F467997
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 600 | 383 | 1200 | 517 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0171277|Ga0436361_0171277_7746_9383 |
| Length | 545 |
| Sequence | VSKVIFLLAPRRHPIRLPKEFAMIPAAEVVSLSRLQFGATAMFHFLFVPLTLGLSWILVICESVYVMTGQPVYKDMTRFWGKLFGINFAMGVATGLTMEFQFGTNWAYYSHYVGDIFGVPLAIEGLMAFFLESTFVGLFFFGWSRLSRVQHLGVTFLLALGTNLSALWILIANAWMQNPVGAEFNYHTMRMELTDLAVVFGNPVAQVKFVHTVAAGYVTGAMFVLGISAWYLLKARDTGFAIRSFAVAAGFGLASSLSVIVLGDESGYTAGEVQQVKLAAIEAEWDTEPAPAAITAFGLPNQETEHTDYAIKIPYVMGIIATRSFDKPVLGLRDIRAANELRIRSGMLAYGALTALKGGHPSDADRLQFEQHKGDLGYGLLLKKYTANVVDATDAQVHQAAQDTIPKVAPLFWAFRGMVGLGITMLFIFAASFWFLVRKRLAPQRWLLRLAVCAIPFPWIAIELGWFVAEYGRQPWTISGILPTFLSASSVASSQVWASFIGIFTIYSALFVVEMYLMLKYIRLGPASLATGRYDGEADLGAQHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 85 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 150 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 160 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 172 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 173 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 259 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 260 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 275 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 276 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 277 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 278 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 279 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 280 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 281 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 282 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 283 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 284 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 285 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 286 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 287 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 288 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 289 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 290 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 291 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 292 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 293 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 294 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 295 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 296 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 297 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 298 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 299 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 300 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 301 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 302 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 303 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 304 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 305 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 306 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 307 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 308 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 309 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 310 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 311 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 312 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 313 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 314 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 315 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 316 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 317 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 318 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 319 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 320 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 321 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 322 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 323 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 324 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 325 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 326 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 327 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 328 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 329 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 330 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 331 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 332 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 333 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 334 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 335 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 336 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 337 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 338 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 339 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 340 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 341 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 342 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 343 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 344 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 345 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 346 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 347 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 348 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 349 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 350 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 351 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 352 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 353 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 354 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 355 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 356 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 357 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 358 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 359 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 360 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 361 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 362 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 363 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 364 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 365 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 366 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 367 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 368 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 369 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 370 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 371 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 372 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 373 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 374 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 375 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 376 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 377 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 378 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 379 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 380 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 381 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 382 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 383 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.67 |
| Metatranscriptomes | 0 |
| Isolates | 18.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.33 |
| Nodule | 3.17 |
| Rhizoplane | 2.83 |
| Rhizosphere | 70.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_0171277 | 3300039447 | Bacteria | 18778 |
| 2 | JGI24739J22299_10002703 | 3300001989 | Bacteria | 6825 |
| 3 | JGI24739J22299_10004190 | 3300001989 | Bacteria | 5517 |
| 4 | JGI24735J21928_10005480 | 3300002067 | Bacteria | 4208 |
| 5 | JGI24735J21928_10010883 | 3300002067 | Bacteria | 2891 |
| 6 | JGI25156J39149_1000394 | 3300002705 | Bacteria | 27403 |
| 7 | JGI25162J39368_1000131 | 3300002737 | Bacteria | 81755 |
| 8 | JGI25162J39368_1000370 | 3300002737 | Bacteria | 38244 |
| 9 | JGI25157J39369_1000336 | 3300002741 | Bacteria | 33359 |
| 10 | JGI25159J45721_1001417 | 3300002987 | Bacteria | 9952 |
| 11 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 12 | rootL2_10003512 | 3300003322 | Bacteria | 14306 |
| 13 | JGI25161J50226_1000334 | 3300003374 | Bacteria | 25440 |
| 14 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 15 | Ga0055538_1000016 | 3300003751 | Bacteria | 305460 |
| 16 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 17 | Ga0055539_1000021 | 3300003752 | Bacteria | 305460 |
| 18 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 19 | Ga0055533_1000029 | 3300003756 | Bacteria | 305460 |
| 20 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 21 | Ga0055525_1000033 | 3300003759 | Bacteria | 305460 |
| 22 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 23 | Ga0055525_1000173 | 3300003759 | Bacteria | 81767 |
| 24 | Ga0055535_1006543 | 3300003761 | Bacteria | 2340 |
| 25 | Ga0055528_1004616 | 3300003790 | Bacteria | 6593 |
| 26 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 27 | Ga0055541_1000045 | 3300003841 | Bacteria | 148620 |
| 28 | Ga0055541_1000084 | 3300003841 | Bacteria | 81767 |
| 29 | Ga0058692_1001492 | 3300003856 | Bacteria | 8575 |
| 30 | Ga0065165_1000115 | 3300005262 | Bacteria | 135145 |
| 31 | Ga0065165_1000820 | 3300005262 | Bacteria | 41193 |
| 32 | Ga0070658_10060519 | 3300005327 | Bacteria | 3084 |
| 33 | Ga0070676_10000216 | 3300005328 | Bacteria | 24689 |
| 34 | Ga0070676_10016463 | 3300005328 | Bacteria | 4089 |
| 35 | Ga0070670_100007274 | 3300005331 | Bacteria | 9388 |
| 36 | Ga0070670_100026782 | 3300005331 | Bacteria | 4959 |
| 37 | Ga0070670_100049102 | 3300005331 | Bacteria | 3630 |
| 38 | Ga0070670_100069477 | 3300005331 | Bacteria | 3023 |
| 39 | Ga0070677_10001090 | 3300005333 | Bacteria | 8745 |
| 40 | Ga0068868_100026555 | 3300005338 | Bacteria | 4415 |
| 41 | Ga0070660_100000001 | 3300005339 | Bacteria | 190487 |
| 42 | Ga0070660_100005558 | 3300005339 | Bacteria | 8734 |
| 43 | Ga0070689_100043520 | 3300005340 | Bacteria | 3451 |
| 44 | Ga0070661_100045377 | 3300005344 | Bacteria | 3213 |
| 45 | Ga0070661_100102914 | 3300005344 | Bacteria | 2126 |
| 46 | Ga0070668_100003734 | 3300005347 | Bacteria | 11232 |
| 47 | Ga0070668_100008159 | 3300005347 | Bacteria | 7778 |
| 48 | Ga0070668_100119545 | 3300005347 | Bacteria | 2105 |
| 49 | Ga0070669_100033238 | 3300005353 | Bacteria | 3730 |
| 50 | Ga0070675_100028574 | 3300005354 | Bacteria | 4489 |
| 51 | Ga0070671_100000488 | 3300005355 | Bacteria | 27659 |
| 52 | Ga0070671_100002449 | 3300005355 | Bacteria | 14351 |
| 53 | Ga0070671_100056008 | 3300005355 | Bacteria | 3280 |
| 54 | Ga0070674_100058342 | 3300005356 | Bacteria | 2683 |
| 55 | Ga0070673_100001385 | 3300005364 | Bacteria | 14176 |
| 56 | Ga0070673_100058175 | 3300005364 | Bacteria | 3055 |
| 57 | Ga0070659_100000941 | 3300005366 | Bacteria | 21399 |
| 58 | Ga0070667_100002852 | 3300005367 | Bacteria | 14917 |
| 59 | Ga0070667_100009065 | 3300005367 | Bacteria | 8235 |
| 60 | Ga0070667_100011417 | 3300005367 | Bacteria | 7345 |
| 61 | Ga0070667_100148645 | 3300005367 | Bacteria | 2056 |
| 62 | Ga0070705_100014573 | 3300005440 | Bacteria | 4047 |
| 63 | Ga0070663_100000078 | 3300005455 | Bacteria | 42943 |
| 64 | Ga0070662_100023396 | 3300005457 | Bacteria | 4243 |
| 65 | Ga0068867_100028402 | 3300005459 | Bacteria | 4028 |
| 66 | Ga0068867_100029557 | 3300005459 | Bacteria | 3949 |
| 67 | Ga0070698_100151336 | 3300005471 | Bacteria | 2268 |
| 68 | Ga0070679_100080152 | 3300005530 | Bacteria | 3254 |
| 69 | Ga0070697_100113282 | 3300005536 | Bacteria | 2263 |
| 70 | Ga0070672_100003644 | 3300005543 | Bacteria | 10004 |
| 71 | Ga0070672_100015142 | 3300005543 | Bacteria | 5482 |
| 72 | Ga0070672_100110695 | 3300005543 | Bacteria | 2238 |
| 73 | Ga0070695_100043069 | 3300005545 | Bacteria | 2869 |
| 74 | Ga0070665_100004317 | 3300005548 | Bacteria | 14944 |
| 75 | Ga0070664_100075214 | 3300005564 | Bacteria | 2900 |
| 76 | Ga0068852_100000705 | 3300005616 | Bacteria | 21852 |
| 77 | Ga0068852_100006811 | 3300005616 | Bacteria | 8297 |
| 78 | Ga0068852_100014873 | 3300005616 | Bacteria | 6014 |
| 79 | Ga0068852_100046989 | 3300005616 | Bacteria | 3681 |
| 80 | Ga0068859_100004214 | 3300005617 | Bacteria | 14669 |
| 81 | Ga0068864_100010031 | 3300005618 | Bacteria | 7819 |
| 82 | Ga0068864_100015176 | 3300005618 | Bacteria | 6406 |
| 83 | Ga0068864_100057215 | 3300005618 | Bacteria | 3369 |
| 84 | Ga0068851_10000160 | 3300005834 | Bacteria | 35442 |
| 85 | Ga0068870_10004282 | 3300005840 | Bacteria | 6138 |
| 86 | Ga0068870_10007671 | 3300005840 | Bacteria | 4826 |
| 87 | Ga0068863_100010612 | 3300005841 | Bacteria | 8942 |
| 88 | Ga0068863_100018285 | 3300005841 | Bacteria | 6712 |
| 89 | Ga0068863_100021755 | 3300005841 | Bacteria | 6118 |
| 90 | Ga0068863_100032354 | 3300005841 | Bacteria | 4985 |
| 91 | Ga0068863_100162928 | 3300005841 | Bacteria | 2137 |
| 92 | Ga0068858_100007336 | 3300005842 | Bacteria | 10669 |
| 93 | Ga0068858_100087800 | 3300005842 | Bacteria | 2892 |
| 94 | Ga0097621_100007151 | 3300006237 | Bacteria | 7955 |
| 95 | Ga0097621_100109799 | 3300006237 | Bacteria | 2330 |
| 96 | Ga0097621_100152802 | 3300006237 | Bacteria | 1980 |
| 97 | Ga0068871_100017293 | 3300006358 | Bacteria | 5453 |
| 98 | Ga0068865_100037737 | 3300006881 | Bacteria | 3265 |
| 99 | Ga0097620_100004214 | 3300006931 | Bacteria | 14669 |
| 100 | Ga0105251_10000055 | 3300009011 | Bacteria | 105044 |
| 101 | Ga0105240_10000497 | 3300009093 | Bacteria | 72381 |
| 102 | Ga0105240_10070042 | 3300009093 | Bacteria | 4339 |
| 103 | Ga0105240_10194130 | 3300009093 | Bacteria | 2385 |
| 104 | Ga0105245_10031217 | 3300009098 | Bacteria | 4714 |
| 105 | Ga0105243_10138348 | 3300009148 | Bacteria | 2074 |
| 106 | Ga0105241_10008358 | 3300009174 | Bacteria | 7623 |
| 107 | Ga0105242_10069431 | 3300009176 | Bacteria | 2918 |
| 108 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 109 | Ga0105248_10038841 | 3300009177 | Bacteria | 5329 |
| 110 | Ga0105248_10150285 | 3300009177 | Bacteria | 2628 |
| 111 | Ga0105248_10209610 | 3300009177 | Bacteria | 2195 |
| 112 | Ga0105237_10012980 | 3300009545 | Bacteria | 8746 |
| 113 | Ga0105237_10022717 | 3300009545 | Bacteria | 6436 |
| 114 | Ga0105238_10000117 | 3300009551 | Bacteria | 89001 |
| 115 | Ga0105238_10018532 | 3300009551 | Bacteria | 7085 |
| 116 | Ga0105238_10076900 | 3300009551 | Bacteria | 3330 |
| 117 | Ga0105239_10055330 | 3300010375 | Bacteria | 4351 |
| 118 | Ga0105246_10040640 | 3300011119 | Bacteria | 3140 |
| 119 | Ga0157369_10102804 | 3300013105 | Bacteria | 3044 |
| 120 | Ga0157378_10013177 | 3300013297 | Bacteria | 7233 |
| 121 | Ga0163162_10029670 | 3300013306 | Bacteria | 5415 |
| 122 | Ga0163162_10035122 | 3300013306 | Bacteria | 4992 |
| 123 | Ga0163162_10054879 | 3300013306 | Bacteria | 4009 |
| 124 | Ga0157372_10131383 | 3300013307 | Bacteria | 2881 |
| 125 | Ga0157375_10063213 | 3300013308 | Bacteria | 3681 |
| 126 | Ga0157375_10155709 | 3300013308 | Bacteria | 2424 |
| 127 | Ga0163163_10164829 | 3300014325 | Bacteria | 2262 |
| 128 | Ga0157380_10101637 | 3300014326 | Bacteria | 2396 |
| 129 | Ga0182008_10038540 | 3300014497 | Bacteria | 2390 |
| 130 | Ga0157376_10025923 | 3300014969 | Bacteria | 4625 |
| 131 | Ga0182006_1002575 | 3300015261 | Bacteria | 9828 |
| 132 | Ga0182007_10001200 | 3300015262 | Bacteria | 14066 |
| 133 | Ga0182005_1000351 | 3300015265 | Bacteria | 26159 |
| 134 | Ga0182005_1006031 | 3300015265 | Bacteria | 3743 |
| 135 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 136 | Ga0163161_10027953 | 3300017792 | Bacteria | 4002 |
| 137 | Ga0213872_10000494 | 3300021361 | Bacteria | 31496 |
| 138 | Ga0213872_10000677 | 3300021361 | Bacteria | 25769 |
| 139 | Ga0213872_10018758 | 3300021361 | Bacteria | 3188 |
| 140 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 141 | Ga0209435_100038 | 3300025206 | Bacteria | 120273 |
| 142 | Ga0209435_100096 | 3300025206 | Bacteria | 38561 |
| 143 | Ga0209436_100502 | 3300025208 | Bacteria | 17128 |
| 144 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 145 | Ga0209784_100033 | 3300025224 | Bacteria | 305649 |
| 146 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 147 | Ga0209566_100037 | 3300025225 | Bacteria | 305649 |
| 148 | Ga0209566_100164 | 3300025225 | Bacteria | 73577 |
| 149 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 150 | Ga0209674_100055 | 3300025226 | Bacteria | 305649 |
| 151 | Ga0209674_101916 | 3300025226 | Bacteria | 4885 |
| 152 | Ga0209672_100046 | 3300025228 | Bacteria | 264244 |
| 153 | Ga0209672_100088 | 3300025228 | Bacteria | 121401 |
| 154 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 155 | Ga0209147_100043 | 3300025229 | Bacteria | 300460 |
| 156 | Ga0209147_100130 | 3300025229 | Bacteria | 121401 |
| 157 | Ga0209147_100214 | 3300025229 | Bacteria | 60481 |
| 158 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 159 | Ga0209563_100056 | 3300025230 | Bacteria | 305649 |
| 160 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 161 | Ga0209437_100080 | 3300025233 | Bacteria | 275402 |
| 162 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 163 | Ga0209258_100204 | 3300025242 | Bacteria | 121401 |
| 164 | Ga0209258_100210 | 3300025242 | Bacteria | 117131 |
| 165 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 166 | Ga0209646_1000093 | 3300025246 | Bacteria | 183840 |
| 167 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 168 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 169 | Ga0209677_100034 | 3300025253 | Bacteria | 305649 |
| 170 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 171 | Ga0209148_1000488 | 3300025254 | Bacteria | 40976 |
| 172 | Ga0209759_1000045 | 3300025256 | Bacteria | 235654 |
| 173 | Ga0209759_1000175 | 3300025256 | Bacteria | 106788 |
| 174 | Ga0209759_1000248 | 3300025256 | Bacteria | 80537 |
| 175 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 176 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 177 | Ga0209455_1001513 | 3300025272 | Bacteria | 10402 |
| 178 | Ga0209673_1000084 | 3300025273 | Bacteria | 215878 |
| 179 | Ga0209130_1000629 | 3300025284 | Bacteria | 33099 |
| 180 | Ga0209564_1012115 | 3300025295 | Bacteria | 3790 |
| 181 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 182 | Ga0207656_10000579 | 3300025321 | Bacteria | 12137 |
| 183 | Ga0207713_1000089 | 3300025735 | Bacteria | 152927 |
| 184 | Ga0207713_1000106 | 3300025735 | Bacteria | 137911 |
| 185 | Ga0207680_10022248 | 3300025903 | Bacteria | 3445 |
| 186 | Ga0207680_10116983 | 3300025903 | Bacteria | 1738 |
| 187 | Ga0207647_10000540 | 3300025904 | Bacteria | 30173 |
| 188 | Ga0207647_10032089 | 3300025904 | Bacteria | 3377 |
| 189 | Ga0207645_10003305 | 3300025907 | Bacteria | 12300 |
| 190 | Ga0207645_10045666 | 3300025907 | Bacteria | 2799 |
| 191 | Ga0207643_10023328 | 3300025908 | Bacteria | 3410 |
| 192 | Ga0207654_10000377 | 3300025911 | Bacteria | 25958 |
| 193 | Ga0207707_10092147 | 3300025912 | Bacteria | 2648 |
| 194 | Ga0207695_10001268 | 3300025913 | Bacteria | 42942 |
| 195 | Ga0207695_10015644 | 3300025913 | Bacteria | 8922 |
| 196 | Ga0207695_10045013 | 3300025913 | Bacteria | 4689 |
| 197 | Ga0207671_10027390 | 3300025914 | Bacteria | 4261 |
| 198 | Ga0207671_10039989 | 3300025914 | Bacteria | 3472 |
| 199 | Ga0207657_10000022 | 3300025919 | Bacteria | 154101 |
| 200 | Ga0207657_10010163 | 3300025919 | Bacteria | 9404 |
| 201 | Ga0207649_10028303 | 3300025920 | Bacteria | 3299 |
| 202 | Ga0207646_10020487 | 3300025922 | Bacteria | 6126 |
| 203 | Ga0207681_10109236 | 3300025923 | Bacteria | 2009 |
| 204 | Ga0207681_10148134 | 3300025923 | Bacteria | 1756 |
| 205 | Ga0207694_10000103 | 3300025924 | Bacteria | 92553 |
| 206 | Ga0207694_10008678 | 3300025924 | Bacteria | 7672 |
| 207 | Ga0207650_10009704 | 3300025925 | Bacteria | 6581 |
| 208 | Ga0207650_10015726 | 3300025925 | Bacteria | 5274 |
| 209 | Ga0207650_10095015 | 3300025925 | Bacteria | 2285 |
| 210 | Ga0207659_10001785 | 3300025926 | Bacteria | 12710 |
| 211 | Ga0207659_10007159 | 3300025926 | Bacteria | 6847 |
| 212 | Ga0207659_10036345 | 3300025926 | Bacteria | 3411 |
| 213 | Ga0207644_10069150 | 3300025931 | Bacteria | 2578 |
| 214 | Ga0207690_10000010 | 3300025932 | Bacteria | 330298 |
| 215 | Ga0207706_10044172 | 3300025933 | Bacteria | 3950 |
| 216 | Ga0207706_10050757 | 3300025933 | Bacteria | 3665 |
| 217 | Ga0207686_10022236 | 3300025934 | Bacteria | 3650 |
| 218 | Ga0207669_10040622 | 3300025937 | Bacteria | 2700 |
| 219 | Ga0207691_10000379 | 3300025940 | Bacteria | 44711 |
| 220 | Ga0207691_10001760 | 3300025940 | Bacteria | 21320 |
| 221 | Ga0207691_10007201 | 3300025940 | Bacteria | 10732 |
| 222 | Ga0207691_10048743 | 3300025940 | Bacteria | 3882 |
| 223 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 224 | Ga0207711_10015556 | 3300025941 | Bacteria | 6314 |
| 225 | Ga0207689_10000049 | 3300025942 | Bacteria | 88948 |
| 226 | Ga0207679_10038059 | 3300025945 | Bacteria | 3425 |
| 227 | Ga0207679_10110517 | 3300025945 | Bacteria | 2168 |
| 228 | Ga0207667_10000073 | 3300025949 | Bacteria | 174391 |
| 229 | Ga0207667_10000076 | 3300025949 | Bacteria | 166704 |
| 230 | Ga0207667_10000147 | 3300025949 | Bacteria | 106918 |
| 231 | Ga0207667_10000166 | 3300025949 | Bacteria | 97376 |
| 232 | Ga0207651_10058023 | 3300025960 | Bacteria | 2673 |
| 233 | Ga0207668_10000663 | 3300025972 | Bacteria | 21145 |
| 234 | Ga0207668_10043808 | 3300025972 | Bacteria | 3040 |
| 235 | Ga0207668_10130684 | 3300025972 | Bacteria | 1917 |
| 236 | Ga0207658_10029875 | 3300025986 | Bacteria | 3854 |
| 237 | Ga0207658_10044034 | 3300025986 | Bacteria | 3248 |
| 238 | Ga0207658_10113189 | 3300025986 | Bacteria | 2149 |
| 239 | Ga0207639_10033215 | 3300026041 | Bacteria | 3804 |
| 240 | Ga0207678_10000226 | 3300026067 | Bacteria | 50299 |
| 241 | Ga0207641_10009182 | 3300026088 | Bacteria | 8162 |
| 242 | Ga0207641_10020878 | 3300026088 | Bacteria | 5383 |
| 243 | Ga0207641_10048521 | 3300026088 | Bacteria | 3583 |
| 244 | Ga0207648_10038835 | 3300026089 | Bacteria | 4189 |
| 245 | Ga0207648_10058195 | 3300026089 | Bacteria | 3371 |
| 246 | Ga0207648_10095354 | 3300026089 | Bacteria | 2602 |
| 247 | Ga0207648_10107639 | 3300026089 | Bacteria | 2447 |
| 248 | Ga0207676_10015984 | 3300026095 | Bacteria | 5430 |
| 249 | Ga0207676_10021344 | 3300026095 | Bacteria | 4750 |
| 250 | Ga0207674_10019494 | 3300026116 | Bacteria | 7345 |
| 251 | Ga0207674_10066633 | 3300026116 | Bacteria | 3626 |
| 252 | Ga0207675_100000699 | 3300026118 | Bacteria | 33170 |
| 253 | Ga0207675_100076460 | 3300026118 | Bacteria | 3135 |
| 254 | Ga0207683_10000085 | 3300026121 | Bacteria | 73884 |
| 255 | Ga0207683_10015787 | 3300026121 | Bacteria | 6428 |
| 256 | Ga0207698_10012831 | 3300026142 | Bacteria | 5504 |
| 257 | Ga0207698_10026426 | 3300026142 | Bacteria | 4107 |
| 258 | Ga0209371_1000160 | 3300027312 | Bacteria | 103642 |
| 259 | Ga0268266_10026630 | 3300028379 | Bacteria | 4920 |
| 260 | Ga0268266_10091486 | 3300028379 | Bacteria | 2667 |
| 261 | Ga0268265_10021904 | 3300028380 | Bacteria | 4484 |
| 262 | Ga0268265_10144769 | 3300028380 | Bacteria | 1995 |
| 263 | Ga0268256_1000132 | 3300030500 | Bacteria | 103642 |
| 264 | Ga0316181_1138627 | 3300030744 | Bacteria | 1972 |
| 265 | Ga0265330_10006819 | 3300031235 | Bacteria | 5623 |
| 266 | Ga0265332_10001661 | 3300031238 | Bacteria | 12159 |
| 267 | Ga0265328_10006749 | 3300031239 | Bacteria | 4830 |
| 268 | Ga0265329_10004388 | 3300031242 | Bacteria | 5883 |
| 269 | Ga0265331_10000579 | 3300031250 | Bacteria | 32817 |
| 270 | Ga0265331_10005012 | 3300031250 | Bacteria | 8119 |
| 271 | Ga0265327_10000302 | 3300031251 | Bacteria | 95654 |
| 272 | Ga0265327_10003193 | 3300031251 | Bacteria | 15986 |
| 273 | Ga0265316_10104503 | 3300031344 | Bacteria | 2150 |
| 274 | Ga0307408_100001773 | 3300031548 | Bacteria | 15748 |
| 275 | Ga0265314_10009471 | 3300031711 | Bacteria | 8215 |
| 276 | Ga0307516_10107633 | 3300031730 | Bacteria | 2596 |
| 277 | Ga0316577_10025177 | 3300031733 | Bacteria | 3310 |
| 278 | Ga0307416_100004729 | 3300032002 | Bacteria | 8255 |
| 279 | Ga0307416_100006471 | 3300032002 | Bacteria | 7338 |
| 280 | Ga0373935_0053602 | 3300035692 | Bacteria | 2566 |
| 281 | Ga0373937_0032992 | 3300036401 | Bacteria | 4699 |
| 282 | Ga0316582_0013147 | 3300036647 | Bacteria | 4650 |
| 283 | Ga0395900_0000474 | 3300037418 | Bacteria | 57230 |
| 284 | Ga0395900_0000689 | 3300037418 | Bacteria | 45109 |
| 285 | Ga0395900_0047336 | 3300037418 | Bacteria | 4427 |
| 286 | Ga0395898_0004656 | 3300037466 | Bacteria | 14955 |
| 287 | Ga0395901_0000019 | 3300038443 | Bacteria | 317063 |
| 288 | Ga0395901_0000448 | 3300038443 | Bacteria | 47911 |
| 289 | Ga0436361_0062839 | 3300039447 | Bacteria | 58101 |
| 290 | Ga0436361_0298954 | 3300039447 | Bacteria | 16837 |
| 291 | Ga0439448_0000123 | 3300042005 | Bacteria | 14522 |
| 292 | Ga0439449_0000465 | 3300042007 | Bacteria | 15109 |
| 293 | Ga0451577_0000315 | 3300042876 | Bacteria | 92038 |
| 294 | Ga0466977_0000098 | 3300044666 | Bacteria | 18255 |
| 295 | Ga0466966_0032581 | 3300044684 | Bacteria | 3376 |
| 296 | Ga0453684_0001040 | 3300044712 | Bacteria | 88809 |
| 297 | Ga0453684_0030477 | 3300044712 | Bacteria | 7619 |
| 298 | Ga0466957_0124577 | 3300044842 | Bacteria | 1645 |
| 299 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 300 | Ga0451576_0000131 | 3300045051 | Bacteria | 190667 |
| 301 | Ga0466958_0064918 | 3300045836 | Bacteria | 2227 |
| 302 | Ga0495592_0015574 | 3300046454 | Bacteria | 5768 |
| 303 | Ga0495592_0120510 | 3300046454 | Bacteria | 1846 |
| 304 | Ga0495603_0013914 | 3300046455 | Bacteria | 4866 |
| 305 | Ga0495590_0008583 | 3300046457 | Bacteria | 3898 |
| 306 | Ga0495590_0023202 | 3300046457 | Bacteria | 2192 |
| 307 | Ga0495591_001790 | 3300046458 | Bacteria | 12729 |
| 308 | Ga0495629_0000041 | 3300046459 | Bacteria | 115135 |
| 309 | Ga0495629_0012956 | 3300046459 | Bacteria | 6029 |
| 310 | Ga0495629_0015579 | 3300046459 | Bacteria | 5457 |
| 311 | Ga0495638_0010321 | 3300046460 | Bacteria | 6496 |
| 312 | Ga0495651_0018070 | 3300046462 | Bacteria | 5458 |
| 313 | Ga0495651_0033153 | 3300046462 | Bacteria | 4028 |
| 314 | Ga0495651_0041725 | 3300046462 | Bacteria | 3563 |
| 315 | Ga0495653_0015181 | 3300046463 | Bacteria | 6279 |
| 316 | Ga0495653_0049679 | 3300046463 | Bacteria | 3229 |
| 317 | Ga0495653_0053554 | 3300046463 | Bacteria | 3086 |
| 318 | Ga0495650_0000084 | 3300046471 | Bacteria | 235690 |
| 319 | Ga0495580_0000483 | 3300046472 | Bacteria | 33249 |
| 320 | Ga0495580_0000497 | 3300046472 | Bacteria | 32912 |
| 321 | Ga0495580_0004287 | 3300046472 | Bacteria | 11995 |
| 322 | Ga0495580_0005465 | 3300046472 | Bacteria | 10504 |
| 323 | Ga0495580_0010550 | 3300046472 | Bacteria | 7190 |
| 324 | Ga0495582_0013809 | 3300046473 | Bacteria | 4447 |
| 325 | Ga0495605_0001100 | 3300046474 | Bacteria | 17990 |
| 326 | Ga0495605_0003028 | 3300046474 | Bacteria | 10144 |
| 327 | Ga0495662_0019048 | 3300046476 | Bacteria | 3321 |
| 328 | Ga0495662_0022335 | 3300046476 | Bacteria | 3056 |
| 329 | Ga0495664_0004801 | 3300046477 | Bacteria | 7392 |
| 330 | Ga0495585_0011381 | 3300046492 | Bacteria | 5265 |
| 331 | Ga0495596_0004440 | 3300046500 | Bacteria | 6829 |
| 332 | Ga0495596_0005409 | 3300046500 | Bacteria | 6037 |
| 333 | Ga0495596_0019621 | 3300046500 | Bacteria | 2776 |
| 334 | Ga0495583_0000609 | 3300046506 | Bacteria | 48438 |
| 335 | Ga0495583_0012412 | 3300046506 | Bacteria | 4821 |
| 336 | Ga0495606_0000075 | 3300046507 | Bacteria | 170038 |
| 337 | Ga0495606_0027842 | 3300046507 | Bacteria | 3998 |
| 338 | Ga0495606_0084979 | 3300046507 | Bacteria | 1958 |
| 339 | Ga0495608_0004020 | 3300046511 | Bacteria | 10554 |
| 340 | Ga0495608_0006949 | 3300046511 | Bacteria | 8013 |
| 341 | Ga0495616_0003657 | 3300046513 | Bacteria | 9821 |
| 342 | Ga0495616_0013000 | 3300046513 | Bacteria | 4707 |
| 343 | Ga0495618_0015191 | 3300046514 | Bacteria | 4698 |
| 344 | Ga0495618_0060142 | 3300046514 | Bacteria | 2408 |
| 345 | Ga0495620_0011729 | 3300046515 | Bacteria | 4558 |
| 346 | Ga0495628_0001453 | 3300046516 | Bacteria | 21731 |
| 347 | Ga0495628_0012493 | 3300046516 | Bacteria | 7158 |
| 348 | Ga0495628_0049454 | 3300046516 | Bacteria | 3329 |
| 349 | Ga0495630_0008632 | 3300046517 | Bacteria | 7313 |
| 350 | Ga0495630_0009354 | 3300046517 | Bacteria | 7044 |
| 351 | Ga0495630_0077529 | 3300046517 | Bacteria | 2505 |
| 352 | Ga0495644_0000683 | 3300046523 | Bacteria | 14091 |
| 353 | Ga0495644_0000809 | 3300046523 | Bacteria | 12896 |
| 354 | Ga0495648_0004880 | 3300046524 | Bacteria | 11297 |
| 355 | Ga0495648_0006910 | 3300046524 | Bacteria | 9152 |
| 356 | Ga0495648_0016382 | 3300046524 | Bacteria | 5347 |
| 357 | Ga0495648_0018115 | 3300046524 | Bacteria | 5005 |
| 358 | Ga0495648_0036250 | 3300046524 | Bacteria | 3185 |
| 359 | Ga0495666_0005526 | 3300046526 | Bacteria | 6365 |
| 360 | Ga0495666_0007842 | 3300046526 | Bacteria | 5346 |
| 361 | Ga0495652_0005080 | 3300046529 | Bacteria | 12452 |
| 362 | Ga0495652_0029637 | 3300046529 | Bacteria | 4807 |
| 363 | Ga0495652_0077784 | 3300046529 | Bacteria | 2748 |
| 364 | Ga0495652_0208219 | 3300046529 | Bacteria | 1479 |
| 365 | Ga0495665_0017829 | 3300046531 | Bacteria | 3816 |
| 366 | Ga0495640_0018174 | 3300046533 | Bacteria | 5223 |
| 367 | Ga0495640_0031161 | 3300046533 | Bacteria | 3808 |
| 368 | Ga0495586_0000941 | 3300046535 | Bacteria | 16504 |
| 369 | Ga0495587_0009399 | 3300046536 | Bacteria | 6267 |
| 370 | Ga0495587_0014043 | 3300046536 | Bacteria | 5029 |
| 371 | Ga0495609_0003812 | 3300046538 | Bacteria | 8476 |
| 372 | Ga0495645_0099018 | 3300046543 | Bacteria | 2075 |
| 373 | Ga0495633_0012413 | 3300046558 | Bacteria | 4531 |
| 374 | Ga0495634_0010774 | 3300046642 | Bacteria | 6687 |
| 375 | Ga0495634_0011168 | 3300046642 | Bacteria | 6551 |
| 376 | Ga0495611_0002122 | 3300046648 | Bacteria | 9282 |
| 377 | Ga0495611_0002293 | 3300046648 | Bacteria | 8858 |
| 378 | Ga0495625_0000888 | 3300046660 | Bacteria | 40400 |
| 379 | Ga0495625_0040657 | 3300046660 | Bacteria | 3388 |
| 380 | Ga0495625_0041176 | 3300046660 | Bacteria | 3364 |
| 381 | Ga0495635_0012192 | 3300046663 | Bacteria | 6027 |
| 382 | Ga0495635_0024821 | 3300046663 | Bacteria | 4177 |
| 383 | Ga0495661_0012406 | 3300046665 | Bacteria | 5753 |
| 384 | Ga0495661_0020675 | 3300046665 | Bacteria | 4294 |
| 385 | Ga0495599_0017063 | 3300046678 | Bacteria | 4511 |
| 386 | Ga0495599_0024960 | 3300046678 | Bacteria | 3739 |
| 387 | Ga0495623_0018520 | 3300046679 | Bacteria | 4497 |
| 388 | Ga0495623_0044242 | 3300046679 | Bacteria | 2830 |
| 389 | Ga0495623_0059034 | 3300046679 | Bacteria | 2411 |
| 390 | Ga0495646_0009890 | 3300046680 | Bacteria | 6060 |
| 391 | Ga0495646_0018672 | 3300046680 | Bacteria | 4391 |
| 392 | Ga0495613_0080313 | 3300046689 | Bacteria | 2370 |
| 393 | Ga0495624_0004140 | 3300046690 | Bacteria | 10661 |
| 394 | Ga0495624_0011627 | 3300046690 | Bacteria | 6046 |
| 395 | Ga0495624_0014986 | 3300046690 | Bacteria | 5250 |
| 396 | Ga0495624_0039993 | 3300046690 | Bacteria | 3004 |
| 397 | Ga0495670_0002454 | 3300046691 | Bacteria | 9160 |
| 398 | Ga0495671_0009423 | 3300046692 | Bacteria | 5451 |
| 399 | Ga0495671_0023223 | 3300046692 | Bacteria | 3241 |
| 400 | Ga0495589_0005085 | 3300046794 | Bacteria | 6960 |
| 401 | Ga0495589_0005886 | 3300046794 | Bacteria | 6477 |
| 402 | Ga0495600_0000303 | 3300046809 | Bacteria | 26375 |
| 403 | Ga0495604_0002457 | 3300047317 | Bacteria | 14822 |
| 404 | Ga0495604_0005502 | 3300047317 | Bacteria | 10042 |
| 405 | Ga0495604_0007470 | 3300047317 | Bacteria | 8653 |
| 406 | Ga0495604_0103031 | 3300047317 | Bacteria | 2094 |
| 407 | Ga0495636_0007374 | 3300047318 | Bacteria | 4328 |
| 408 | Ga0495674_0017721 | 3300047319 | Bacteria | 6631 |
| 409 | Ga0495674_0027591 | 3300047319 | Bacteria | 5187 |
| 410 | Ga0495672_0000498 | 3300047320 | Bacteria | 45426 |
| 411 | Ga0495672_0021035 | 3300047320 | Bacteria | 4260 |
| 412 | Ga0495676_0012517 | 3300047321 | Bacteria | 7639 |
| 413 | Ga0495680_0054529 | 3300047322 | Bacteria | 3103 |
| 414 | Ga0495680_0065303 | 3300047322 | Bacteria | 2787 |
| 415 | Ga0495683_0001076 | 3300047323 | Bacteria | 18894 |
| 416 | Ga0495683_0001837 | 3300047323 | Bacteria | 13332 |
| 417 | Ga0495683_0010814 | 3300047323 | Bacteria | 4812 |
| 418 | Ga0495687_001078 | 3300047443 | Bacteria | 26839 |
| 419 | Ga0495687_007773 | 3300047443 | Bacteria | 6244 |
| 420 | Ga0495675_0012913 | 3300047444 | Bacteria | 5263 |
| 421 | Ga0495677_0000842 | 3300047445 | Bacteria | 12382 |
| 422 | Ga0495677_0028555 | 3300047445 | Bacteria | 2026 |
| 423 | Ga0495679_000007 | 3300047446 | Bacteria | 401482 |
| 424 | Ga0495679_005101 | 3300047446 | Bacteria | 5893 |
| 425 | Ga0495679_009170 | 3300047446 | Bacteria | 3979 |
| 426 | Ga0495685_000482 | 3300047447 | Bacteria | 12407 |
| 427 | Ga0495673_0021003 | 3300047469 | Bacteria | 3235 |
| 428 | Ga0495673_0029415 | 3300047469 | Bacteria | 2592 |
| 429 | Ga0495684_0030428 | 3300047471 | Bacteria | 4145 |
| 430 | Ga0495686_0000865 | 3300047472 | Bacteria | 38738 |
| 431 | Ga0495686_0000867 | 3300047472 | Bacteria | 38673 |
| 432 | Ga0495593_0026167 | 3300047673 | Bacteria | 3224 |
| 433 | Ga0495602_0005576 | 3300048088 | Bacteria | 13208 |
| 434 | Ga0495602_0024026 | 3300048088 | Bacteria | 5920 |
| 435 | Ga0495602_0099151 | 3300048088 | Bacteria | 2395 |
| 436 | Ga0495614_0006125 | 3300048089 | Bacteria | 5406 |
| 437 | Ga0495626_0000043 | 3300048091 | Bacteria | 168109 |
| 438 | Ga0495626_0010010 | 3300048091 | Bacteria | 5090 |
| 439 | Ga0495626_0029104 | 3300048091 | Bacteria | 2676 |
| 440 | Ga0496100_0016070 | 3300048903 | Bacteria | 4385 |
| 441 | Ga0496101_0042608 | 3300048904 | Bacteria | 3240 |
| 442 | Ga0496103_0022302 | 3300048906 | Bacteria | 3812 |
| 443 | Ga0496104_0027465 | 3300048907 | Bacteria | 5266 |
| 444 | Ga0496106_0000071 | 3300048909 | Bacteria | 82296 |
| 445 | Ga0496106_0061356 | 3300048909 | Bacteria | 2852 |
| 446 | Ga0496109_0103548 | 3300048912 | Bacteria | 2642 |
| 447 | Ga0496109_0244006 | 3300048912 | Bacteria | 1691 |
| 448 | Ga0496112_0002284 | 3300048915 | Bacteria | 15335 |
| 449 | Ga0496112_0094994 | 3300048915 | Bacteria | 2952 |
| 450 | Ga0496113_0000731 | 3300048916 | Bacteria | 16836 |
| 451 | Ga0496113_0001940 | 3300048916 | Bacteria | 11841 |
| 452 | Ga0496115_0013026 | 3300048918 | Bacteria | 6278 |
| 453 | Ga0496116_0046349 | 3300048919 | Bacteria | 2934 |
| 454 | Ga0496116_0057681 | 3300048919 | Bacteria | 2537 |
| 455 | Ga0496117_0000530 | 3300048920 | Bacteria | 62705 |
| 456 | Ga0496117_0009247 | 3300048920 | Bacteria | 9211 |
| 457 | Ga0496117_0034074 | 3300048920 | Bacteria | 3843 |
| 458 | Ga0496118_0001972 | 3300048921 | Bacteria | 29128 |
| 459 | Ga0496118_0002189 | 3300048921 | Bacteria | 27169 |
| 460 | Ga0496118_0014236 | 3300048921 | Bacteria | 7459 |
| 461 | Ga0496118_0029985 | 3300048921 | Bacteria | 4552 |
| 462 | Ga0496118_0056276 | 3300048921 | Bacteria | 2958 |
| 463 | Ga0496118_0056708 | 3300048921 | Bacteria | 2942 |
| 464 | Ga0496121_0000333 | 3300048924 | Bacteria | 98583 |
| 465 | Ga0496121_0006639 | 3300048924 | Bacteria | 14244 |
| 466 | Ga0496121_0046875 | 3300048924 | Bacteria | 3694 |
| 467 | Ga0496121_0079586 | 3300048924 | Bacteria | 2601 |
| 468 | Ga0496121_0148248 | 3300048924 | Bacteria | 1730 |
| 469 | Ga0496122_0000375 | 3300048925 | Bacteria | 95681 |
| 470 | Ga0496123_0000267 | 3300048926 | Bacteria | 104282 |
| 471 | Ga0496124_0002800 | 3300048927 | Bacteria | 22098 |
| 472 | Ga0496125_0000694 | 3300048928 | Bacteria | 55573 |
| 473 | Ga0496126_0000088 | 3300048929 | Bacteria | 212256 |
| 474 | Ga0496126_0003517 | 3300048929 | Bacteria | 19714 |
| 475 | Ga0496126_0006313 | 3300048929 | Bacteria | 13235 |
| 476 | Ga0496126_0006824 | 3300048929 | Bacteria | 12666 |
| 477 | Ga0495682_0000398 | 3300049460 | Bacteria | 31324 |
| 478 | Ga0495682_0001576 | 3300049460 | Bacteria | 11883 |
| 479 | Ga0495682_0025822 | 3300049460 | Bacteria | 2184 |
| 480 | Ga0501038_0147078 | 3300049574 | Bacteria | 1923 |
| 481 | Ga0501043_0041340 | 3300049579 | Bacteria | 3622 |
| 482 | Ga0501047_0200012 | 3300049581 | Bacteria | 1859 |
| 483 | Ga0501073_0188914 | 3300049589 | Bacteria | 1425 |
| 484 | Ga0501080_0092618 | 3300049742 | Bacteria | 2807 |
| 485 | Ga0501279_001782 | 3300049775 | Bacteria | 2840 |
| 486 | Ga0501035_0002740 | 3300049822 | Bacteria | 17085 |
| 487 | Ga0501035_0058201 | 3300049822 | Bacteria | 3445 |
| 488 | Ga0500588_0000145 | 3300053146 | Bacteria | 9474 |
| 489 | Ga0501084_0000347 | 3300054114 | Bacteria | 35283 |
| 490 | Ga0501082_0014699 | 3300060353 | Bacteria | 6742 |
| 491 | 2501070797 | 2501025501 | Bacteria | 7768574 |
| 492 | 2501080322 | 2501025502 | Bacteria | 9641094 |
| 493 | 2501413631 | 2501025504 | Bacteria | 8008976 |
| 494 | 2511089702 | 2510917013 | Bacteria | 9951648 |
| 495 | 2511095099 | 2510917014 | Bacteria | 8296963 |
| 496 | 2511104758 | 2510917015 | Bacteria | 7950052 |
| 497 | 2511248903 | 2511231003 | Bacteria | 5606035 |
| 498 | 2512347356 | 2512047030 | Bacteria | 9031815 |
| 499 | 2513551386 | 2513237082 | Bacteria | 8640282 |
| 500 | 2513560028 | 2513237083 | Bacteria | 8410967 |
| 501 | 2513704744 | 2513237102 | Bacteria | 7703324 |
| 502 | 2514048024 | 2513237166 | Bacteria | 10373764 |
| 503 | 2515685313 | 2515154122 | Bacteria | 8609520 |
| 504 | 2515687956 | 2515154123 | Bacteria | 6387382 |
| 505 | 2519459860 | 2519103095 | Bacteria | 6629912 |
| 506 | 2521558934 | 2521172590 | Bacteria | 5047645 |
| 507 | 2550697207 | 2548876994 | Bacteria | 4904866 |
| 508 | 2553003742 | 2551306416 | Bacteria | 6152985 |
| 509 | 2563060031 | 2562617112 | Bacteria | 10918404 |
| 510 | 2585290624 | 2582581311 | Bacteria | 6763856 |
| 511 | 2599740232 | 2599185239 | Bacteria | 8686614 |
| 512 | 2599744092 | 2599185240 | Bacteria | 7968121 |
| 513 | 2600210827 | 2599185355 | Bacteria | 7968906 |
| 514 | 2643791181 | 2643221554 | Bacteria | 6603920 |
| 515 | 2644215390 | 2643221638 | Bacteria | 6579467 |
| 516 | 2652975140 | 2651869818 | Bacteria | 5864031 |
| 517 | 2676743557 | 2675903129 | Bacteria | 7964495 |
| 518 | 2713479252 | 2711768613 | Bacteria | 11048459 |
| 519 | 2723876223 | 2721755763 | Bacteria | 4464185 |
| 520 | 2746086361 | 2744054900 | Bacteria | 8399525 |
| 521 | 2746093361 | 2744054901 | Bacteria | 8397047 |
| 522 | 2753566267 | 2751185846 | Bacteria | 7242164 |
| 523 | 2765568830 | 2765235838 | Bacteria | 5445269 |
| 524 | 2792834689 | 2791355137 | Bacteria | 9654227 |
| 525 | 2808968323 | 2808606384 | Bacteria | 8474373 |
| 526 | 2809003154 | 2808606390 | Bacteria | 8476311 |
| 527 | 2809010431 | 2808606391 | Bacteria | 8308166 |
| 528 | 2809130665 | 2808606415 | Bacteria | 4576710 |
| 529 | 2809146086 | 2808606418 | Bacteria | 6724496 |
| 530 | 2809149857 | 2808606419 | Bacteria | 4576925 |
| 531 | 2817262144 | 2816332253 | Bacteria | 6764532 |
| 532 | 2817279845 | 2816332256 | Bacteria | 6891714 |
| 533 | 2817455550 | 2816332286 | Bacteria | 6853759 |
| 534 | 2819542394 | 2818991436 | Bacteria | 5376622 |
| 535 | 2819591364 | 2818991445 | Bacteria | 4955017 |
| 536 | 2819615456 | 2818991449 | Bacteria | 5518009 |
| 537 | 2819623933 | 2818991450 | Bacteria | 6962147 |
| 538 | 2819633695 | 2818991452 | Bacteria | 8442785 |
| 539 | 2821444684 | 2821443989 | Bacteria | 7658172 |
| 540 | 2829749734 | 2829745981 | Bacteria | 5406054 |
| 541 | 2839096289 | 2839094727 | Bacteria | 5534556 |
| 542 | 2842331828 | 2842324504 | Bacteria | 9364110 |
| 543 | 2842356141 | 2842348783 | Bacteria | 9002918 |
| 544 | 2842459341 | 2842454564 | Bacteria | 8730687 |
| 545 | 2852620001 | 2852618963 | Bacteria | 4577824 |
| 546 | 2855732953 | 2855730933 | Bacteria | 7047938 |
| 547 | 2855771705 | 2855767633 | Bacteria | 7049357 |
| 548 | 2856293254 | 2856287931 | Bacteria | 7223934 |
| 549 | 2857366627 | 2857357740 | Bacteria | 9937880 |
| 550 | 2863427296 | 2863421361 | Bacteria | 7300805 |
| 551 | 2870070097 | 2870068957 | Bacteria | 8925310 |
| 552 | 2881415758 | 2881412998 | Bacteria | 6492157 |
| 553 | 2883090527 | 2883087390 | Bacteria | 9532701 |
| 554 | 2884812918 | 2884811622 | Bacteria | 5552861 |
| 555 | 2884837160 | 2884836552 | Bacteria | 5219991 |
| 556 | 2884853452 | 2884852848 | Bacteria | 5221161 |
| 557 | 2885278546 | 2885270888 | Bacteria | 9831543 |
| 558 | 2894513734 | 2894510363 | Bacteria | 5121143 |
| 559 | 2896155431 | 2896154374 | Bacteria | 5221518 |
| 560 | 2900636405 | 2900634093 | Bacteria | 10263517 |
| 561 | 2902689101 | 2902682994 | Bacteria | 8951596 |
| 562 | 2904437382 | 2904434214 | Bacteria | 6230908 |
| 563 | 2904444625 | 2904439833 | Bacteria | 5931679 |
| 564 | 2904534720 | 2904530477 | Bacteria | 5876334 |
| 565 | 2904567678 | 2904564687 | Bacteria | 7609577 |
| 566 | 2904574920 | 2904571731 | Bacteria | 7608790 |
| 567 | 2904584609 | 2904584206 | Bacteria | 6028872 |
| 568 | 2904591076 | 2904589729 | Bacteria | 6113573 |
| 569 | 2904605296 | 2904601388 | Bacteria | 5884906 |
| 570 | 2904619076 | 2904615490 | Bacteria | 10047340 |
| 571 | 2919048464 | 2919046199 | Bacteria | 5567169 |
| 572 | 2919081015 | 2919079590 | Bacteria | 5946433 |
| 573 | 2919496071 | 2919493220 | Bacteria | 4598500 |
| 574 | 2919544349 | 2919543075 | Bacteria | 4728703 |
| 575 | 2921644141 | 2921643360 | Bacteria | 11448031 |
| 576 | 2923512595 | 2923510766 | Bacteria | 5926163 |
| 577 | 2923527891 | 2923525760 | Bacteria | 4472324 |
| 578 | 2928109502 | 2928108538 | Bacteria | 7360024 |
| 579 | 2928132626 | 2928130867 | Bacteria | 5467269 |
| 580 | 2928137044 | 2928135762 | Bacteria | 7259641 |
| 581 | 2928162052 | 2928157003 | Bacteria | 7522202 |
| 582 | 2928169282 | 2928163908 | Bacteria | 7561269 |
| 583 | 2928175453 | 2928170801 | Bacteria | 8785406 |
| 584 | 2928506572 | 2928503688 | Bacteria | 7268108 |
| 585 | 2928538989 | 2928536128 | Bacteria | 7657547 |
| 586 | 2981992802 | 2981990288 | Bacteria | 7590678 |
| 587 | 642418053 | 641736154 | Bacteria | 7689995 |
| 588 | 642592062 | 642555112 | Bacteria | 8676562 |
| 589 | 642620132 | 642555113 | Bacteria | 8214658 |
| 590 | 651175182 | 651053060 | Bacteria | 4689946 |
| 591 | 8003957293 | 8003955200 | Bacteria | 8601927 |
| 592 | 8018846266 | 8018845410 | Bacteria | 8933938 |
| 593 | 8020814250 | 8020807995 | Bacteria | 6801506 |
| 594 | 8020940010 | 8020938398 | Bacteria | 7472757 |
| 595 | 8020950361 | 8020945358 | Bacteria | 8467355 |
| 596 | 8020954707 | 8020953355 | Bacteria | 7439080 |
| 597 | 8021125552 | 8021120328 | Bacteria | 8782274 |
| 598 | 8039104491 | 8039098773 | Bacteria | 6602928 |
| 599 | 8040172105 | 8040167225 | Bacteria | 6542727 |
| 600 | 8040173986 | 8040173305 | Bacteria | 6827067 |
| 601 | Ga0436361_0171277 | |||
| 602 | JGI24739J22299_10002703 | |||
| 603 | JGI24739J22299_10004190 | |||
| 604 | JGI24735J21928_10005480 | |||
| 605 | JGI24735J21928_10010883 | |||
| 606 | JGI25156J39149_1000394 | |||
| 607 | JGI25162J39368_1000131 | |||
| 608 | JGI25162J39368_1000370 | |||
| 609 | JGI25157J39369_1000336 | |||
| 610 | JGI25159J45721_1001417 | |||
| 611 | JGI25165J46597_1000022 | |||
| 612 | rootL2_10003512 | |||
| 613 | JGI25161J50226_1000334 | |||
| 614 | Ga0055538_1000011 | |||
| 615 | Ga0055538_1000016 | |||
| 616 | Ga0055539_1000016 | |||
| 617 | Ga0055539_1000021 | |||
| 618 | Ga0055533_1000019 | |||
| 619 | Ga0055533_1000029 | |||
| 620 | Ga0055532_1000016 | |||
| 621 | Ga0055525_1000033 | |||
| 622 | Ga0055525_1000042 | |||
| 623 | Ga0055525_1000173 | |||
| 624 | Ga0055535_1006543 | |||
| 625 | Ga0055528_1004616 | |||
| 626 | Ga0055541_1000017 | |||
| 627 | Ga0055541_1000045 | |||
| 628 | Ga0055541_1000084 | |||
| 629 | Ga0058692_1001492 | |||
| 630 | Ga0065165_1000115 | |||
| 631 | Ga0065165_1000820 | |||
| 632 | Ga0070658_10060519 | |||
| 633 | Ga0070676_10000216 | |||
| 634 | Ga0070676_10016463 | |||
| 635 | Ga0070670_100007274 | |||
| 636 | Ga0070670_100026782 | |||
| 637 | Ga0070670_100049102 | |||
| 638 | Ga0070670_100069477 | |||
| 639 | Ga0070677_10001090 | |||
| 640 | Ga0068868_100026555 | |||
| 641 | Ga0070660_100000001 | |||
| 642 | Ga0070660_100005558 | |||
| 643 | Ga0070689_100043520 | |||
| 644 | Ga0070661_100045377 | |||
| 645 | Ga0070661_100102914 | |||
| 646 | Ga0070668_100003734 | |||
| 647 | Ga0070668_100008159 | |||
| 648 | Ga0070668_100119545 | |||
| 649 | Ga0070669_100033238 | |||
| 650 | Ga0070675_100028574 | |||
| 651 | Ga0070671_100000488 | |||
| 652 | Ga0070671_100002449 | |||
| 653 | Ga0070671_100056008 | |||
| 654 | Ga0070674_100058342 | |||
| 655 | Ga0070673_100001385 | |||
| 656 | Ga0070673_100058175 | |||
| 657 | Ga0070659_100000941 | |||
| 658 | Ga0070667_100002852 | |||
| 659 | Ga0070667_100009065 | |||
| 660 | Ga0070667_100011417 | |||
| 661 | Ga0070667_100148645 | |||
| 662 | Ga0070705_100014573 | |||
| 663 | Ga0070663_100000078 | |||
| 664 | Ga0070662_100023396 | |||
| 665 | Ga0068867_100028402 | |||
| 666 | Ga0068867_100029557 | |||
| 667 | Ga0070698_100151336 | |||
| 668 | Ga0070679_100080152 | |||
| 669 | Ga0070697_100113282 | |||
| 670 | Ga0070672_100003644 | |||
| 671 | Ga0070672_100015142 | |||
| 672 | Ga0070672_100110695 | |||
| 673 | Ga0070695_100043069 | |||
| 674 | Ga0070665_100004317 | |||
| 675 | Ga0070664_100075214 | |||
| 676 | Ga0068852_100000705 | |||
| 677 | Ga0068852_100006811 | |||
| 678 | Ga0068852_100014873 | |||
| 679 | Ga0068852_100046989 | |||
| 680 | Ga0068859_100004214 | |||
| 681 | Ga0068864_100010031 | |||
| 682 | Ga0068864_100015176 | |||
| 683 | Ga0068864_100057215 | |||
| 684 | Ga0068851_10000160 | |||
| 685 | Ga0068870_10004282 | |||
| 686 | Ga0068870_10007671 | |||
| 687 | Ga0068863_100010612 | |||
| 688 | Ga0068863_100018285 | |||
| 689 | Ga0068863_100021755 | |||
| 690 | Ga0068863_100032354 | |||
| 691 | Ga0068863_100162928 | |||
| 692 | Ga0068858_100007336 | |||
| 693 | Ga0068858_100087800 | |||
| 694 | Ga0097621_100007151 | |||
| 695 | Ga0097621_100109799 | |||
| 696 | Ga0097621_100152802 | |||
| 697 | Ga0068871_100017293 | |||
| 698 | Ga0068865_100037737 | |||
| 699 | Ga0097620_100004214 | |||
| 700 | Ga0105251_10000055 | |||
| 701 | Ga0105240_10000497 | |||
| 702 | Ga0105240_10070042 | |||
| 703 | Ga0105240_10194130 | |||
| 704 | Ga0105245_10031217 | |||
| 705 | Ga0105243_10138348 | |||
| 706 | Ga0105241_10008358 | |||
| 707 | Ga0105242_10069431 | |||
| 708 | Ga0105248_10000001 | |||
| 709 | Ga0105248_10038841 | |||
| 710 | Ga0105248_10150285 | |||
| 711 | Ga0105248_10209610 | |||
| 712 | Ga0105237_10012980 | |||
| 713 | Ga0105237_10022717 | |||
| 714 | Ga0105238_10000117 | |||
| 715 | Ga0105238_10018532 | |||
| 716 | Ga0105238_10076900 | |||
| 717 | Ga0105239_10055330 | |||
| 718 | Ga0105246_10040640 | |||
| 719 | Ga0157369_10102804 | |||
| 720 | Ga0157378_10013177 | |||
| 721 | Ga0163162_10029670 | |||
| 722 | Ga0163162_10035122 | |||
| 723 | Ga0163162_10054879 | |||
| 724 | Ga0157372_10131383 | |||
| 725 | Ga0157375_10063213 | |||
| 726 | Ga0157375_10155709 | |||
| 727 | Ga0163163_10164829 | |||
| 728 | Ga0157380_10101637 | |||
| 729 | Ga0182008_10038540 | |||
| 730 | Ga0157376_10025923 | |||
| 731 | Ga0182006_1002575 | |||
| 732 | Ga0182007_10001200 | |||
| 733 | Ga0182005_1000351 | |||
| 734 | Ga0182005_1006031 | |||
| 735 | Ga0183361_10001 | |||
| 736 | Ga0163161_10027953 | |||
| 737 | Ga0213872_10000494 | |||
| 738 | Ga0213872_10000677 | |||
| 739 | Ga0213872_10018758 | |||
| 740 | Ga0209435_100016 | |||
| 741 | Ga0209435_100038 | |||
| 742 | Ga0209435_100096 | |||
| 743 | Ga0209436_100502 | |||
| 744 | Ga0209784_100019 | |||
| 745 | Ga0209784_100033 | |||
| 746 | Ga0209566_100017 | |||
| 747 | Ga0209566_100037 | |||
| 748 | Ga0209566_100164 | |||
| 749 | Ga0209674_100031 | |||
| 750 | Ga0209674_100055 | |||
| 751 | Ga0209674_101916 | |||
| 752 | Ga0209672_100046 | |||
| 753 | Ga0209672_100088 | |||
| 754 | Ga0209147_100023 | |||
| 755 | Ga0209147_100043 | |||
| 756 | Ga0209147_100130 | |||
| 757 | Ga0209147_100214 | |||
| 758 | Ga0209563_100035 | |||
| 759 | Ga0209563_100056 | |||
| 760 | Ga0209437_100038 | |||
| 761 | Ga0209437_100080 | |||
| 762 | Ga0209258_100023 | |||
| 763 | Ga0209258_100204 | |||
| 764 | Ga0209258_100210 | |||
| 765 | Ga0209646_1000033 | |||
| 766 | Ga0209646_1000093 | |||
| 767 | Ga0209026_1000031 | |||
| 768 | Ga0209677_100020 | |||
| 769 | Ga0209677_100034 | |||
| 770 | Ga0209148_1000029 | |||
| 771 | Ga0209148_1000488 | |||
| 772 | Ga0209759_1000045 | |||
| 773 | Ga0209759_1000175 | |||
| 774 | Ga0209759_1000248 | |||
| 775 | Ga0209233_1000049 | |||
| 776 | Ga0209455_1000064 | |||
| 777 | Ga0209455_1001513 | |||
| 778 | Ga0209673_1000084 | |||
| 779 | Ga0209130_1000629 | |||
| 780 | Ga0209564_1012115 | |||
| 781 | Ga0207426_1000007 | |||
| 782 | Ga0207656_10000579 | |||
| 783 | Ga0207713_1000089 | |||
| 784 | Ga0207713_1000106 | |||
| 785 | Ga0207680_10022248 | |||
| 786 | Ga0207680_10116983 | |||
| 787 | Ga0207647_10000540 | |||
| 788 | Ga0207647_10032089 | |||
| 789 | Ga0207645_10003305 | |||
| 790 | Ga0207645_10045666 | |||
| 791 | Ga0207643_10023328 | |||
| 792 | Ga0207654_10000377 | |||
| 793 | Ga0207707_10092147 | |||
| 794 | Ga0207695_10001268 | |||
| 795 | Ga0207695_10015644 | |||
| 796 | Ga0207695_10045013 | |||
| 797 | Ga0207671_10027390 | |||
| 798 | Ga0207671_10039989 | |||
| 799 | Ga0207657_10000022 | |||
| 800 | Ga0207657_10010163 | |||
| 801 | Ga0207649_10028303 | |||
| 802 | Ga0207646_10020487 | |||
| 803 | Ga0207681_10109236 | |||
| 804 | Ga0207681_10148134 | |||
| 805 | Ga0207694_10000103 | |||
| 806 | Ga0207694_10008678 | |||
| 807 | Ga0207650_10009704 | |||
| 808 | Ga0207650_10015726 | |||
| 809 | Ga0207650_10095015 | |||
| 810 | Ga0207659_10001785 | |||
| 811 | Ga0207659_10007159 | |||
| 812 | Ga0207659_10036345 | |||
| 813 | Ga0207644_10069150 | |||
| 814 | Ga0207690_10000010 | |||
| 815 | Ga0207706_10044172 | |||
| 816 | Ga0207706_10050757 | |||
| 817 | Ga0207686_10022236 | |||
| 818 | Ga0207669_10040622 | |||
| 819 | Ga0207691_10000379 | |||
| 820 | Ga0207691_10001760 | |||
| 821 | Ga0207691_10007201 | |||
| 822 | Ga0207691_10048743 | |||
| 823 | Ga0207711_10000001 | |||
| 824 | Ga0207711_10015556 | |||
| 825 | Ga0207689_10000049 | |||
| 826 | Ga0207679_10038059 | |||
| 827 | Ga0207679_10110517 | |||
| 828 | Ga0207667_10000073 | |||
| 829 | Ga0207667_10000076 | |||
| 830 | Ga0207667_10000147 | |||
| 831 | Ga0207667_10000166 | |||
| 832 | Ga0207651_10058023 | |||
| 833 | Ga0207668_10000663 | |||
| 834 | Ga0207668_10043808 | |||
| 835 | Ga0207668_10130684 | |||
| 836 | Ga0207658_10029875 | |||
| 837 | Ga0207658_10044034 | |||
| 838 | Ga0207658_10113189 | |||
| 839 | Ga0207639_10033215 | |||
| 840 | Ga0207678_10000226 | |||
| 841 | Ga0207641_10009182 | |||
| 842 | Ga0207641_10020878 | |||
| 843 | Ga0207641_10048521 | |||
| 844 | Ga0207648_10038835 | |||
| 845 | Ga0207648_10058195 | |||
| 846 | Ga0207648_10095354 | |||
| 847 | Ga0207648_10107639 | |||
| 848 | Ga0207676_10015984 | |||
| 849 | Ga0207676_10021344 | |||
| 850 | Ga0207674_10019494 | |||
| 851 | Ga0207674_10066633 | |||
| 852 | Ga0207675_100000699 | |||
| 853 | Ga0207675_100076460 | |||
| 854 | Ga0207683_10000085 | |||
| 855 | Ga0207683_10015787 | |||
| 856 | Ga0207698_10012831 | |||
| 857 | Ga0207698_10026426 | |||
| 858 | Ga0209371_1000160 | |||
| 859 | Ga0268266_10026630 | |||
| 860 | Ga0268266_10091486 | |||
| 861 | Ga0268265_10021904 | |||
| 862 | Ga0268265_10144769 | |||
| 863 | Ga0268256_1000132 | |||
| 864 | Ga0316181_1138627 | |||
| 865 | Ga0265330_10006819 | |||
| 866 | Ga0265332_10001661 | |||
| 867 | Ga0265328_10006749 | |||
| 868 | Ga0265329_10004388 | |||
| 869 | Ga0265331_10000579 | |||
| 870 | Ga0265331_10005012 | |||
| 871 | Ga0265327_10000302 | |||
| 872 | Ga0265327_10003193 | |||
| 873 | Ga0265316_10104503 | |||
| 874 | Ga0307408_100001773 | |||
| 875 | Ga0265314_10009471 | |||
| 876 | Ga0307516_10107633 | |||
| 877 | Ga0316577_10025177 | |||
| 878 | Ga0307416_100004729 | |||
| 879 | Ga0307416_100006471 | |||
| 880 | Ga0373935_0053602 | |||
| 881 | Ga0373937_0032992 | |||
| 882 | Ga0316582_0013147 | |||
| 883 | Ga0395900_0000474 | |||
| 884 | Ga0395900_0000689 | |||
| 885 | Ga0395900_0047336 | |||
| 886 | Ga0395898_0004656 | |||
| 887 | Ga0395901_0000019 | |||
| 888 | Ga0395901_0000448 | |||
| 889 | Ga0436361_0062839 | |||
| 890 | Ga0436361_0298954 | |||
| 891 | Ga0439448_0000123 | |||
| 892 | Ga0439449_0000465 | |||
| 893 | Ga0451577_0000315 | |||
| 894 | Ga0466977_0000098 | |||
| 895 | Ga0466966_0032581 | |||
| 896 | Ga0453684_0001040 | |||
| 897 | Ga0453684_0030477 | |||
| 898 | Ga0466957_0124577 | |||
| 899 | Ga0451576_0000034 | |||
| 900 | Ga0451576_0000131 | |||
| 901 | Ga0466958_0064918 | |||
| 902 | Ga0495592_0015574 | |||
| 903 | Ga0495592_0120510 | |||
| 904 | Ga0495603_0013914 | |||
| 905 | Ga0495590_0008583 | |||
| 906 | Ga0495590_0023202 | |||
| 907 | Ga0495591_001790 | |||
| 908 | Ga0495629_0000041 | |||
| 909 | Ga0495629_0012956 | |||
| 910 | Ga0495629_0015579 | |||
| 911 | Ga0495638_0010321 | |||
| 912 | Ga0495651_0018070 | |||
| 913 | Ga0495651_0033153 | |||
| 914 | Ga0495651_0041725 | |||
| 915 | Ga0495653_0015181 | |||
| 916 | Ga0495653_0049679 | |||
| 917 | Ga0495653_0053554 | |||
| 918 | Ga0495650_0000084 | |||
| 919 | Ga0495580_0000483 | |||
| 920 | Ga0495580_0000497 | |||
| 921 | Ga0495580_0004287 | |||
| 922 | Ga0495580_0005465 | |||
| 923 | Ga0495580_0010550 | |||
| 924 | Ga0495582_0013809 | |||
| 925 | Ga0495605_0001100 | |||
| 926 | Ga0495605_0003028 | |||
| 927 | Ga0495662_0019048 | |||
| 928 | Ga0495662_0022335 | |||
| 929 | Ga0495664_0004801 | |||
| 930 | Ga0495585_0011381 | |||
| 931 | Ga0495596_0004440 | |||
| 932 | Ga0495596_0005409 | |||
| 933 | Ga0495596_0019621 | |||
| 934 | Ga0495583_0000609 | |||
| 935 | Ga0495583_0012412 | |||
| 936 | Ga0495606_0000075 | |||
| 937 | Ga0495606_0027842 | |||
| 938 | Ga0495606_0084979 | |||
| 939 | Ga0495608_0004020 | |||
| 940 | Ga0495608_0006949 | |||
| 941 | Ga0495616_0003657 | |||
| 942 | Ga0495616_0013000 | |||
| 943 | Ga0495618_0015191 | |||
| 944 | Ga0495618_0060142 | |||
| 945 | Ga0495620_0011729 | |||
| 946 | Ga0495628_0001453 | |||
| 947 | Ga0495628_0012493 | |||
| 948 | Ga0495628_0049454 | |||
| 949 | Ga0495630_0008632 | |||
| 950 | Ga0495630_0009354 | |||
| 951 | Ga0495630_0077529 | |||
| 952 | Ga0495644_0000683 | |||
| 953 | Ga0495644_0000809 | |||
| 954 | Ga0495648_0004880 | |||
| 955 | Ga0495648_0006910 | |||
| 956 | Ga0495648_0016382 | |||
| 957 | Ga0495648_0018115 | |||
| 958 | Ga0495648_0036250 | |||
| 959 | Ga0495666_0005526 | |||
| 960 | Ga0495666_0007842 | |||
| 961 | Ga0495652_0005080 | |||
| 962 | Ga0495652_0029637 | |||
| 963 | Ga0495652_0077784 | |||
| 964 | Ga0495652_0208219 | |||
| 965 | Ga0495665_0017829 | |||
| 966 | Ga0495640_0018174 | |||
| 967 | Ga0495640_0031161 | |||
| 968 | Ga0495586_0000941 | |||
| 969 | Ga0495587_0009399 | |||
| 970 | Ga0495587_0014043 | |||
| 971 | Ga0495609_0003812 | |||
| 972 | Ga0495645_0099018 | |||
| 973 | Ga0495633_0012413 | |||
| 974 | Ga0495634_0010774 | |||
| 975 | Ga0495634_0011168 | |||
| 976 | Ga0495611_0002122 | |||
| 977 | Ga0495611_0002293 | |||
| 978 | Ga0495625_0000888 | |||
| 979 | Ga0495625_0040657 | |||
| 980 | Ga0495625_0041176 | |||
| 981 | Ga0495635_0012192 | |||
| 982 | Ga0495635_0024821 | |||
| 983 | Ga0495661_0012406 | |||
| 984 | Ga0495661_0020675 | |||
| 985 | Ga0495599_0017063 | |||
| 986 | Ga0495599_0024960 | |||
| 987 | Ga0495623_0018520 | |||
| 988 | Ga0495623_0044242 | |||
| 989 | Ga0495623_0059034 | |||
| 990 | Ga0495646_0009890 | |||
| 991 | Ga0495646_0018672 | |||
| 992 | Ga0495613_0080313 | |||
| 993 | Ga0495624_0004140 | |||
| 994 | Ga0495624_0011627 | |||
| 995 | Ga0495624_0014986 | |||
| 996 | Ga0495624_0039993 | |||
| 997 | Ga0495670_0002454 | |||
| 998 | Ga0495671_0009423 | |||
| 999 | Ga0495671_0023223 | |||
| 1000 | Ga0495589_0005085 | |||
| 1001 | Ga0495589_0005886 | |||
| 1002 | Ga0495600_0000303 | |||
| 1003 | Ga0495604_0002457 | |||
| 1004 | Ga0495604_0005502 | |||
| 1005 | Ga0495604_0007470 | |||
| 1006 | Ga0495604_0103031 | |||
| 1007 | Ga0495636_0007374 | |||
| 1008 | Ga0495674_0017721 | |||
| 1009 | Ga0495674_0027591 | |||
| 1010 | Ga0495672_0000498 | |||
| 1011 | Ga0495672_0021035 | |||
| 1012 | Ga0495676_0012517 | |||
| 1013 | Ga0495680_0054529 | |||
| 1014 | Ga0495680_0065303 | |||
| 1015 | Ga0495683_0001076 | |||
| 1016 | Ga0495683_0001837 | |||
| 1017 | Ga0495683_0010814 | |||
| 1018 | Ga0495687_001078 | |||
| 1019 | Ga0495687_007773 | |||
| 1020 | Ga0495675_0012913 | |||
| 1021 | Ga0495677_0000842 | |||
| 1022 | Ga0495677_0028555 | |||
| 1023 | Ga0495679_000007 | |||
| 1024 | Ga0495679_005101 | |||
| 1025 | Ga0495679_009170 | |||
| 1026 | Ga0495685_000482 | |||
| 1027 | Ga0495673_0021003 | |||
| 1028 | Ga0495673_0029415 | |||
| 1029 | Ga0495684_0030428 | |||
| 1030 | Ga0495686_0000865 | |||
| 1031 | Ga0495686_0000867 | |||
| 1032 | Ga0495593_0026167 | |||
| 1033 | Ga0495602_0005576 | |||
| 1034 | Ga0495602_0024026 | |||
| 1035 | Ga0495602_0099151 | |||
| 1036 | Ga0495614_0006125 | |||
| 1037 | Ga0495626_0000043 | |||
| 1038 | Ga0495626_0010010 | |||
| 1039 | Ga0495626_0029104 | |||
| 1040 | Ga0496100_0016070 | |||
| 1041 | Ga0496101_0042608 | |||
| 1042 | Ga0496103_0022302 | |||
| 1043 | Ga0496104_0027465 | |||
| 1044 | Ga0496106_0000071 | |||
| 1045 | Ga0496106_0061356 | |||
| 1046 | Ga0496109_0103548 | |||
| 1047 | Ga0496109_0244006 | |||
| 1048 | Ga0496112_0002284 | |||
| 1049 | Ga0496112_0094994 | |||
| 1050 | Ga0496113_0000731 | |||
| 1051 | Ga0496113_0001940 | |||
| 1052 | Ga0496115_0013026 | |||
| 1053 | Ga0496116_0046349 | |||
| 1054 | Ga0496116_0057681 | |||
| 1055 | Ga0496117_0000530 | |||
| 1056 | Ga0496117_0009247 | |||
| 1057 | Ga0496117_0034074 | |||
| 1058 | Ga0496118_0001972 | |||
| 1059 | Ga0496118_0002189 | |||
| 1060 | Ga0496118_0014236 | |||
| 1061 | Ga0496118_0029985 | |||
| 1062 | Ga0496118_0056276 | |||
| 1063 | Ga0496118_0056708 | |||
| 1064 | Ga0496121_0000333 | |||
| 1065 | Ga0496121_0006639 | |||
| 1066 | Ga0496121_0046875 | |||
| 1067 | Ga0496121_0079586 | |||
| 1068 | Ga0496121_0148248 | |||
| 1069 | Ga0496122_0000375 | |||
| 1070 | Ga0496123_0000267 | |||
| 1071 | Ga0496124_0002800 | |||
| 1072 | Ga0496125_0000694 | |||
| 1073 | Ga0496126_0000088 | |||
| 1074 | Ga0496126_0003517 | |||
| 1075 | Ga0496126_0006313 | |||
| 1076 | Ga0496126_0006824 | |||
| 1077 | Ga0495682_0000398 | |||
| 1078 | Ga0495682_0001576 | |||
| 1079 | Ga0495682_0025822 | |||
| 1080 | Ga0501038_0147078 | |||
| 1081 | Ga0501043_0041340 | |||
| 1082 | Ga0501047_0200012 | |||
| 1083 | Ga0501073_0188914 | |||
| 1084 | Ga0501080_0092618 | |||
| 1085 | Ga0501279_001782 | |||
| 1086 | Ga0501035_0002740 | |||
| 1087 | Ga0501035_0058201 | |||
| 1088 | Ga0500588_0000145 | |||
| 1089 | Ga0501084_0000347 | |||
| 1090 | Ga0501082_0014699 | |||
| 1091 | 2501070797 | |||
| 1092 | 2501080322 | |||
| 1093 | 2501413631 | |||
| 1094 | 2511089702 | |||
| 1095 | 2511095099 | |||
| 1096 | 2511104758 | |||
| 1097 | 2511248903 | |||
| 1098 | 2512347356 | |||
| 1099 | 2513551386 | |||
| 1100 | 2513560028 | |||
| 1101 | 2513704744 | |||
| 1102 | 2514048024 | |||
| 1103 | 2515685313 | |||
| 1104 | 2515687956 | |||
| 1105 | 2519459860 | |||
| 1106 | 2521558934 | |||
| 1107 | 2550697207 | |||
| 1108 | 2553003742 | |||
| 1109 | 2563060031 | |||
| 1110 | 2585290624 | |||
| 1111 | 2599740232 | |||
| 1112 | 2599744092 | |||
| 1113 | 2600210827 | |||
| 1114 | 2643791181 | |||
| 1115 | 2644215390 | |||
| 1116 | 2652975140 | |||
| 1117 | 2676743557 | |||
| 1118 | 2713479252 | |||
| 1119 | 2723876223 | |||
| 1120 | 2746086361 | |||
| 1121 | 2746093361 | |||
| 1122 | 2753566267 | |||
| 1123 | 2765568830 | |||
| 1124 | 2792834689 | |||
| 1125 | 2808968323 | |||
| 1126 | 2809003154 | |||
| 1127 | 2809010431 | |||
| 1128 | 2809130665 | |||
| 1129 | 2809146086 | |||
| 1130 | 2809149857 | |||
| 1131 | 2817262144 | |||
| 1132 | 2817279845 | |||
| 1133 | 2817455550 | |||
| 1134 | 2819542394 | |||
| 1135 | 2819591364 | |||
| 1136 | 2819615456 | |||
| 1137 | 2819623933 | |||
| 1138 | 2819633695 | |||
| 1139 | 2821444684 | |||
| 1140 | 2829749734 | |||
| 1141 | 2839096289 | |||
| 1142 | 2842331828 | |||
| 1143 | 2842356141 | |||
| 1144 | 2842459341 | |||
| 1145 | 2852620001 | |||
| 1146 | 2855732953 | |||
| 1147 | 2855771705 | |||
| 1148 | 2856293254 | |||
| 1149 | 2857366627 | |||
| 1150 | 2863427296 | |||
| 1151 | 2870070097 | |||
| 1152 | 2881415758 | |||
| 1153 | 2883090527 | |||
| 1154 | 2884812918 | |||
| 1155 | 2884837160 | |||
| 1156 | 2884853452 | |||
| 1157 | 2885278546 | |||
| 1158 | 2894513734 | |||
| 1159 | 2896155431 | |||
| 1160 | 2900636405 | |||
| 1161 | 2902689101 | |||
| 1162 | 2904437382 | |||
| 1163 | 2904444625 | |||
| 1164 | 2904534720 | |||
| 1165 | 2904567678 | |||
| 1166 | 2904574920 | |||
| 1167 | 2904584609 | |||
| 1168 | 2904591076 | |||
| 1169 | 2904605296 | |||
| 1170 | 2904619076 | |||
| 1171 | 2919048464 | |||
| 1172 | 2919081015 | |||
| 1173 | 2919496071 | |||
| 1174 | 2919544349 | |||
| 1175 | 2921644141 | |||
| 1176 | 2923512595 | |||
| 1177 | 2923527891 | |||
| 1178 | 2928109502 | |||
| 1179 | 2928132626 | |||
| 1180 | 2928137044 | |||
| 1181 | 2928162052 | |||
| 1182 | 2928169282 | |||
| 1183 | 2928175453 | |||
| 1184 | 2928506572 | |||
| 1185 | 2928538989 | |||
| 1186 | 2981992802 | |||
| 1187 | 642418053 | |||
| 1188 | 642592062 | |||
| 1189 | 642620132 | |||
| 1190 | 651175182 | |||
| 1191 | 8003957293 | |||
| 1192 | 8018846266 | |||
| 1193 | 8020814250 | |||
| 1194 | 8020940010 | |||
| 1195 | 8020950361 | |||
| 1196 | 8020954707 | |||
| 1197 | 8021125552 | |||
| 1198 | 8039104491 | |||
| 1199 | 8040172105 | |||
| 1200 | 8040173986 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ose-assembly1.cif.gz_D | cytochrome bd-ii type oxidase with bound aurachin d | 0.933 | 6 | 502 |
| 6rko-assembly1.cif.gz_A | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.9242 | 6 | 509 |
| 7oy2-assembly1.cif.gz_C | high resolution structure of cytochrome bd-ii oxidase from e. coli | 0.9228 | 6 | 502 |
| 7ose-assembly1.cif.gz_D | cytochrome bd-ii type oxidase with bound aurachin d | 0.9206 | 6 | 502 |
| 6rx4-assembly1.cif.gz_A | the structure of bd oxidase from escherichia coli | 0.9158 | 7 | 514 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.4812 | 22 | 257 | 1.20.1630.10 |
| af_P37180_41_337_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.4623 | 13 | 240 | 1.20.1630.10 |
| af_Q54NX1_225_415_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4217 | 13 | 237 | 1.20.1250.20 |
| af_Q54NX1_225_415_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3896 | 13 | 237 | 1.20.1250.20 |
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.377 | 22 | 257 | 1.20.1630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0Y395-F1-model_v4 | Cytochrome bd ubiquinol oxidase subunit I (EC 1.10.3.-) | 0.9887 | 118 | 237 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A376UDY2-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit 1 (EC 1.10.3.-) | 0.9815 | 130 | 236 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A833KMA1-F1-model_v4 | deleted | 0.967 | 252 | 390 |
|
| AF-A0A6G3XUQ9-F1-model_v4 | Cytochrome ubiquinol oxidase subunit I | 0.963 | 122 | 240 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A258KH10-F1-model_v4 | Cytochrome d terminal oxidase subunit 1 | 0.9629 | 6 | 240 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |