria 4681
138 Ga0105248_10005004 3300009177 Bacteria 14643
139 Ga0105248_10128699 3300009177 Bacteria 2857
140 Ga0105238_10013562 3300009551 Bacteria 8228
141 Ga0105238_10183569 3300009551 Bacteria 2068
142 Ga0105239_10063421 3300010375 Bacteria 4057
143 Ga0105239_10113918 3300010375 Bacteria 2999
144 Ga0105239_10695375 3300010375 Bacteria 1162
145 Ga0105246_10047090 3300011119 Bacteria 2943
146 Ga0105246_10077045 3300011119 Bacteria 2364
147 Ga0105246_10230462 3300011119 Bacteria 1458
148 Ga0157373_10285484 3300013100 Bacteria 1170
149 Ga0157373_10728289 3300013100 Bacteria 728
150 Ga0157371_10028053 3300013102 Bacteria 4079
151 Ga0157370_10072882 3300013104 Bacteria 3240
152 Ga0157369_11401166 3300013105 Bacteria 712
153 Ga0157374_10053399 3300013296 Bacteria 3767
154 Ga0157374_11695598 3300013296 Bacteria 657
155 Ga0157378_10003817 3300013297 Bacteria 13327
156 Ga0163162_10359570 3300013306 Bacteria 1589
157 Ga0163162_10474409 3300013306 Bacteria 1382
158 Ga0157372_10036911 3300013307 Bacteria 5388
159 Ga0157372_10055287 3300013307 Bacteria 4432
160 Ga0157372_10769341 3300013307 Bacteria 1119
161 Ga0157375_10021282 3300013308 Bacteria 5942
162 Ga0157375_10042713 3300013308 Bacteria 4390
163 Ga0157380_10102500 3300014326 Bacteria 2386
164 Ga0182008_10457938 3300014497 Bacteria 695
165 Ga0157377_10006000 3300014745 Bacteria 5756
166 Ga0157379_10133455 3300014968 Bacteria 2236
167 Ga0157376_10012752 3300014969 Bacteria 6250
168 Ga0206353_11501847 3300020082 Bacteria 2683
169 Ga0207656_10012703 3300025321 Bacteria 3206
170 Ga0207642_10018482 3300025899 Bacteria 2677
171 Ga0207688_10002602 3300025901 Bacteria 9763
172 Ga0207680_10152797 3300025903 Bacteria 1540
173 Ga0207680_10276545 3300025903 Bacteria 1166
174 Ga0207685_10104418 3300025905 Bacteria 1217
175 Ga0207699_10659040 3300025906 Bacteria 765
176 Ga0207645_10062569 3300025907 Bacteria 2377
177 Ga0207643_10009113 3300025908 Bacteria 5330
178 Ga0207643_10023467 3300025908 Bacteria 3401
179 Ga0207643_10082473 3300025908 Bacteria 1864
180 Ga0207705_10009394 3300025909 Bacteria 7110
181 Ga0207705_10022980 3300025909 Bacteria 4447
182 Ga0207705_10050638 3300025909 Bacteria 2990
183 Ga0207707_10064320 3300025912 Bacteria 3193
184 Ga0207707_10065193 3300025912 Bacteria 3172
185 Ga0207707_10092049 3300025912 Bacteria 2650
186 Ga0207707_10108367 3300025912 Bacteria 2428
187 Ga0207707_10136859 3300025912 Bacteria 2141
188 Ga0207695_11065846 3300025913 Bacteria 688
189 Ga0207693_10635656 3300025915 Bacteria 830
190 Ga0207660_10410516 3300025917 Bacteria 1091
191 Ga0207660_10558239 3300025917 Bacteria 931
192 Ga0207662_10260005 3300025918 Bacteria 1142
193 Ga0207657_10001017 3300025919 Bacteria 29789
194 Ga0207657_10001123 3300025919 Bacteria 28402
195 Ga0207657_10005451 3300025919 Bacteria 13281
196 Ga0207657_10007362 3300025919 Bacteria 11291
197 Ga0207657_10011098 3300025919 Bacteria 8955
198 Ga0207657_10177721 3300025919 Bacteria 1722
199 Ga0207657_10447726 3300025919 Bacteria 1013
200 Ga0207649_10055149 3300025920 Bacteria 2476
201 Ga0207649_10194893 3300025920 Bacteria 1427
202 Ga0207649_10472493 3300025920 Bacteria 950
203 Ga0207652_10052319 3300025921 Bacteria 3504
204 Ga0207652_10088196 3300025921 Bacteria 2721
205 Ga0207652_10102012 3300025921 Bacteria 2535
206 Ga0207652_10126074 3300025921 Bacteria 2281
207 Ga0207652_10426983 3300025921 Bacteria 1195
208 Ga0207652_10488738 3300025921 Bacteria 1109
209 Ga0207652_10921674 3300025921 Bacteria 771
210 Ga0207646_10281530 3300025922 Bacteria 1503
211 Ga0207681_10197502 3300025923 Bacteria 1543
212 Ga0207694_10069230 3300025924 Bacteria 2757
213 Ga0207650_10025606 3300025925 Bacteria 4204
214 Ga0207659_10121074 3300025926 Bacteria 2005
215 Ga0207687_10015507 3300025927 Bacteria 4997
216 Ga0207687_10167939 3300025927 Bacteria 1690
217 Ga0207664_10473438 3300025929 Bacteria 1120
218 Ga0207644_10120757 3300025931 Bacteria 1995
219 Ga0207690_10175155 3300025932 Bacteria 1610
220 Ga0207706_10005710 3300025933 Bacteria 11591
221 Ga0207686_10011433 3300025934 Bacteria 4861
222 Ga0207686_10030436 3300025934 Bacteria 3195
223 Ga0207709_10015587 3300025935 Bacteria 4215
224 Ga0207709_10251220 3300025935 Bacteria 1292
225 Ga0207709_10757270 3300025935 Bacteria 781
226 Ga0207669_10021417 3300025937 Bacteria 3413
227 Ga0207669_10048026 3300025937 Bacteria 2533
228 Ga0207669_11248427 3300025937 Bacteria 630
229 Ga0207704_10010030 3300025938 Bacteria 4599
230 Ga0207704_10492661 3300025938 Bacteria 986
231 Ga0207691_10021645 3300025940 Bacteria 6069
232 Ga0207711_10069860 3300025941 Bacteria 3045
233 Ga0207711_10495778 3300025941 Bacteria 1138
234 Ga0207661_10017952 3300025944 Bacteria 5249
235 Ga0207661_10023527 3300025944 Bacteria 4657
236 Ga0207661_10095576 3300025944 Bacteria 2484
237 Ga0207661_10165223 3300025944 Bacteria 1923
238 Ga0207661_10366920 3300025944 Bacteria 1301
239 Ga0207661_10618563 3300025944 Bacteria 995
240 Ga0207661_11237649 3300025944 Archaea 686
241 Ga0207661_11274947 3300025944 Bacteria 675
242 Ga0207679_10046023 3300025945 Bacteria 3160
243 Ga0207679_10628653 3300025945 Bacteria 970
244 Ga0207667_10044521 3300025949 Bacteria 4703
245 Ga0207667_10106504 3300025949 Bacteria 2892
246 Ga0207667_10801591 3300025949 Bacteria 938
247 Ga0207667_11729172 3300025949 Bacteria 591
248 Ga0207667_11884487 3300025949 Archaea 560
249 Ga0207651_10009289 3300025960 Bacteria 5371
250 Ga0207640_10066255 3300025981 Bacteria 2412
251 Ga0207658_10042027 3300025986 Bacteria 3314
252 Ga0207677_10057161 3300026023 Bacteria 2677
253 Ga0207703_10098316 3300026035 Bacteria 2475
254 Ga0207703_11100055 3300026035 Bacteria 763
255 Ga0207639_10066479 3300026041 Bacteria 2802
256 Ga0207678_10054994 3300026067 Bacteria 3428
257 Ga0207708_10554108 3300026075 Bacteria 970
258 Ga0207702_10004504 3300026078 Bacteria 12363
259 Ga0207641_11078458 3300026088 Bacteria 801
260 Ga0207648_10023252 3300026089 Bacteria 5558
261 Ga0207648_10846157 3300026089 Bacteria 853
262 Ga0207676_10769730 3300026095 Bacteria 937
263 Ga0207674_10044709 3300026116 Bacteria 4561
264 Ga0207674_10948207 3300026116 Bacteria 829
265 Ga0207675_100021186 3300026118 Bacteria 6056
266 Ga0207683_10003162 3300026121 Bacteria 14371
267 Ga0207683_10003743 3300026121 Bacteria 13186
268 Ga0207698_10323533 3300026142 Bacteria 1445
269 Ga0209588_1000047 3300027671 Bacteria 46643
270 Ga0207428_10754128 3300027907 Bacteria 694
271 Ga0268266_10977396 3300028379 Bacteria 819
272 Ga0268264_10359859 3300028381 Bacteria 1387
273 Ga0265337_1122933 3300028556 Bacteria 704
274 Ga0265319_1002310 3300028563 Bacteria 10520
275 Ga0265334_10001366 3300028573 Bacteria 11771
276 Ga0265334_10009970 3300028573 Bacteria 4016
277 Ga0265334_10250865 3300028573 Bacteria 609
278 Ga0265318_10050074 3300028577 Bacteria 1570
279 Ga0265318_10052648 3300028577 Bacteria 1527
280 Ga0265322_10046720 3300028654 Bacteria 1231
281 Ga0265322_10119546 3300028654 Bacteria 750
282 Ga0265336_10032631 3300028666 Bacteria 1615
283 Ga0265338_10058269 3300028800 Bacteria 3410
284 Ga0265338_10070970 3300028800 Bacteria 2983
285 Ga0265338_10216587 3300028800 Bacteria 1433
286 Ga0265338_10217683 3300028800 Bacteria 1429
287 Ga0265338_10241675 3300028800 Bacteria 1337
288 Ga0265330_10166039 3300031235 Bacteria 936
289 Ga0265328_10044792 3300031239 Bacteria 1627
290 Ga0265320_10015100 3300031240 Bacteria 4373
291 Ga0265325_10110639 3300031241 Bacteria 1335
292 Ga0265325_10202270 3300031241 Bacteria 916
293 Ga0265340_10036274 3300031247 Bacteria 2444
294 Ga0265340_10059717 3300031247 Bacteria 1828
295 Ga0265339_10218044 3300031249 Bacteria 934
296 Ga0265327_10077727 3300031251 Bacteria 1645
297 Ga0265327_10394180 3300031251 Bacteria 602
298 Ga0265316_10063912 3300031344 Bacteria 2852
299 Ga0265316_11049666 3300031344 Bacteria 566
300 Ga0307408_100933514 3300031548 Bacteria 796
301 Ga0265313_10187447 3300031595 Bacteria 866
302 Ga0265314_10022158 3300031711 Bacteria 4869
303 Ga0265314_10053992 3300031711 Bacteria 2783
304 Ga0265342_10015850 3300031712 Bacteria 4943
305 Ga0307410_10008489 3300031852 Bacteria 5698
306 Ga0307406_10022643 3300031901 Bacteria 3730
307 Ga0307406_10210611 3300031901 Bacteria 1438
308 Ga0307407_10010129 3300031903 Bacteria 4430
309 Ga0307407_10675668 3300031903 Bacteria 776
310 Ga0307412_10531478 3300031911 Bacteria 984
311 Ga0307412_10620244 3300031911 Bacteria 919
312 Ga0307409_101399830 3300031995 Bacteria 726
313 Ga0307409_101608254 3300031995 Bacteria 678
314 Ga0307416_100149727 3300032002 Bacteria 2138
315 Ga0307416_100607743 3300032002 Bacteria 1174
316 Ga0307415_100009757 3300032126 Bacteria 5402
317 Ga0307415_100392120 3300032126 Bacteria 1183
318 Ga0307415_101320834 3300032126 Bacteria 684
319 Ga0307415_101741745 3300032126 Bacteria 602
320 Ga0373958_0094549 3300034819 Bacteria 694
321 Ga0373938_0074593 3300034957 Bacteria 817
322 Ga0373939_0031055 3300035114 Bacteria 1542
323 Ga0373945_0455543 3300035116 Bacteria 566
324 Ga0373942_0134452 3300035207 Bacteria 783
325 Ga0373924_0476190 3300035410 Bacteria 560
326 Ga0373933_0250782 3300035724 Bacteria 1140
327 Ga0373937_0372458 3300036401 Bacteria 1354
328 Ga0373937_1098423 3300036401 Bacteria 744
329 Ga0395899_0242854 3300037312 Bacteria 1239
330 Ga0395900_0258551 3300037418 Bacteria 1740
331 Ga0395901_1433016 3300038443 Bacteria 648
332 Ga0436360_1161128 3300039438 Bacteria 3502
333 Ga0439438_086483 3300041405 Bacteria 766
334 Ga0439461_0021135 3300041410 Bacteria 1295
335 Ga0439466_0101275 3300041411 Bacteria 898
336 Ga0451843_0004055 3300041509 Bacteria 503
337 Ga0439437_014770 3300042000 Bacteria 914
338 Ga0439451_016636 3300042009 Bacteria 1481
339 Ga0439454_004322 3300042011 Bacteria 1632
340 Ga0450905_043297 3300042142 Bacteria 720
341 Ga0439446_0029754 3300042156 Bacteria 1576
342 Ga0439434_0101951 3300042435 Bacteria 925
343 Ga0495592_0074154 3300046454 Bacteria 2472
344 Ga0495592_0753579 3300046454 Bacteria 582
345 Ga0495603_0285580 3300046455 Bacteria 948
346 Ga0495638_0031340 3300046460 Bacteria 3418
347 Ga0495641_0129187 3300046461 Bacteria 1128
348 Ga0495641_0269972 3300046461 Bacteria 765
349 Ga0495651_0055872 3300046462 Bacteria 3032
350 Ga0495653_0798164 3300046463 Bacteria 568
351 Ga0495582_0305904 3300046473 Bacteria 914
352 Ga0495664_0133731 3300046477 Bacteria 1502
353 Ga0495596_0199416 3300046500 Bacteria 778
354 Ga0495608_0014814 3300046511 Bacteria 5409
355 Ga0495618_0109691 3300046514 Bacteria 1767
356 Ga0495628_0073276 3300046516 Bacteria 2668
357 Ga0495630_0038687 3300046517 Bacteria 3568
358 Ga0495630_0271445 3300046517 Bacteria 1296
359 Ga0495652_0245626 3300046529 Bacteria 1329
360 Ga0495665_0191581 3300046531 Bacteria 1061
361 Ga0495640_0011233 3300046533 Bacteria 6895
362 Ga0495640_0355538 3300046533 Bacteria 904
363 Ga0495640_0832128 3300046533 Bacteria 549
364 Ga0495586_0248905 3300046535 Bacteria 1014
365 Ga0495586_0361683 3300046535 Bacteria 834
366 Ga0495587_0230425 3300046536 Bacteria 1044
367 Ga0495645_0290869 3300046543 Bacteria 1071
368 Ga0495645_0622897 3300046543 Bacteria 662
369 Ga0495667_0022713 3300046559 Bacteria 4226
370 Ga0495634_0090460 3300046642 Bacteria 1988
371 Ga0495613_0018468 3300046689 Bacteria 5199
372 Ga0495613_0198329 3300046689 Bacteria 1416
373 Ga0495604_0010862 3300047317 Bacteria 7233
374 Ga0495674_0008073 3300047319 Bacteria 10048
375 Ga0495674_0297507 3300047319 Bacteria 1319
376 Ga0495676_0322562 3300047321 Bacteria 1037
377 Ga0495676_0752755 3300047321 Bacteria 629
378 Ga0495680_0033011 3300047322 Bacteria 4195
379 Ga0495680_0293913 3300047322 Bacteria 1142
380 Ga0495680_0958961 3300047322 Bacteria 549
381 Ga0495675_0063328 3300047444 Bacteria 2340
382 Ga0495684_0037113 3300047471 Bacteria 3737
383 Ga0496100_0219584 3300048903 Bacteria 1394
384 Ga0496100_0940271 3300048903 Bacteria 679
385 Ga0496101_0327516 3300048904 Bacteria 1202
386 Ga0496101_0576109 3300048904 Bacteria 890
387 Ga0496101_0838785 3300048904 Bacteria 724
388 Ga0496101_0966576 3300048904 Bacteria 670
389 Ga0496102_0007890 3300048905 Bacteria 9096
390 Ga0496102_1098070 3300048905 Bacteria 715
391 Ga0496103_0368784 3300048906 Bacteria 923
392 Ga0496104_0550908 3300048907 Bacteria 1064
393 Ga0496105_0448290 3300048908 Bacteria 1019
394 Ga0496106_0770918 3300048909 Bacteria 764
395 Ga0496107_0381667 3300048910 Bacteria 1048
396 Ga0496108_0174797 3300048911 Bacteria 1859
397 Ga0496108_0585466 3300048911 Bacteria 973
398 Ga0496109_0879203 3300048912 Bacteria 834
399 Ga0496109_1152092 3300048912 Bacteria 712
400 Ga0496110_0093251 3300048913 Bacteria 2695
401 Ga0496111_0504187 3300048914 Bacteria 891
402 Ga0496112_0011597 3300048915 Bacteria 8059
403 Ga0496112_0103986 3300048915 Bacteria 2810
404 Ga0496112_0244054 3300048915 Bacteria 1748
405 Ga0496112_0550849 3300048915 Bacteria 1087
406 Ga0496113_0291688 3300048916 Bacteria 1305
407 Ga0496113_0315957 3300048916 Bacteria 1252
408 Ga0496113_0825687 3300048916 Bacteria 736
409 Ga0496114_0050130 3300048917 Bacteria 3475
410 Ga0496114_0057024 3300048917 Bacteria 3261
411 Ga0496114_0361340 3300048917 Bacteria 1284
412 Ga0496115_0016776 3300048918 Bacteria 5581
413 Ga0496115_0362249 3300048918 Bacteria 1181
414 Ga0496115_0478744 3300048918 Bacteria 1003
415 Ga0496126_0029373 3300048929 Bacteria 5223
416 Ga0501031_0001078 3300049568 Bacteria 16572
417 Ga0501032_0040749 3300049569 Bacteria 3156
418 Ga0501032_0044289 3300049569 Bacteria 3013
419 Ga0501032_0145403 3300049569 Bacteria 1561
420 Ga0501033_0001444 3300049570 Bacteria 21089
421 Ga0501033_0123644 3300049570 Bacteria 1876
422 Ga0501033_0415324 3300049570 Bacteria 937
423 Ga0501033_0421738 3300049570 Bacteria 929
424 Ga0501033_0663336 3300049570 Bacteria 712
425 Ga0501034_0053329 3300049571 Bacteria 4072
426 Ga0501034_0163935 3300049571 Bacteria 2192
427 Ga0501036_0136843 3300049572 Bacteria 2067
428 Ga0501036_0588863 3300049572 Bacteria 923
429 Ga0501036_0731708 3300049572 Bacteria 816
430 Ga0501036_0900039 3300049572 Bacteria 726
431 Ga0501036_1052759 3300049572 Bacteria 665
432 Ga0501037_0007202 3300049573 Bacteria 8126
433 Ga0501037_0118763 3300049573 Bacteria 1902
434 Ga0501037_0297028 3300049573 Bacteria 1122
435 Ga0501038_0038046 3300049574 Bacteria 4214
436 Ga0501038_0075279 3300049574 Bacteria 2853
437 Ga0501038_0099474 3300049574 Bacteria 2424
438 Ga0501038_0562217 3300049574 Bacteria 866
439 Ga0501039_0011885 3300049575 Bacteria 6634
440 Ga0501039_0044314 3300049575 Bacteria 3436
441 Ga0501039_0172333 3300049575 Bacteria 1701
442 Ga0501039_0633007 3300049575 Bacteria 838
443 Ga0501039_0834408 3300049575 Bacteria 718
444 Ga0501039_0846958 3300049575 Bacteria 712
445 Ga0501040_0006262 3300049576 Bacteria 7724
446 Ga0501040_0029023 3300049576 Bacteria 3732
447 Ga0501040_0080539 3300049576 Bacteria 2255
448 Ga0501040_0092214 3300049576 Bacteria 2106
449 Ga0501040_0375077 3300049576 Bacteria 1020
450 Ga0501041_0000114 3300049577 Bacteria 33742
451 Ga0501041_0061981 3300049577 Bacteria 2290
452 Ga0501041_0082938 3300049577 Bacteria 1975
453 Ga0501041_0306687 3300049577 Bacteria 1001
454 Ga0501041_0500130 3300049577 Bacteria 773
455 Ga0501041_0617457 3300049577 Bacteria 692
456 Ga0501042_0003088 3300049578 Bacteria 10355
457 Ga0501042_0017288 3300049578 Bacteria 4971
458 Ga0501042_0075970 3300049578 Bacteria 2404
459 Ga0501042_0076281 3300049578 Bacteria 2399
460 Ga0501042_0078449 3300049578 Bacteria 2365
461 Ga0501042_0173230 3300049578 Bacteria 1557
462 Ga0501042_0219461 3300049578 Bacteria 1371
463 Ga0501042_0312383 3300049578 Bacteria 1135
464 Ga0501042_0495007 3300049578 Bacteria 887
465 Ga0501042_0658102 3300049578 Bacteria 762
466 Ga0501043_0016817 3300049579 Bacteria 5733
467 Ga0501043_0028173 3300049579 Bacteria 4409
468 Ga0501043_0176877 3300049579 Bacteria 1663
469 Ga0501043_0396874 3300049579 Bacteria 1043
470 Ga0501043_0466422 3300049579 Bacteria 947
471 Ga0501046_0011120 3300049580 Bacteria 7707
472 Ga0501046_0022659 3300049580 Bacteria 5174
473 Ga0501046_0278215 3300049580 Bacteria 1226
474 Ga0501046_0414656 3300049580 Bacteria 971
475 Ga0501046_0781965 3300049580 Bacteria 669
476 Ga0501047_0356084 3300049581 Bacteria 1300
477 Ga0501048_0001384 3300049582 Bacteria 18373
478 Ga0501048_0019963 3300049582 Bacteria 4913
479 Ga0501048_0051127 3300049582 Bacteria 2942
480 Ga0501048_0120717 3300049582 Bacteria 1852
481 Ga0501067_0342875 3300049583 Bacteria 832
482 Ga0501067_0363762 3300049583 Bacteria 806
483 Ga0501068_0163598 3300049584 Bacteria 1403
484 Ga0501068_0210802 3300049584 Bacteria 1233
485 Ga0501069_0010266 3300049585 Bacteria 4956
486 Ga0501069_0202712 3300049585 Bacteria 1150
487 Ga0501069_0206719 3300049585 Bacteria 1139
488 Ga0501069_0243722 3300049585 Bacteria 1048
489 Ga0501069_0250734 3300049585 Bacteria 1032
490 Ga0501070_0013621 3300049586 Bacteria 6854
491 Ga0501070_0014242 3300049586 Bacteria 6692
492 Ga0501070_0057501 3300049586 Bacteria 3224
493 Ga0501070_0192817 3300049586 Bacteria 1674
494 Ga0501070_0429777 3300049586 Bacteria 1066
495 Ga0501070_0681787 3300049586 Bacteria 814
496 Ga0501070_0879248 3300049586 Bacteria 700
497 Ga0501071_0000282 3300049587 Bacteria 24249
498 Ga0501071_0018402 3300049587 Bacteria 4835
499 Ga0501071_0045179 3300049587 Bacteria 3161
500 Ga0501071_0485589 3300049587 Bacteria 947
501 Ga0501071_0577937 3300049587 Bacteria 863
502 Ga0501071_1250848 3300049587 Bacteria 573
503 Ga0501072_0014457 3300049588 Bacteria 6047
504 Ga0501072_0014664 3300049588 Bacteria 6008
505 Ga0501072_0044659 3300049588 Bacteria 3484
506 Ga0501072_0048517 3300049588 Bacteria 3344
507 Ga0501072_0392288 3300049588 Bacteria 1101
508 Ga0501072_0400678 3300049588 Bacteria 1088
509 Ga0501072_0926400 3300049588 Bacteria 680
510 Ga0501073_0002406 3300049589 Bacteria 14006
511 Ga0501073_0107762 3300049589 Bacteria 1933
512 Ga0501073_0207699 3300049589 Bacteria 1353
513 Ga0501073_0938215 3300049589 Bacteria 596
514 Ga0501074_0012087 3300049590 Bacteria 6274
515 Ga0501074_0072155 3300049590 Bacteria 2480
516 Ga0501074_0155228 3300049590 Bacteria 1635
517 Ga0501074_1061320 3300049590 Bacteria 569
518 Ga0501075_0001862 3300049591 Bacteria 13917
519 Ga0501075_0024117 3300049591 Bacteria 4455
520 Ga0501075_0064570 3300049591 Bacteria 2761
521 Ga0501075_0127923 3300049591 Bacteria 1934
522 Ga0501075_0187438 3300049591 Bacteria 1578
523 Ga0501075_0398677 3300049591 Bacteria 1049
524 Ga0501075_1112241 3300049591 Bacteria 600
525 Ga0501076_0001153 3300049592 Bacteria 17474
526 Ga0501076_0016761 3300049592 Bacteria 5559
527 Ga0501076_0017750 3300049592 Bacteria 5410
528 Ga0501076_0033434 3300049592 Bacteria 4015
529 Ga0501076_0056200 3300049592 Bacteria 3123
530 Ga0501076_0084637 3300049592 Bacteria 2547
531 Ga0501076_0101432 3300049592 Bacteria 2320
532 Ga0501076_0697977 3300049592 Bacteria 838
533 Ga0501076_0925656 3300049592 Bacteria 718
534 Ga0501077_0002037 3300049593 Bacteria 12189
535 Ga0501077_0004289 3300049593 Bacteria 8628
536 Ga0501077_0010144 3300049593 Bacteria 5866
537 Ga0501077_0017092 3300049593 Bacteria 4575
538 Ga0501077_0172863 3300049593 Bacteria 1372
539 Ga0501077_0658353 3300049593 Bacteria 673
540 Ga0501079_0042776 3300049741 Bacteria 3497
541 Ga0501079_0052241 3300049741 Bacteria 3154
542 Ga0501079_0299949 3300049741 Bacteria 1257
543 Ga0501079_0375830 3300049741 Bacteria 1114
544 Ga0501079_0732935 3300049741 Bacteria 778
545 Ga0501079_0850023 3300049741 Bacteria 718
546 Ga0501079_0889443 3300049741 Bacteria 701
547 Ga0501080_0007340 3300049742 Bacteria 9948
548 Ga0501080_0023005 3300049742 Bacteria 5779
549 Ga0501080_0033995 3300049742 Bacteria 4760
550 Ga0501080_0098434 3300049742 Bacteria 2714
551 Ga0501080_0191682 3300049742 Bacteria 1878
552 Ga0501080_0571507 3300049742 Bacteria 1006
553 Ga0501081_0004247 3300049743 Bacteria 9178
554 Ga0501081_0208174 3300049743 Bacteria 1420
555 Ga0501081_0565964 3300049743 Bacteria 849
556 Ga0501081_0902967 3300049743 Bacteria 666
557 Ga0501083_0013240 3300049744 Bacteria 5765
558 Ga0501083_0388263 3300049744 Bacteria 908
559 Ga0501083_0984637 3300049744 Bacteria 549
560 Ga0501035_0010965 3300049822 Bacteria 8392
561 Ga0501035_0069977 3300049822 Bacteria 3109
562 Ga0501035_0093984 3300049822 Bacteria 2637
563 Ga0501035_0108970 3300049822 Bacteria 2428
564 Ga0501035_0396430 3300049822 Bacteria 1149
565 Ga0501044_0015724 3300049823 Bacteria 8149
566 Ga0501044_0108711 3300049823 Bacteria 2783
567 Ga0501044_0728928 3300049823 Bacteria 875
568 Ga0501045_0003712 3300049824 Bacteria 10497
569 Ga0501045_0023428 3300049824 Bacteria 4425
570 Ga0501045_0023735 3300049824 Bacteria 4399
571 Ga0501045_0259982 3300049824 Bacteria 1292
572 Ga0501045_0290102 3300049824 Bacteria 1218
573 Ga0501045_0439265 3300049824 Bacteria 970
574 Ga0501045_1132536 3300049824 Bacteria 572
575 nmdc:mga0yw44_109244_c1 3300050492 Bacteria 1770
576 nmdc:mga0yw44_1179848_c1 3300050492 Bacteria 517
577 nmdc:mga05p37_52684_c1 3300050507 Bacteria 5003
578 nmdc:mga08y16_331647_c1 3300050511 Bacteria 1565
579 Ga0495619_0117817 3300053085 Bacteria 1819
580 Ga0501084_0001680 3300054114 Bacteria 17577
581 Ga0501084_0031216 3300054114 Bacteria 4455
582 Ga0501084_0039498 3300054114 Bacteria 3947
583 Ga0501084_0137881 3300054114 Bacteria 2054
584 Ga0501084_0142454 3300054114 Bacteria 2019
585 Ga0501084_1365069 3300054114 Bacteria 594
586 Ga0501084_1591312 3300054114 Bacteria 546
587 Ga0501082_0019482 3300060353 Bacteria 5849
588 Ga0501082_0034829 3300060353 Bacteria 4339
589 Ga0501082_0126012 3300060353 Bacteria 2221
590 Ga0501082_0173226 3300060353 Bacteria 1876
591 Ga0501082_0234536 3300060353 Bacteria 1597
592 Ga0501082_0342732 3300060353 Bacteria 1302
593 Ga0501082_0558545 3300060353 Bacteria 1001
594 Ga0501082_0604621 3300060353 Bacteria 959
595 Ga0530510_0125841 3300061734 Bacteria 1884
596 Ga0530510_0134847 3300061734 Bacteria 1817
597 Ga0530510_0141693 3300061734 Bacteria 1771
598 Ga0530510_0262488 3300061734 Bacteria 1288
599 Ga0530510_0370867 3300061734 Bacteria 1077
600 Ga0530510_0404734 3300061734 Bacteria 1029
601 Ga0530510_0595810 3300061734 Bacteria 840
602 Ga0496112_0144972
603 JGI24738J21930_10005724
604 JGI24742J22300_10032726
605 JGI24751J29686_10036013
606 Ga0070658_10011501
607 Ga0070658_10015373
608 Ga0070658_10026521
609 Ga0070658_10054576
610 Ga0070676_10393395
611 Ga0070683_100023238
612 Ga0070683_100106864
613 Ga0070683_100135158
614 Ga0070683_100262870
615 Ga0070683_100268509
616 Ga0070683_100756818
617 Ga0070683_101564783
618 Ga0070683_101760709
619 Ga0070670_100012950
620 Ga0070666_10107125
621 Ga0070680_100002375
622 Ga0070680_100093904
623 Ga0070680_100386028
624 Ga0070682_100007700
625 Ga0070682_100032747
626 Ga0068868_100058072
627 Ga0070660_100005964
628 Ga0070660_100008512
629 Ga0070660_100017697
630 Ga0070660_100022179
631 Ga0070660_100081239
632 Ga0070660_100114680
633 Ga0070660_100263579
634 Ga0070660_100362429
635 Ga0070691_10006822
636 Ga0070687_100292611
637 Ga0070661_100020978
638 Ga0070661_100166365
639 Ga0070661_100221993
640 Ga0070692_10009031
641 Ga0070692_10501301
642 Ga0070675_100010304
643 Ga0070674_100005903
644 Ga0070674_100819217
645 Ga0070673_100014501
646 Ga0070659_100069406
647 Ga0070667_100010945
648 Ga0070667_100076899
649 Ga0070667_100109042
650 Ga0070714_100065485
651 Ga0070701_10024347
652 Ga0070678_100003242
653 Ga0070678_100014870
654 Ga0070662_100138544
655 Ga0070681_10015216
656 Ga0070681_10027644
657 Ga0070681_10063030
658 Ga0070681_10063888
659 Ga0070681_10112594
660 Ga0070681_10228902
661 Ga0070681_10249152
662 Ga0070681_10272042
663 Ga0070681_10292099
664 Ga0070681_10296293
665 Ga0068867_100008225
666 Ga0068867_101139849
667 Ga0070698_100119424
668 Ga0070698_100156460
669 Ga0070698_101191694
670 Ga0070699_100116243
671 Ga0070699_101600173
672 Ga0070679_100028270
673 Ga0070679_100059535
674 Ga0070679_100103296
675 Ga0070679_100183576
676 Ga0070679_100266042
677 Ga0070679_100719925
678 Ga0070679_101055232
679 Ga0070684_100007100
680 Ga0070684_100011439
681 Ga0070684_100056516
682 Ga0070684_100126576
683 Ga0070684_100286766
684 Ga0070697_100252595
685 Ga0068853_100020768
686 Ga0068853_101313232
687 Ga0070672_100006412
688 Ga0070696_100161680
689 Ga0070693_100014341
690 Ga0070693_100421890
691 Ga0070665_100343681
692 Ga0070665_101068264
693 Ga0070704_100270394
694 Ga0068855_100018639
695 Ga0068855_100037405
696 Ga0068855_100047151
697 Ga0068855_100066818
698 Ga0068855_100107691
699 Ga0070664_100020655
700 Ga0070664_100202188
701 Ga0068857_100014956
702 Ga0068857_101118336
703 Ga0068854_100021325
704 Ga0068856_100168035
705 Ga0070702_100002276
706 Ga0070702_100026892
707 Ga0068852_100094112
708 Ga0068866_10018214
709 Ga0068866_10618242
710 Ga0068861_100049752
711 Ga0068851_10017586
712 Ga0068870_10014582
713 Ga0068863_100347416
714 Ga0068858_100047265
715 Ga0068858_100085350
716 Ga0075364_10588200
717 Ga0070712_100514399
718 Ga0097621_100002019
719 Ga0097621_100051376
720 Ga0068871_100119836
721 Ga0075428_100322845
722 Ga0075430_101118525
723 Ga0068865_100020410
724 Ga0068865_100173005
725 Ga0099794_10000091
726 Ga0105240_10271156
727 Ga0111539_10335533
728 Ga0105245_10017669
729 Ga0105245_10025903
730 Ga0105245_10243829
731 Ga0105245_11302024
732 Ga0105247_10011824
733 Ga0114129_10049563
734 Ga0105243_10001768
735 Ga0105243_10073353
736 Ga0105241_10883082
737 Ga0105242_10002887
738 Ga0105242_10025487
739 Ga0105248_10005004
740 Ga0105248_10128699
741 Ga0105238_10013562
742 Ga0105238_10183569
743 Ga0105239_10063421
744 Ga0105239_10113918
745 Ga0105239_10695375
746 Ga0105246_10047090
747 Ga0105246_10077045
748 Ga0105246_10230462
749 Ga0157373_10285484
750 Ga0157373_10728289
751 Ga0157371_10028053
752 Ga0157370_10072882
753 Ga0157369_11401166
754 Ga0157374_10053399
755 Ga0157374_11695598
756 Ga0157378_10003817
757 Ga0163162_10359570
758 Ga0163162_10474409
759 Ga0157372_10036911
760 Ga0157372_10055287
761 Ga0157372_10769341
762 Ga0157375_10021282
763 Ga0157375_10042713
764 Ga0157380_10102500
765 Ga0182008_10457938
766 Ga0157377_10006000
767 Ga0157379_10133455
768 Ga0157376_10012752
769 Ga0206353_11501847
770 Ga0207656_10012703
771 Ga0207642_10018482
772 Ga0207688_10002602
773 Ga0207680_10152797
774 Ga0207680_10276545
775 Ga0207685_10104418
776 Ga0207699_10659040
777 Ga0207645_10062569
778 Ga0207643_10009113
779 Ga0207643_10023467
780 Ga0207643_10082473
781 Ga0207705_10009394
782 Ga0207705_10022980
783 Ga0207705_10050638
784 Ga0207707_10064320
785 Ga0207707_10065193
786 Ga0207707_10092049
787 Ga0207707_10108367
788 Ga0207707_10136859
789 Ga0207695_11065846
790 Ga0207693_10635656
791 Ga0207660_10410516
792 Ga0207660_10558239
793 Ga0207662_10260005
794 Ga0207657_10001017
795 Ga0207657_10001123
796 Ga0207657_10005451
797 Ga0207657_10007362
798 Ga0207657_10011098
799 Ga0207657_10177721
800 Ga0207657_10447726
801 Ga0207649_10055149
802 Ga0207649_10194893
803 Ga0207649_10472493
804 Ga0207652_10052319
805 Ga0207652_10088196
806 Ga0207652_10102012
807 Ga0207652_10126074
808 Ga0207652_10426983
809 Ga0207652_10488738
810 Ga0207652_10921674
811 Ga0207646_10281530
812 Ga0207681_10197502
813 Ga0207694_10069230
814 Ga0207650_10025606
815 Ga0207659_10121074
816 Ga0207687_10015507
817 Ga0207687_10167939
818 Ga0207664_10473438
819 Ga0207644_10120757
820 Ga0207690_10175155
821 Ga0207706_10005710
822 Ga0207686_10011433
823 Ga0207686_10030436
824 Ga0207709_10015587
825 Ga0207709_10251220
826 Ga0207709_10757270
827 Ga0207669_10021417
828 Ga0207669_10048026
829 Ga0207669_11248427
830 Ga0207704_10010030
831 Ga0207704_10492661
832 Ga0207691_10021645
833 Ga0207711_10069860
834 Ga0207711_10495778
835 Ga0207661_10017952
836 Ga0207661_10023527
837 Ga0207661_10095576
838 Ga0207661_10165223
839 Ga0207661_10366920
840 Ga0207661_10618563
841 Ga0207661_11237649
842 Ga0207661_11274947
843 Ga0207679_10046023
844 Ga0207679_10628653
845 Ga0207667_10044521
846 Ga0207667_10106504
847 Ga0207667_10801591
848 Ga0207667_11729172
849 Ga0207667_11884487
850 Ga0207651_10009289
851 Ga0207640_10066255
852 Ga0207658_10042027
853 Ga0207677_10057161
854 Ga0207703_10098316
855 Ga0207703_11100055
856 Ga0207639_10066479
857 Ga0207678_10054994
858 Ga0207708_10554108
859 Ga0207702_10004504
860 Ga0207641_11078458
861 Ga0207648_10023252
862 Ga0207648_10846157
863 Ga0207676_10769730
864 Ga0207674_10044709
865 Ga0207674_10948207
866 Ga0207675_100021186
867 Ga0207683_10003162
868 Ga0207683_10003743
869 Ga0207698_10323533
870 Ga0209588_1000047
871 Ga0207428_10754128
872 Ga0268266_10977396
873 Ga0268264_10359859
874 Ga0265337_1122933
875 Ga0265319_1002310
876 Ga0265334_10001366
877 Ga0265334_10009970
878 Ga0265334_10250865
879 Ga0265318_10050074
880 Ga0265318_10052648
881 Ga0265322_10046720
882 Ga0265322_10119546
883 Ga0265336_10032631
884 Ga0265338_10058269
885 Ga0265338_10070970
886 Ga0265338_10216587
887 Ga0265338_10217683
888 Ga0265338_10241675
889 Ga0265330_10166039
890 Ga0265328_10044792
891 Ga0265320_10015100
892 Ga0265325_10110639
893 Ga0265325_10202270
894 Ga0265340_10036274
895 Ga0265340_10059717
896 Ga0265339_10218044
897 Ga0265327_10077727
898 Ga0265327_10394180
899 Ga0265316_10063912
900 Ga0265316_11049666
901 Ga0307408_100933514
902 Ga0265313_10187447
903 Ga0265314_10022158
904 Ga0265314_10053992
905 Ga0265342_10015850
906 Ga0307410_10008489
907 Ga0307406_10022643
908 Ga0307406_10210611
909 Ga0307407_10010129
910 Ga0307407_10675668
911 Ga0307412_10531478
912 Ga0307412_10620244
913 Ga0307409_101399830
914 Ga0307409_101608254
915 Ga0307416_100149727
916 Ga0307416_100607743
917 Ga0307415_100009757
918 Ga0307415_100392120
919 Ga0307415_101320834
920 Ga0307415_101741745
921 Ga0373958_0094549
922 Ga0373938_0074593
923 Ga0373939_0031055
924 Ga0373945_0455543
925 Ga0373942_0134452
926 Ga0373924_0476190
927 Ga0373933_0250782
928 Ga0373937_0372458
929 Ga0373937_1098423
930 Ga0395899_0242854
931 Ga0395900_0258551
932 Ga0395901_1433016
933 Ga0436360_1161128
934 Ga0439438_086483
935 Ga0439461_0021135
936 Ga0439466_0101275
937 Ga0451843_0004055
938 Ga0439437_014770
939 Ga0439451_016636
940 Ga0439454_004322
941 Ga0450905_043297
942 Ga0439446_0029754
943 Ga0439434_0101951
944 Ga0495592_0074154
945 Ga0495592_0753579
946 Ga0495603_0285580
947 Ga0495638_0031340
948 Ga0495641_0129187
949 Ga0495641_0269972
950 Ga0495651_0055872
951 Ga0495653_0798164
952 Ga0495582_0305904
953 Ga0495664_0133731
954 Ga0495596_0199416
955 Ga0495608_0014814
956 Ga0495618_0109691
957 Ga0495628_0073276
958 Ga0495630_0038687
959 Ga0495630_0271445
960 Ga0495652_0245626
961 Ga0495665_0191581
962 Ga0495640_0011233
963 Ga0495640_0355538
964 Ga0495640_0832128
965 Ga0495586_0248905
966 Ga0495586_0361683
967 Ga0495587_0230425
968 Ga0495645_0290869
969 Ga0495645_0622897
970 Ga0495667_0022713
971 Ga0495634_0090460
972 Ga0495613_0018468
973 Ga0495613_0198329
974 Ga0495604_0010862
975 Ga0495674_0008073
976 Ga0495674_0297507
977 Ga0495676_0322562
978 Ga0495676_0752755
979 Ga0495680_0033011
980 Ga0495680_0293913
981 Ga0495680_0958961
982 Ga0495675_0063328
983 Ga0495684_0037113
984 Ga0496100_0219584
985 Ga0496100_0940271
986 Ga0496101_0327516
987 Ga0496101_0576109
988 Ga0496101_0838785
989 Ga0496101_0966576
990 Ga0496102_0007890
991 Ga0496102_1098070
992 Ga0496103_0368784
993 Ga0496104_0550908
994 Ga0496105_0448290
995 Ga0496106_0770918
996 Ga0496107_0381667
997 Ga0496108_0174797
998 Ga0496108_0585466
999 Ga0496109_0879203
1000 Ga0496109_1152092
1001 Ga0496110_0093251
1002 Ga0496111_0504187
1003 Ga0496112_0011597
1004 Ga0496112_0103986
1005 Ga0496112_0244054
1006 Ga0496112_0550849
1007 Ga0496113_0291688
1008 Ga0496113_0315957
1009 Ga0496113_0825687
1010 Ga0496114_0050130
1011 Ga0496114_0057024
1012 Ga0496114_0361340
1013 Ga0496115_0016776
1014 Ga0496115_0362249
1015 Ga0496115_0478744
1016 Ga0496126_0029373
1017 Ga0501031_0001078
1018 Ga0501032_0040749
1019 Ga0501032_0044289
1020 Ga0501032_0145403
1021 Ga0501033_0001444
1022 Ga0501033_0123644
1023 Ga0501033_0415324
1024 Ga0501033_0421738
1025 Ga0501033_0663336
1026 Ga0501034_0053329
1027 Ga0501034_0163935
1028 Ga0501036_0136843
1029 Ga0501036_0588863
1030 Ga0501036_0731708
1031 Ga0501036_0900039
1032 Ga0501036_1052759
1033 Ga0501037_0007202
1034 Ga0501037_0118763
1035 Ga0501037_0297028
1036 Ga0501038_0038046
1037 Ga0501038_0075279
1038 Ga0501038_0099474
1039 Ga0501038_0562217
1040 Ga0501039_0011885
1041 Ga0501039_0044314
1042 Ga0501039_0172333
1043 Ga0501039_0633007
1044 Ga0501039_0834408
1045 Ga0501039_0846958
1046 Ga0501040_0006262
1047 Ga0501040_0029023
1048 Ga0501040_0080539
1049 Ga0501040_0092214
1050 Ga0501040_0375077
1051 Ga0501041_0000114
1052 Ga0501041_0061981
1053 Ga0501041_0082938
1054 Ga0501041_0306687
1055 Ga0501041_0500130
1056 Ga0501041_0617457
1057 Ga0501042_0003088
1058 Ga0501042_0017288
1059 Ga0501042_0075970
1060 Ga0501042_0076281
1061 Ga0501042_0078449
1062 Ga0501042_0173230
1063 Ga0501042_0219461
1064 Ga0501042_0312383
1065 Ga0501042_0495007
1066 Ga0501042_0658102
1067 Ga0501043_0016817
1068 Ga0501043_0028173
1069 Ga0501043_0176877
1070 Ga0501043_0396874
1071 Ga0501043_0466422
1072 Ga0501046_0011120
1073 Ga0501046_0022659
1074 Ga0501046_0278215
1075 Ga0501046_0414656
1076 Ga0501046_0781965
1077 Ga0501047_0356084
1078 Ga0501048_0001384
1079 Ga0501048_0019963
1080 Ga0501048_0051127
1081 Ga0501048_0120717
1082 Ga0501067_0342875
1083 Ga0501067_0363762
1084 Ga0501068_0163598
1085 Ga0501068_0210802
1086 Ga0501069_0010266
1087 Ga0501069_0202712
1088 Ga0501069_0206719
1089 Ga0501069_0243722
1090 Ga0501069_0250734
1091 Ga0501070_0013621
1092 Ga0501070_0014242
1093 Ga0501070_0057501
1094 Ga0501070_0192817
1095 Ga0501070_0429777
1096 Ga0501070_0681787
1097 Ga0501070_0879248
1098 Ga0501071_0000282
1099 Ga0501071_0018402
1100 Ga0501071_0045179
1101 Ga0501071_0485589
1102 Ga0501071_0577937
1103 Ga0501071_1250848
1104 Ga0501072_0014457
1105 Ga0501072_0014664
1106 Ga0501072_0044659
1107 Ga0501072_0048517
1108 Ga0501072_0392288
1109 Ga0501072_0400678
1110 Ga0501072_0926400
1111 Ga0501073_0002406
1112 Ga0501073_0107762
1113 Ga0501073_0207699
1114 Ga0501073_0938215
1115 Ga0501074_0012087
1116 Ga0501074_0072155
1117 Ga0501074_0155228
1118 Ga0501074_1061320
1119 Ga0501075_0001862
1120 Ga0501075_0024117
1121 Ga0501075_0064570
1122 Ga0501075_0127923
1123 Ga0501075_0187438
1124 Ga0501075_0398677
1125 Ga0501075_1112241
1126 Ga0501076_0001153
1127 Ga0501076_0016761
1128 Ga0501076_0017750
1129 Ga0501076_0033434
1130 Ga0501076_0056200
1131 Ga0501076_0084637
1132 Ga0501076_0101432
1133 Ga0501076_0697977
1134 Ga0501076_0925656
1135 Ga0501077_0002037
1136 Ga0501077_0004289
1137 Ga0501077_0010144
1138 Ga0501077_0017092
1139 Ga0501077_0172863
1140 Ga0501077_0658353
1141 Ga0501079_0042776
1142 Ga0501079_0052241
1143 Ga0501079_0299949
1144 Ga0501079_0375830
1145 Ga0501079_0732935
1146 Ga0501079_0850023
1147 Ga0501079_0889443
1148 Ga0501080_0007340
1149 Ga0501080_0023005
1150 Ga0501080_0033995
1151 Ga0501080_0098434
1152 Ga0501080_0191682
1153 Ga0501080_0571507
1154 Ga0501081_0004247
1155 Ga0501081_0208174
1156 Ga0501081_0565964
1157 Ga0501081_0902967
1158 Ga0501083_0013240
1159 Ga0501083_0388263
1160 Ga0501083_0984637
1161 Ga0501035_0010965
1162 Ga0501035_0069977
1163 Ga0501035_0093984
1164 Ga0501035_0108970
1165 Ga0501035_0396430
1166 Ga0501044_0015724
1167 Ga0501044_0108711
1168 Ga0501044_0728928
1169 Ga0501045_0003712
1170 Ga0501045_0023428
1171 Ga0501045_0023735
1172 Ga0501045_0259982
1173 Ga0501045_0290102
1174 Ga0501045_0439265
1175 Ga0501045_1132536
1176 nmdc:mga0yw44_109244_c1
1177 nmdc:mga0yw44_1179848_c1
1178 nmdc:mga05p37_52684_c1
1179 nmdc:mga08y16_331647_c1
1180 Ga0495619_0117817
1181 Ga0501084_0001680
1182 Ga0501084_0031216
1183 Ga0501084_0039498
1184 Ga0501084_0137881
1185 Ga0501084_0142454
1186 Ga0501084_1365069
1187 Ga0501084_1591312
1188 Ga0501082_0019482
1189 Ga0501082_0034829
1190 Ga0501082_0126012
1191 Ga0501082_0173226
1192 Ga0501082_0234536
1193 Ga0501082_0342732
1194 Ga0501082_0558545
1195 Ga0501082_0604621
1196 Ga0530510_0125841
1197 Ga0530510_0134847
1198 Ga0530510_0141693
1199 Ga0530510_0262488
1200 Ga0530510_0370867
1201 Ga0530510_0404734
1202 Ga0530510_0595810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

36

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z0t-assembly1.cif.gz_G structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.9351 24 144
6cfw-assembly1.cif.gz_J cryoem structure of a respiratory membrane-bound hydrogenase 0.9154 24 156
5gpn-assembly1.cif.gz_a architecture of mammalian respirasome 0.9134 25 147
7ard-assembly1.cif.gz_B cryo-em structure of polytomella complex-i (complete composition) 0.9126 25 147
7zmb-assembly1.cif.gz_K cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) 0.9095 25 147
ID Description Score Start End Superfamily
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9519 25 144 3.40.50.12280
af_P77668_14_171_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9372 24 150 3.40.50.12280
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9366 24 146 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9154 24 156 3.40.50.12280
af_Q5ADP7_59_222_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8698 24 147 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A7Y3P629-F1-model_v4 Oxidoreductase 0.9563 25 147 GO:0051539
AF-A0A534DHW0-F1-model_v4 deleted 0.9557 23 149
AF-A0A6F8XS28-F1-model_v4 Oxidoreductase 0.9514 25 144 GO:0051539
AF-V7MMA1-F1-model_v4 deleted 0.951 25 144
AF-A0A1X1UZK7-F1-model_v4 deleted 0.9503 25 144

Map