F467997

General Info

Members Datasets Scaffolds Average Seq Length
600 383 1200 517

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0171277|Ga0436361_0171277_7746_9383
Length 545
Sequence VSKVIFLLAPRRHPIRLPKEFAMIPAAEVVSLSRLQFGATAMFHFLFVPLTLGLSWILVICESVYVMTGQPVYKDMTRFWGKLFGINFAMGVATGLTMEFQFGTNWAYYSHYVGDIFGVPLAIEGLMAFFLESTFVGLFFFGWSRLSRVQHLGVTFLLALGTNLSALWILIANAWMQNPVGAEFNYHTMRMELTDLAVVFGNPVAQVKFVHTVAAGYVTGAMFVLGISAWYLLKARDTGFAIRSFAVAAGFGLASSLSVIVLGDESGYTAGEVQQVKLAAIEAEWDTEPAPAAITAFGLPNQETEHTDYAIKIPYVMGIIATRSFDKPVLGLRDIRAANELRIRSGMLAYGALTALKGGHPSDADRLQFEQHKGDLGYGLLLKKYTANVVDATDAQVHQAAQDTIPKVAPLFWAFRGMVGLGITMLFIFAASFWFLVRKRLAPQRWLLRLAVCAIPFPWIAIELGWFVAEYGRQPWTISGILPTFLSASSVASSQVWASFIGIFTIYSALFVVEMYLMLKYIRLGPASLATGRYDGEADLGAQHA

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
275 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
276 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
277 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
278 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
279 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
280 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
281 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
282 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
283 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
284 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
285 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
286 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
287 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
288 2519103095 Burkholderia sp. KJ006 Isolate Nodule
289 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
290 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
291 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
292 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
293 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
294 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
295 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
296 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
297 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
298 2643221638 Duganella sp. Root336D2 Isolate Unclassified
299 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
300 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
301 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
302 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
303 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
304 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
305 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
306 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
307 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
308 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
309 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
310 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
311 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
312 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
313 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
314 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
315 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
316 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
317 2818991436 Collimonas arenae 515 Isolate Unclassified
318 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
319 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
320 2818991450 Burkholderia sp. 604 Isolate Unclassified
321 2818991452 Burkholderia cepacia 561 Isolate Unclassified
322 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
323 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
324 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
325 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
326 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
327 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
328 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
329 2855730933 Achromobacter sp. HZ28 Isolate Nodule
330 2855767633 Achromobacter sp. HZ34 Isolate Nodule
331 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
332 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
333 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
334 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
335 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
336 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
337 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
338 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
339 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
340 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
341 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
342 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
343 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
344 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
345 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
346 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
347 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
348 2904564687 Burkholderia sp. 571 Isolate Unclassified
349 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
350 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
351 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
352 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
353 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
354 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
355 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
356 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
357 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
358 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
359 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
360 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
361 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
362 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
363 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
364 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
365 2928163908 Burkholderia sp. 567 Isolate Unclassified
366 2928170801 Burkholderia sp. 572 Isolate Unclassified
367 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
368 2928536128 Burkholderia sola 565 Isolate Unclassified
369 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
370 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
371 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
372 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
373 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
374 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
375 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
376 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
377 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
378 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
379 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
380 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
381 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
382 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
383 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.67
Metatranscriptomes 0
Isolates 18.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.33
Nodule 3.17
Rhizoplane 2.83
Rhizosphere 70.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0171277 3300039447 Bacteria 18778
2 JGI24739J22299_10002703 3300001989 Bacteria 6825
3 JGI24739J22299_10004190 3300001989 Bacteria 5517
4 JGI24735J21928_10005480 3300002067 Bacteria 4208
5 JGI24735J21928_10010883 3300002067 Bacteria 2891
6 JGI25156J39149_1000394 3300002705 Bacteria 27403
7 JGI25162J39368_1000131 3300002737 Bacteria 81755
8 JGI25162J39368_1000370 3300002737 Bacteria 38244
9 JGI25157J39369_1000336 3300002741 Bacteria 33359
10 JGI25159J45721_1001417 3300002987 Bacteria 9952
11 JGI25165J46597_1000022 3300003214 Bacteria 357959
12 rootL2_10003512 3300003322 Bacteria 14306
13 JGI25161J50226_1000334 3300003374 Bacteria 25440
14 Ga0055538_1000011 3300003751 Bacteria 357959
15 Ga0055538_1000016 3300003751 Bacteria 305460
16 Ga0055539_1000016 3300003752 Bacteria 358248
17 Ga0055539_1000021 3300003752 Bacteria 305460
18 Ga0055533_1000019 3300003756 Bacteria 357959
19 Ga0055533_1000029 3300003756 Bacteria 305460
20 Ga0055532_1000016 3300003758 Bacteria 327509
21 Ga0055525_1000033 3300003759 Bacteria 305460
22 Ga0055525_1000042 3300003759 Bacteria 279804
23 Ga0055525_1000173 3300003759 Bacteria 81767
24 Ga0055535_1006543 3300003761 Bacteria 2340
25 Ga0055528_1004616 3300003790 Bacteria 6593
26 Ga0055541_1000017 3300003841 Bacteria 286811
27 Ga0055541_1000045 3300003841 Bacteria 148620
28 Ga0055541_1000084 3300003841 Bacteria 81767
29 Ga0058692_1001492 3300003856 Bacteria 8575
30 Ga0065165_1000115 3300005262 Bacteria 135145
31 Ga0065165_1000820 3300005262 Bacteria 41193
32 Ga0070658_10060519 3300005327 Bacteria 3084
33 Ga0070676_10000216 3300005328 Bacteria 24689
34 Ga0070676_10016463 3300005328 Bacteria 4089
35 Ga0070670_100007274 3300005331 Bacteria 9388
36 Ga0070670_100026782 3300005331 Bacteria 4959
37 Ga0070670_100049102 3300005331 Bacteria 3630
38 Ga0070670_100069477 3300005331 Bacteria 3023
39 Ga0070677_10001090 3300005333 Bacteria 8745
40 Ga0068868_100026555 3300005338 Bacteria 4415
41 Ga0070660_100000001 3300005339 Bacteria 190487
42 Ga0070660_100005558 3300005339 Bacteria 8734
43 Ga0070689_100043520 3300005340 Bacteria 3451
44 Ga0070661_100045377 3300005344 Bacteria 3213
45 Ga0070661_100102914 3300005344 Bacteria 2126
46 Ga0070668_100003734 3300005347 Bacteria 11232
47 Ga0070668_100008159 3300005347 Bacteria 7778
48 Ga0070668_100119545 3300005347 Bacteria 2105
49 Ga0070669_100033238 3300005353 Bacteria 3730
50 Ga0070675_100028574 3300005354 Bacteria 4489
51 Ga0070671_100000488 3300005355 Bacteria 27659
52 Ga0070671_100002449 3300005355 Bacteria 14351
53 Ga0070671_100056008 3300005355 Bacteria 3280
54 Ga0070674_100058342 3300005356 Bacteria 2683
55 Ga0070673_100001385 3300005364 Bacteria 14176
56 Ga0070673_100058175 3300005364 Bacteria 3055
57 Ga0070659_100000941 3300005366 Bacteria 21399
58 Ga0070667_100002852 3300005367 Bacteria 14917
59 Ga0070667_100009065 3300005367 Bacteria 8235
60 Ga0070667_100011417 3300005367 Bacteria 7345
61 Ga0070667_100148645 3300005367 Bacteria 2056
62 Ga0070705_100014573 3300005440 Bacteria 4047
63 Ga0070663_100000078 3300005455 Bacteria 42943
64 Ga0070662_100023396 3300005457 Bacteria 4243
65 Ga0068867_100028402 3300005459 Bacteria 4028
66 Ga0068867_100029557 3300005459 Bacteria 3949
67 Ga0070698_100151336 3300005471 Bacteria 2268
68 Ga0070679_100080152 3300005530 Bacteria 3254
69 Ga0070697_100113282 3300005536 Bacteria 2263
70 Ga0070672_100003644 3300005543 Bacteria 10004
71 Ga0070672_100015142 3300005543 Bacteria 5482
72 Ga0070672_100110695 3300005543 Bacteria 2238
73 Ga0070695_100043069 3300005545 Bacteria 2869
74 Ga0070665_100004317 3300005548 Bacteria 14944
75 Ga0070664_100075214 3300005564 Bacteria 2900
76 Ga0068852_100000705 3300005616 Bacteria 21852
77 Ga0068852_100006811 3300005616 Bacteria 8297
78 Ga0068852_100014873 3300005616 Bacteria 6014
79 Ga0068852_100046989 3300005616 Bacteria 3681
80 Ga0068859_100004214 3300005617 Bacteria 14669
81 Ga0068864_100010031 3300005618 Bacteria 7819
82 Ga0068864_100015176 3300005618 Bacteria 6406
83 Ga0068864_100057215 3300005618 Bacteria 3369
84 Ga0068851_10000160 3300005834 Bacteria 35442
85 Ga0068870_10004282 3300005840 Bacteria 6138
86 Ga0068870_10007671 3300005840 Bacteria 4826
87 Ga0068863_100010612 3300005841 Bacteria 8942
88 Ga0068863_100018285 3300005841 Bacteria 6712
89 Ga0068863_100021755 3300005841 Bacteria 6118
90 Ga0068863_100032354 3300005841 Bacteria 4985
91 Ga0068863_100162928 3300005841 Bacteria 2137
92 Ga0068858_100007336 3300005842 Bacteria 10669
93 Ga0068858_100087800 3300005842 Bacteria 2892
94 Ga0097621_100007151 3300006237 Bacteria 7955
95 Ga0097621_100109799 3300006237 Bacteria 2330
96 Ga0097621_100152802 3300006237 Bacteria 1980
97 Ga0068871_100017293 3300006358 Bacteria 5453
98 Ga0068865_100037737 3300006881 Bacteria 3265
99 Ga0097620_100004214 3300006931 Bacteria 14669
100 Ga0105251_10000055 3300009011 Bacteria 105044
101 Ga0105240_10000497 3300009093 Bacteria 72381
102 Ga0105240_10070042 3300009093 Bacteria 4339
103 Ga0105240_10194130 3300009093 Bacteria 2385
104 Ga0105245_10031217 3300009098 Bacteria 4714
105 Ga0105243_10138348 3300009148 Bacteria 2074
106 Ga0105241_10008358 3300009174 Bacteria 7623
107 Ga0105242_10069431 3300009176 Bacteria 2918
108 Ga0105248_10000001 3300009177 Bacteria 1881304
109 Ga0105248_10038841 3300009177 Bacteria 5329
110 Ga0105248_10150285 3300009177 Bacteria 2628
111 Ga0105248_10209610 3300009177 Bacteria 2195
112 Ga0105237_10012980 3300009545 Bacteria 8746
113 Ga0105237_10022717 3300009545 Bacteria 6436
114 Ga0105238_10000117 3300009551 Bacteria 89001
115 Ga0105238_10018532 3300009551 Bacteria 7085
116 Ga0105238_10076900 3300009551 Bacteria 3330
117 Ga0105239_10055330 3300010375 Bacteria 4351
118 Ga0105246_10040640 3300011119 Bacteria 3140
119 Ga0157369_10102804 3300013105 Bacteria 3044
120 Ga0157378_10013177 3300013297 Bacteria 7233
121 Ga0163162_10029670 3300013306 Bacteria 5415
122 Ga0163162_10035122 3300013306 Bacteria 4992
123 Ga0163162_10054879 3300013306 Bacteria 4009
124 Ga0157372_10131383 3300013307 Bacteria 2881
125 Ga0157375_10063213 3300013308 Bacteria 3681
126 Ga0157375_10155709 3300013308 Bacteria 2424
127 Ga0163163_10164829 3300014325 Bacteria 2262
128 Ga0157380_10101637 3300014326 Bacteria 2396
129 Ga0182008_10038540 3300014497 Bacteria 2390
130 Ga0157376_10025923 3300014969 Bacteria 4625
131 Ga0182006_1002575 3300015261 Bacteria 9828
132 Ga0182007_10001200 3300015262 Bacteria 14066
133 Ga0182005_1000351 3300015265 Bacteria 26159
134 Ga0182005_1006031 3300015265 Bacteria 3743
135 Ga0183361_10001 3300016635 Bacteria 908583
136 Ga0163161_10027953 3300017792 Bacteria 4002
137 Ga0213872_10000494 3300021361 Bacteria 31496
138 Ga0213872_10000677 3300021361 Bacteria 25769
139 Ga0213872_10018758 3300021361 Bacteria 3188
140 Ga0209435_100016 3300025206 Bacteria 305566
141 Ga0209435_100038 3300025206 Bacteria 120273
142 Ga0209435_100096 3300025206 Bacteria 38561
143 Ga0209436_100502 3300025208 Bacteria 17128
144 Ga0209784_100019 3300025224 Bacteria 453558
145 Ga0209784_100033 3300025224 Bacteria 305649
146 Ga0209566_100017 3300025225 Bacteria 453558
147 Ga0209566_100037 3300025225 Bacteria 305649
148 Ga0209566_100164 3300025225 Bacteria 73577
149 Ga0209674_100031 3300025226 Bacteria 453558
150 Ga0209674_100055 3300025226 Bacteria 305649
151 Ga0209674_101916 3300025226 Bacteria 4885
152 Ga0209672_100046 3300025228 Bacteria 264244
153 Ga0209672_100088 3300025228 Bacteria 121401
154 Ga0209147_100023 3300025229 Bacteria 437803
155 Ga0209147_100043 3300025229 Bacteria 300460
156 Ga0209147_100130 3300025229 Bacteria 121401
157 Ga0209147_100214 3300025229 Bacteria 60481
158 Ga0209563_100035 3300025230 Bacteria 453558
159 Ga0209563_100056 3300025230 Bacteria 305649
160 Ga0209437_100038 3300025233 Bacteria 453558
161 Ga0209437_100080 3300025233 Bacteria 275402
162 Ga0209258_100023 3300025242 Bacteria 547286
163 Ga0209258_100204 3300025242 Bacteria 121401
164 Ga0209258_100210 3300025242 Bacteria 117131
165 Ga0209646_1000033 3300025246 Bacteria 369507
166 Ga0209646_1000093 3300025246 Bacteria 183840
167 Ga0209026_1000031 3300025250 Bacteria 325747
168 Ga0209677_100020 3300025253 Bacteria 453558
169 Ga0209677_100034 3300025253 Bacteria 305649
170 Ga0209148_1000029 3300025254 Bacteria 579199
171 Ga0209148_1000488 3300025254 Bacteria 40976
172 Ga0209759_1000045 3300025256 Bacteria 235654
173 Ga0209759_1000175 3300025256 Bacteria 106788
174 Ga0209759_1000248 3300025256 Bacteria 80537
175 Ga0209233_1000049 3300025261 Bacteria 453558
176 Ga0209455_1000064 3300025272 Bacteria 332404
177 Ga0209455_1001513 3300025272 Bacteria 10402
178 Ga0209673_1000084 3300025273 Bacteria 215878
179 Ga0209130_1000629 3300025284 Bacteria 33099
180 Ga0209564_1012115 3300025295 Bacteria 3790
181 Ga0207426_1000007 3300025302 Bacteria 971011
182 Ga0207656_10000579 3300025321 Bacteria 12137
183 Ga0207713_1000089 3300025735 Bacteria 152927
184 Ga0207713_1000106 3300025735 Bacteria 137911
185 Ga0207680_10022248 3300025903 Bacteria 3445
186 Ga0207680_10116983 3300025903 Bacteria 1738
187 Ga0207647_10000540 3300025904 Bacteria 30173
188 Ga0207647_10032089 3300025904 Bacteria 3377
189 Ga0207645_10003305 3300025907 Bacteria 12300
190 Ga0207645_10045666 3300025907 Bacteria 2799
191 Ga0207643_10023328 3300025908 Bacteria 3410
192 Ga0207654_10000377 3300025911 Bacteria 25958
193 Ga0207707_10092147 3300025912 Bacteria 2648
194 Ga0207695_10001268 3300025913 Bacteria 42942
195 Ga0207695_10015644 3300025913 Bacteria 8922
196 Ga0207695_10045013 3300025913 Bacteria 4689
197 Ga0207671_10027390 3300025914 Bacteria 4261
198 Ga0207671_10039989 3300025914 Bacteria 3472
199 Ga0207657_10000022 3300025919 Bacteria 154101
200 Ga0207657_10010163 3300025919 Bacteria 9404
201 Ga0207649_10028303 3300025920 Bacteria 3299
202 Ga0207646_10020487 3300025922 Bacteria 6126
203 Ga0207681_10109236 3300025923 Bacteria 2009
204 Ga0207681_10148134 3300025923 Bacteria 1756
205 Ga0207694_10000103 3300025924 Bacteria 92553
206 Ga0207694_10008678 3300025924 Bacteria 7672
207 Ga0207650_10009704 3300025925 Bacteria 6581
208 Ga0207650_10015726 3300025925 Bacteria 5274
209 Ga0207650_10095015 3300025925 Bacteria 2285
210 Ga0207659_10001785 3300025926 Bacteria 12710
211 Ga0207659_10007159 3300025926 Bacteria 6847
212 Ga0207659_10036345 3300025926 Bacteria 3411
213 Ga0207644_10069150 3300025931 Bacteria 2578
214 Ga0207690_10000010 3300025932 Bacteria 330298
215 Ga0207706_10044172 3300025933 Bacteria 3950
216 Ga0207706_10050757 3300025933 Bacteria 3665
217 Ga0207686_10022236 3300025934 Bacteria 3650
218 Ga0207669_10040622 3300025937 Bacteria 2700
219 Ga0207691_10000379 3300025940 Bacteria 44711
220 Ga0207691_10001760 3300025940 Bacteria 21320
221 Ga0207691_10007201 3300025940 Bacteria 10732
222 Ga0207691_10048743 3300025940 Bacteria 3882
223 Ga0207711_10000001 3300025941 Bacteria 1325674
224 Ga0207711_10015556 3300025941 Bacteria 6314
225 Ga0207689_10000049 3300025942 Bacteria 88948
226 Ga0207679_10038059 3300025945 Bacteria 3425
227 Ga0207679_10110517 3300025945 Bacteria 2168
228 Ga0207667_10000073 3300025949 Bacteria 174391
229 Ga0207667_10000076 3300025949 Bacteria 166704
230 Ga0207667_10000147 3300025949 Bacteria 106918
231 Ga0207667_10000166 3300025949 Bacteria 97376
232 Ga0207651_10058023 3300025960 Bacteria 2673
233 Ga0207668_10000663 3300025972 Bacteria 21145
234 Ga0207668_10043808 3300025972 Bacteria 3040
235 Ga0207668_10130684 3300025972 Bacteria 1917
236 Ga0207658_10029875 3300025986 Bacteria 3854
237 Ga0207658_10044034 3300025986 Bacteria 3248
238 Ga0207658_10113189 3300025986 Bacteria 2149
239 Ga0207639_10033215 3300026041 Bacteria 3804
240 Ga0207678_10000226 3300026067 Bacteria 50299
241 Ga0207641_10009182 3300026088 Bacteria 8162
242 Ga0207641_10020878 3300026088 Bacteria 5383
243 Ga0207641_10048521 3300026088 Bacteria 3583
244 Ga0207648_10038835 3300026089 Bacteria 4189
245 Ga0207648_10058195 3300026089 Bacteria 3371
246 Ga0207648_10095354 3300026089 Bacteria 2602
247 Ga0207648_10107639 3300026089 Bacteria 2447
248 Ga0207676_10015984 3300026095 Bacteria 5430
249 Ga0207676_10021344 3300026095 Bacteria 4750
250 Ga0207674_10019494 3300026116 Bacteria 7345
251 Ga0207674_10066633 3300026116 Bacteria 3626
252 Ga0207675_100000699 3300026118 Bacteria 33170
253 Ga0207675_100076460 3300026118 Bacteria 3135
254 Ga0207683_10000085 3300026121 Bacteria 73884
255 Ga0207683_10015787 3300026121 Bacteria 6428
256 Ga0207698_10012831 3300026142 Bacteria 5504
257 Ga0207698_10026426 3300026142 Bacteria 4107
258 Ga0209371_1000160 3300027312 Bacteria 103642
259 Ga0268266_10026630 3300028379 Bacteria 4920
260 Ga0268266_10091486 3300028379 Bacteria 2667
261 Ga0268265_10021904 3300028380 Bacteria 4484
262 Ga0268265_10144769 3300028380 Bacteria 1995
263 Ga0268256_1000132 3300030500 Bacteria 103642
264 Ga0316181_1138627 3300030744 Bacteria 1972
265 Ga0265330_10006819 3300031235 Bacteria 5623
266 Ga0265332_10001661 3300031238 Bacteria 12159
267 Ga0265328_10006749 3300031239 Bacteria 4830
268 Ga0265329_10004388 3300031242 Bacteria 5883
269 Ga0265331_10000579 3300031250 Bacteria 32817
270 Ga0265331_10005012 3300031250 Bacteria 8119
271 Ga0265327_10000302 3300031251 Bacteria 95654
272 Ga0265327_10003193 3300031251 Bacteria 15986
273 Ga0265316_10104503 3300031344 Bacteria 2150
274 Ga0307408_100001773 3300031548 Bacteria 15748
275 Ga0265314_10009471 3300031711 Bacteria 8215
276 Ga0307516_10107633 3300031730 Bacteria 2596
277 Ga0316577_10025177 3300031733 Bacteria 3310
278 Ga0307416_100004729 3300032002 Bacteria 8255
279 Ga0307416_100006471 3300032002 Bacteria 7338
280 Ga0373935_0053602 3300035692 Bacteria 2566
281 Ga0373937_0032992 3300036401 Bacteria 4699
282 Ga0316582_0013147 3300036647 Bacteria 4650
283 Ga0395900_0000474 3300037418 Bacteria 57230
284 Ga0395900_0000689 3300037418 Bacteria 45109
285 Ga0395900_0047336 3300037418 Bacteria 4427
286 Ga0395898_0004656 3300037466 Bacteria 14955
287 Ga0395901_0000019 3300038443 Bacteria 317063
288 Ga0395901_0000448 3300038443 Bacteria 47911
289 Ga0436361_0062839 3300039447 Bacteria 58101
290 Ga0436361_0298954 3300039447 Bacteria 16837
291 Ga0439448_0000123 3300042005 Bacteria 14522
292 Ga0439449_0000465 3300042007 Bacteria 15109
293 Ga0451577_0000315 3300042876 Bacteria 92038
294 Ga0466977_0000098 3300044666 Bacteria 18255
295 Ga0466966_0032581 3300044684 Bacteria 3376
296 Ga0453684_0001040 3300044712 Bacteria 88809
297 Ga0453684_0030477 3300044712 Bacteria 7619
298 Ga0466957_0124577 3300044842 Bacteria 1645
299 Ga0451576_0000034 3300045051 Bacteria 390778
300 Ga0451576_0000131 3300045051 Bacteria 190667
301 Ga0466958_0064918 3300045836 Bacteria 2227
302 Ga0495592_0015574 3300046454 Bacteria 5768
303 Ga0495592_0120510 3300046454 Bacteria 1846
304 Ga0495603_0013914 3300046455 Bacteria 4866
305 Ga0495590_0008583 3300046457 Bacteria 3898
306 Ga0495590_0023202 3300046457 Bacteria 2192
307 Ga0495591_001790 3300046458 Bacteria 12729
308 Ga0495629_0000041 3300046459 Bacteria 115135
309 Ga0495629_0012956 3300046459 Bacteria 6029
310 Ga0495629_0015579 3300046459 Bacteria 5457
311 Ga0495638_0010321 3300046460 Bacteria 6496
312 Ga0495651_0018070 3300046462 Bacteria 5458
313 Ga0495651_0033153 3300046462 Bacteria 4028
314 Ga0495651_0041725 3300046462 Bacteria 3563
315 Ga0495653_0015181 3300046463 Bacteria 6279
316 Ga0495653_0049679 3300046463 Bacteria 3229
317 Ga0495653_0053554 3300046463 Bacteria 3086
318 Ga0495650_0000084 3300046471 Bacteria 235690
319 Ga0495580_0000483 3300046472 Bacteria 33249
320 Ga0495580_0000497 3300046472 Bacteria 32912
321 Ga0495580_0004287 3300046472 Bacteria 11995
322 Ga0495580_0005465 3300046472 Bacteria 10504
323 Ga0495580_0010550 3300046472 Bacteria 7190
324 Ga0495582_0013809 3300046473 Bacteria 4447
325 Ga0495605_0001100 3300046474 Bacteria 17990
326 Ga0495605_0003028 3300046474 Bacteria 10144
327 Ga0495662_0019048 3300046476 Bacteria 3321
328 Ga0495662_0022335 3300046476 Bacteria 3056
329 Ga0495664_0004801 3300046477 Bacteria 7392
330 Ga0495585_0011381 3300046492 Bacteria 5265
331 Ga0495596_0004440 3300046500 Bacteria 6829
332 Ga0495596_0005409 3300046500 Bacteria 6037
333 Ga0495596_0019621 3300046500 Bacteria 2776
334 Ga0495583_0000609 3300046506 Bacteria 48438
335 Ga0495583_0012412 3300046506 Bacteria 4821
336 Ga0495606_0000075 3300046507 Bacteria 170038
337 Ga0495606_0027842 3300046507 Bacteria 3998
338 Ga0495606_0084979 3300046507 Bacteria 1958
339 Ga0495608_0004020 3300046511 Bacteria 10554
340 Ga0495608_0006949 3300046511 Bacteria 8013
341 Ga0495616_0003657 3300046513 Bacteria 9821
342 Ga0495616_0013000 3300046513 Bacteria 4707
343 Ga0495618_0015191 3300046514 Bacteria 4698
344 Ga0495618_0060142 3300046514 Bacteria 2408
345 Ga0495620_0011729 3300046515 Bacteria 4558
346 Ga0495628_0001453 3300046516 Bacteria 21731
347 Ga0495628_0012493 3300046516 Bacteria 7158
348 Ga0495628_0049454 3300046516 Bacteria 3329
349 Ga0495630_0008632 3300046517 Bacteria 7313
350 Ga0495630_0009354 3300046517 Bacteria 7044
351 Ga0495630_0077529 3300046517 Bacteria 2505
352 Ga0495644_0000683 3300046523 Bacteria 14091
353 Ga0495644_0000809 3300046523 Bacteria 12896
354 Ga0495648_0004880 3300046524 Bacteria 11297
355 Ga0495648_0006910 3300046524 Bacteria 9152
356 Ga0495648_0016382 3300046524 Bacteria 5347
357 Ga0495648_0018115 3300046524 Bacteria 5005
358 Ga0495648_0036250 3300046524 Bacteria 3185
359 Ga0495666_0005526 3300046526 Bacteria 6365
360 Ga0495666_0007842 3300046526 Bacteria 5346
361 Ga0495652_0005080 3300046529 Bacteria 12452
362 Ga0495652_0029637 3300046529 Bacteria 4807
363 Ga0495652_0077784 3300046529 Bacteria 2748
364 Ga0495652_0208219 3300046529 Bacteria 1479
365 Ga0495665_0017829 3300046531 Bacteria 3816
366 Ga0495640_0018174 3300046533 Bacteria 5223
367 Ga0495640_0031161 3300046533 Bacteria 3808
368 Ga0495586_0000941 3300046535 Bacteria 16504
369 Ga0495587_0009399 3300046536 Bacteria 6267
370 Ga0495587_0014043 3300046536 Bacteria 5029
371 Ga0495609_0003812 3300046538 Bacteria 8476
372 Ga0495645_0099018 3300046543 Bacteria 2075
373 Ga0495633_0012413 3300046558 Bacteria 4531
374 Ga0495634_0010774 3300046642 Bacteria 6687
375 Ga0495634_0011168 3300046642 Bacteria 6551
376 Ga0495611_0002122 3300046648 Bacteria 9282
377 Ga0495611_0002293 3300046648 Bacteria 8858
378 Ga0495625_0000888 3300046660 Bacteria 40400
379 Ga0495625_0040657 3300046660 Bacteria 3388
380 Ga0495625_0041176 3300046660 Bacteria 3364
381 Ga0495635_0012192 3300046663 Bacteria 6027
382 Ga0495635_0024821 3300046663 Bacteria 4177
383 Ga0495661_0012406 3300046665 Bacteria 5753
384 Ga0495661_0020675 3300046665 Bacteria 4294
385 Ga0495599_0017063 3300046678 Bacteria 4511
386 Ga0495599_0024960 3300046678 Bacteria 3739
387 Ga0495623_0018520 3300046679 Bacteria 4497
388 Ga0495623_0044242 3300046679 Bacteria 2830
389 Ga0495623_0059034 3300046679 Bacteria 2411
390 Ga0495646_0009890 3300046680 Bacteria 6060
391 Ga0495646_0018672 3300046680 Bacteria 4391
392 Ga0495613_0080313 3300046689 Bacteria 2370
393 Ga0495624_0004140 3300046690 Bacteria 10661
394 Ga0495624_0011627 3300046690 Bacteria 6046
395 Ga0495624_0014986 3300046690 Bacteria 5250
396 Ga0495624_0039993 3300046690 Bacteria 3004
397 Ga0495670_0002454 3300046691 Bacteria 9160
398 Ga0495671_0009423 3300046692 Bacteria 5451
399 Ga0495671_0023223 3300046692 Bacteria 3241
400 Ga0495589_0005085 3300046794 Bacteria 6960
401 Ga0495589_0005886 3300046794 Bacteria 6477
402 Ga0495600_0000303 3300046809 Bacteria 26375
403 Ga0495604_0002457 3300047317 Bacteria 14822
404 Ga0495604_0005502 3300047317 Bacteria 10042
405 Ga0495604_0007470 3300047317 Bacteria 8653
406 Ga0495604_0103031 3300047317 Bacteria 2094
407 Ga0495636_0007374 3300047318 Bacteria 4328
408 Ga0495674_0017721 3300047319 Bacteria 6631
409 Ga0495674_0027591 3300047319 Bacteria 5187
410 Ga0495672_0000498 3300047320 Bacteria 45426
411 Ga0495672_0021035 3300047320 Bacteria 4260
412 Ga0495676_0012517 3300047321 Bacteria 7639
413 Ga0495680_0054529 3300047322 Bacteria 3103
414 Ga0495680_0065303 3300047322 Bacteria 2787
415 Ga0495683_0001076 3300047323 Bacteria 18894
416 Ga0495683_0001837 3300047323 Bacteria 13332
417 Ga0495683_0010814 3300047323 Bacteria 4812
418 Ga0495687_001078 3300047443 Bacteria 26839
419 Ga0495687_007773 3300047443 Bacteria 6244
420 Ga0495675_0012913 3300047444 Bacteria 5263
421 Ga0495677_0000842 3300047445 Bacteria 12382
422 Ga0495677_0028555 3300047445 Bacteria 2026
423 Ga0495679_000007 3300047446 Bacteria 401482
424 Ga0495679_005101 3300047446 Bacteria 5893
425 Ga0495679_009170 3300047446 Bacteria 3979
426 Ga0495685_000482 3300047447 Bacteria 12407
427 Ga0495673_0021003 3300047469 Bacteria 3235
428 Ga0495673_0029415 3300047469 Bacteria 2592
429 Ga0495684_0030428 3300047471 Bacteria 4145
430 Ga0495686_0000865 3300047472 Bacteria 38738
431 Ga0495686_0000867 3300047472 Bacteria 38673
432 Ga0495593_0026167 3300047673 Bacteria 3224
433 Ga0495602_0005576 3300048088 Bacteria 13208
434 Ga0495602_0024026 3300048088 Bacteria 5920
435 Ga0495602_0099151 3300048088 Bacteria 2395
436 Ga0495614_0006125 3300048089 Bacteria 5406
437 Ga0495626_0000043 3300048091 Bacteria 168109
438 Ga0495626_0010010 3300048091 Bacteria 5090
439 Ga0495626_0029104 3300048091 Bacteria 2676
440 Ga0496100_0016070 3300048903 Bacteria 4385
441 Ga0496101_0042608 3300048904 Bacteria 3240
442 Ga0496103_0022302 3300048906 Bacteria 3812
443 Ga0496104_0027465 3300048907 Bacteria 5266
444 Ga0496106_0000071 3300048909 Bacteria 82296
445 Ga0496106_0061356 3300048909 Bacteria 2852
446 Ga0496109_0103548 3300048912 Bacteria 2642
447 Ga0496109_0244006 3300048912 Bacteria 1691
448 Ga0496112_0002284 3300048915 Bacteria 15335
449 Ga0496112_0094994 3300048915 Bacteria 2952
450 Ga0496113_0000731 3300048916 Bacteria 16836
451 Ga0496113_0001940 3300048916 Bacteria 11841
452 Ga0496115_0013026 3300048918 Bacteria 6278
453 Ga0496116_0046349 3300048919 Bacteria 2934
454 Ga0496116_0057681 3300048919 Bacteria 2537
455 Ga0496117_0000530 3300048920 Bacteria 62705
456 Ga0496117_0009247 3300048920 Bacteria 9211
457 Ga0496117_0034074 3300048920 Bacteria 3843
458 Ga0496118_0001972 3300048921 Bacteria 29128
459 Ga0496118_0002189 3300048921 Bacteria 27169
460 Ga0496118_0014236 3300048921 Bacteria 7459
461 Ga0496118_0029985 3300048921 Bacteria 4552
462 Ga0496118_0056276 3300048921 Bacteria 2958
463 Ga0496118_0056708 3300048921 Bacteria 2942
464 Ga0496121_0000333 3300048924 Bacteria 98583
465 Ga0496121_0006639 3300048924 Bacteria 14244
466 Ga0496121_0046875 3300048924 Bacteria 3694
467 Ga0496121_0079586 3300048924 Bacteria 2601
468 Ga0496121_0148248 3300048924 Bacteria 1730
469 Ga0496122_0000375 3300048925 Bacteria 95681
470 Ga0496123_0000267 3300048926 Bacteria 104282
471 Ga0496124_0002800 3300048927 Bacteria 22098
472 Ga0496125_0000694 3300048928 Bacteria 55573
473 Ga0496126_0000088 3300048929 Bacteria 212256
474 Ga0496126_0003517 3300048929 Bacteria 19714
475 Ga0496126_0006313 3300048929 Bacteria 13235
476 Ga0496126_0006824 3300048929 Bacteria 12666
477 Ga0495682_0000398 3300049460 Bacteria 31324
478 Ga0495682_0001576 3300049460 Bacteria 11883
479 Ga0495682_0025822 3300049460 Bacteria 2184
480 Ga0501038_0147078 3300049574 Bacteria 1923
481 Ga0501043_0041340 3300049579 Bacteria 3622
482 Ga0501047_0200012 3300049581 Bacteria 1859
483 Ga0501073_0188914 3300049589 Bacteria 1425
484 Ga0501080_0092618 3300049742 Bacteria 2807
485 Ga0501279_001782 3300049775 Bacteria 2840
486 Ga0501035_0002740 3300049822 Bacteria 17085
487 Ga0501035_0058201 3300049822 Bacteria 3445
488 Ga0500588_0000145 3300053146 Bacteria 9474
489 Ga0501084_0000347 3300054114 Bacteria 35283
490 Ga0501082_0014699 3300060353 Bacteria 6742
491 2501070797 2501025501 Bacteria 7768574
492 2501080322 2501025502 Bacteria 9641094
493 2501413631 2501025504 Bacteria 8008976
494 2511089702 2510917013 Bacteria 9951648
495 2511095099 2510917014 Bacteria 8296963
496 2511104758 2510917015 Bacteria 7950052
497 2511248903 2511231003 Bacteria 5606035
498 2512347356 2512047030 Bacteria 9031815
499 2513551386 2513237082 Bacteria 8640282
500 2513560028 2513237083 Bacteria 8410967
501 2513704744 2513237102 Bacteria 7703324
502 2514048024 2513237166 Bacteria 10373764
503 2515685313 2515154122 Bacteria 8609520
504 2515687956 2515154123 Bacteria 6387382
505 2519459860 2519103095 Bacteria 6629912
506 2521558934 2521172590 Bacteria 5047645
507 2550697207 2548876994 Bacteria 4904866
508 2553003742 2551306416 Bacteria 6152985
509 2563060031 2562617112 Bacteria 10918404
510 2585290624 2582581311 Bacteria 6763856
511 2599740232 2599185239 Bacteria 8686614
512 2599744092 2599185240 Bacteria 7968121
513 2600210827 2599185355 Bacteria 7968906
514 2643791181 2643221554 Bacteria 6603920
515 2644215390 2643221638 Bacteria 6579467
516 2652975140 2651869818 Bacteria 5864031
517 2676743557 2675903129 Bacteria 7964495
518 2713479252 2711768613 Bacteria 11048459
519 2723876223 2721755763 Bacteria 4464185
520 2746086361 2744054900 Bacteria 8399525
521 2746093361 2744054901 Bacteria 8397047
522 2753566267 2751185846 Bacteria 7242164
523 2765568830 2765235838 Bacteria 5445269
524 2792834689 2791355137 Bacteria 9654227
525 2808968323 2808606384 Bacteria 8474373
526 2809003154 2808606390 Bacteria 8476311
527 2809010431 2808606391 Bacteria 8308166
528 2809130665 2808606415 Bacteria 4576710
529 2809146086 2808606418 Bacteria 6724496
530 2809149857 2808606419 Bacteria 4576925
531 2817262144 2816332253 Bacteria 6764532
532 2817279845 2816332256 Bacteria 6891714
533 2817455550 2816332286 Bacteria 6853759
534 2819542394 2818991436 Bacteria 5376622
535 2819591364 2818991445 Bacteria 4955017
536 2819615456 2818991449 Bacteria 5518009
537 2819623933 2818991450 Bacteria 6962147
538 2819633695 2818991452 Bacteria 8442785
539 2821444684 2821443989 Bacteria 7658172
540 2829749734 2829745981 Bacteria 5406054
541 2839096289 2839094727 Bacteria 5534556
542 2842331828 2842324504 Bacteria 9364110
543 2842356141 2842348783 Bacteria 9002918
544 2842459341 2842454564 Bacteria 8730687
545 2852620001 2852618963 Bacteria 4577824
546 2855732953 2855730933 Bacteria 7047938
547 2855771705 2855767633 Bacteria 7049357
548 2856293254 2856287931 Bacteria 7223934
549 2857366627 2857357740 Bacteria 9937880
550 2863427296 2863421361 Bacteria 7300805
551 2870070097 2870068957 Bacteria 8925310
552 2881415758 2881412998 Bacteria 6492157
553 2883090527 2883087390 Bacteria 9532701
554 2884812918 2884811622 Bacteria 5552861
555 2884837160 2884836552 Bacteria 5219991
556 2884853452 2884852848 Bacteria 5221161
557 2885278546 2885270888 Bacteria 9831543
558 2894513734 2894510363 Bacteria 5121143
559 2896155431 2896154374 Bacteria 5221518
560 2900636405 2900634093 Bacteria 10263517
561 2902689101 2902682994 Bacteria 8951596
562 2904437382 2904434214 Bacteria 6230908
563 2904444625 2904439833 Bacteria 5931679
564 2904534720 2904530477 Bacteria 5876334
565 2904567678 2904564687 Bacteria 7609577
566 2904574920 2904571731 Bacteria 7608790
567 2904584609 2904584206 Bacteria 6028872
568 2904591076 2904589729 Bacteria 6113573
569 2904605296 2904601388 Bacteria 5884906
570 2904619076 2904615490 Bacteria 10047340
571 2919048464 2919046199 Bacteria 5567169
572 2919081015 2919079590 Bacteria 5946433
573 2919496071 2919493220 Bacteria 4598500
574 2919544349 2919543075 Bacteria 4728703
575 2921644141 2921643360 Bacteria 11448031
576 2923512595 2923510766 Bacteria 5926163
577 2923527891 2923525760 Bacteria 4472324
578 2928109502 2928108538 Bacteria 7360024
579 2928132626 2928130867 Bacteria 5467269
580 2928137044 2928135762 Bacteria 7259641
581 2928162052 2928157003 Bacteria 7522202
582 2928169282 2928163908 Bacteria 7561269
583 2928175453 2928170801 Bacteria 8785406
584 2928506572 2928503688 Bacteria 7268108
585 2928538989 2928536128 Bacteria 7657547
586 2981992802 2981990288 Bacteria 7590678
587 642418053 641736154 Bacteria 7689995
588 642592062 642555112 Bacteria 8676562
589 642620132 642555113 Bacteria 8214658
590 651175182 651053060 Bacteria 4689946
591 8003957293 8003955200 Bacteria 8601927
592 8018846266 8018845410 Bacteria 8933938
593 8020814250 8020807995 Bacteria 6801506
594 8020940010 8020938398 Bacteria 7472757
595 8020950361 8020945358 Bacteria 8467355
596 8020954707 8020953355 Bacteria 7439080
597 8021125552 8021120328 Bacteria 8782274
598 8039104491 8039098773 Bacteria 6602928
599 8040172105 8040167225 Bacteria 6542727
600 8040173986 8040173305 Bacteria 6827067
601 Ga0436361_0171277
602 JGI24739J22299_10002703
603 JGI24739J22299_10004190
604 JGI24735J21928_10005480
605 JGI24735J21928_10010883
606 JGI25156J39149_1000394
607 JGI25162J39368_1000131
608 JGI25162J39368_1000370
609 JGI25157J39369_1000336
610 JGI25159J45721_1001417
611 JGI25165J46597_1000022
612 rootL2_10003512
613 JGI25161J50226_1000334
614 Ga0055538_1000011
615 Ga0055538_1000016
616 Ga0055539_1000016
617 Ga0055539_1000021
618 Ga0055533_1000019
619 Ga0055533_1000029
620 Ga0055532_1000016
621 Ga0055525_1000033
622 Ga0055525_1000042
623 Ga0055525_1000173
624 Ga0055535_1006543
625 Ga0055528_1004616
626 Ga0055541_1000017
627 Ga0055541_1000045
628 Ga0055541_1000084
629 Ga0058692_1001492
630 Ga0065165_1000115
631 Ga0065165_1000820
632 Ga0070658_10060519
633 Ga0070676_10000216
634 Ga0070676_10016463
635 Ga0070670_100007274
636 Ga0070670_100026782
637 Ga0070670_100049102
638 Ga0070670_100069477
639 Ga0070677_10001090
640 Ga0068868_100026555
641 Ga0070660_100000001
642 Ga0070660_100005558
643 Ga0070689_100043520
644 Ga0070661_100045377
645 Ga0070661_100102914
646 Ga0070668_100003734
647 Ga0070668_100008159
648 Ga0070668_100119545
649 Ga0070669_100033238
650 Ga0070675_100028574
651 Ga0070671_100000488
652 Ga0070671_100002449
653 Ga0070671_100056008
654 Ga0070674_100058342
655 Ga0070673_100001385
656 Ga0070673_100058175
657 Ga0070659_100000941
658 Ga0070667_100002852
659 Ga0070667_100009065
660 Ga0070667_100011417
661 Ga0070667_100148645
662 Ga0070705_100014573
663 Ga0070663_100000078
664 Ga0070662_100023396
665 Ga0068867_100028402
666 Ga0068867_100029557
667 Ga0070698_100151336
668 Ga0070679_100080152
669 Ga0070697_100113282
670 Ga0070672_100003644
671 Ga0070672_100015142
672 Ga0070672_100110695
673 Ga0070695_100043069
674 Ga0070665_100004317
675 Ga0070664_100075214
676 Ga0068852_100000705
677 Ga0068852_100006811
678 Ga0068852_100014873
679 Ga0068852_100046989
680 Ga0068859_100004214
681 Ga0068864_100010031
682 Ga0068864_100015176
683 Ga0068864_100057215
684 Ga0068851_10000160
685 Ga0068870_10004282
686 Ga0068870_10007671
687 Ga0068863_100010612
688 Ga0068863_100018285
689 Ga0068863_100021755
690 Ga0068863_100032354
691 Ga0068863_100162928
692 Ga0068858_100007336
693 Ga0068858_100087800
694 Ga0097621_100007151
695 Ga0097621_100109799
696 Ga0097621_100152802
697 Ga0068871_100017293
698 Ga0068865_100037737
699 Ga0097620_100004214
700 Ga0105251_10000055
701 Ga0105240_10000497
702 Ga0105240_10070042
703 Ga0105240_10194130
704 Ga0105245_10031217
705 Ga0105243_10138348
706 Ga0105241_10008358
707 Ga0105242_10069431
708 Ga0105248_10000001
709 Ga0105248_10038841
710 Ga0105248_10150285
711 Ga0105248_10209610
712 Ga0105237_10012980
713 Ga0105237_10022717
714 Ga0105238_10000117
715 Ga0105238_10018532
716 Ga0105238_10076900
717 Ga0105239_10055330
718 Ga0105246_10040640
719 Ga0157369_10102804
720 Ga0157378_10013177
721 Ga0163162_10029670
722 Ga0163162_10035122
723 Ga0163162_10054879
724 Ga0157372_10131383
725 Ga0157375_10063213
726 Ga0157375_10155709
727 Ga0163163_10164829
728 Ga0157380_10101637
729 Ga0182008_10038540
730 Ga0157376_10025923
731 Ga0182006_1002575
732 Ga0182007_10001200
733 Ga0182005_1000351
734 Ga0182005_1006031
735 Ga0183361_10001
736 Ga0163161_10027953
737 Ga0213872_10000494
738 Ga0213872_10000677
739 Ga0213872_10018758
740 Ga0209435_100016
741 Ga0209435_100038
742 Ga0209435_100096
743 Ga0209436_100502
744 Ga0209784_100019
745 Ga0209784_100033
746 Ga0209566_100017
747 Ga0209566_100037
748 Ga0209566_100164
749 Ga0209674_100031
750 Ga0209674_100055
751 Ga0209674_101916
752 Ga0209672_100046
753 Ga0209672_100088
754 Ga0209147_100023
755 Ga0209147_100043
756 Ga0209147_100130
757 Ga0209147_100214
758 Ga0209563_100035
759 Ga0209563_100056
760 Ga0209437_100038
761 Ga0209437_100080
762 Ga0209258_100023
763 Ga0209258_100204
764 Ga0209258_100210
765 Ga0209646_1000033
766 Ga0209646_1000093
767 Ga0209026_1000031
768 Ga0209677_100020
769 Ga0209677_100034
770 Ga0209148_1000029
771 Ga0209148_1000488
772 Ga0209759_1000045
773 Ga0209759_1000175
774 Ga0209759_1000248
775 Ga0209233_1000049
776 Ga0209455_1000064
777 Ga0209455_1001513
778 Ga0209673_1000084
779 Ga0209130_1000629
780 Ga0209564_1012115
781 Ga0207426_1000007
782 Ga0207656_10000579
783 Ga0207713_1000089
784 Ga0207713_1000106
785 Ga0207680_10022248
786 Ga0207680_10116983
787 Ga0207647_10000540
788 Ga0207647_10032089
789 Ga0207645_10003305
790 Ga0207645_10045666
791 Ga0207643_10023328
792 Ga0207654_10000377
793 Ga0207707_10092147
794 Ga0207695_10001268
795 Ga0207695_10015644
796 Ga0207695_10045013
797 Ga0207671_10027390
798 Ga0207671_10039989
799 Ga0207657_10000022
800 Ga0207657_10010163
801 Ga0207649_10028303
802 Ga0207646_10020487
803 Ga0207681_10109236
804 Ga0207681_10148134
805 Ga0207694_10000103
806 Ga0207694_10008678
807 Ga0207650_10009704
808 Ga0207650_10015726
809 Ga0207650_10095015
810 Ga0207659_10001785
811 Ga0207659_10007159
812 Ga0207659_10036345
813 Ga0207644_10069150
814 Ga0207690_10000010
815 Ga0207706_10044172
816 Ga0207706_10050757
817 Ga0207686_10022236
818 Ga0207669_10040622
819 Ga0207691_10000379
820 Ga0207691_10001760
821 Ga0207691_10007201
822 Ga0207691_10048743
823 Ga0207711_10000001
824 Ga0207711_10015556
825 Ga0207689_10000049
826 Ga0207679_10038059
827 Ga0207679_10110517
828 Ga0207667_10000073
829 Ga0207667_10000076
830 Ga0207667_10000147
831 Ga0207667_10000166
832 Ga0207651_10058023
833 Ga0207668_10000663
834 Ga0207668_10043808
835 Ga0207668_10130684
836 Ga0207658_10029875
837 Ga0207658_10044034
838 Ga0207658_10113189
839 Ga0207639_10033215
840 Ga0207678_10000226
841 Ga0207641_10009182
842 Ga0207641_10020878
843 Ga0207641_10048521
844 Ga0207648_10038835
845 Ga0207648_10058195
846 Ga0207648_10095354
847 Ga0207648_10107639
848 Ga0207676_10015984
849 Ga0207676_10021344
850 Ga0207674_10019494
851 Ga0207674_10066633
852 Ga0207675_100000699
853 Ga0207675_100076460
854 Ga0207683_10000085
855 Ga0207683_10015787
856 Ga0207698_10012831
857 Ga0207698_10026426
858 Ga0209371_1000160
859 Ga0268266_10026630
860 Ga0268266_10091486
861 Ga0268265_10021904
862 Ga0268265_10144769
863 Ga0268256_1000132
864 Ga0316181_1138627
865 Ga0265330_10006819
866 Ga0265332_10001661
867 Ga0265328_10006749
868 Ga0265329_10004388
869 Ga0265331_10000579
870 Ga0265331_10005012
871 Ga0265327_10000302
872 Ga0265327_10003193
873 Ga0265316_10104503
874 Ga0307408_100001773
875 Ga0265314_10009471
876 Ga0307516_10107633
877 Ga0316577_10025177
878 Ga0307416_100004729
879 Ga0307416_100006471
880 Ga0373935_0053602
881 Ga0373937_0032992
882 Ga0316582_0013147
883 Ga0395900_0000474
884 Ga0395900_0000689
885 Ga0395900_0047336
886 Ga0395898_0004656
887 Ga0395901_0000019
888 Ga0395901_0000448
889 Ga0436361_0062839
890 Ga0436361_0298954
891 Ga0439448_0000123
892 Ga0439449_0000465
893 Ga0451577_0000315
894 Ga0466977_0000098
895 Ga0466966_0032581
896 Ga0453684_0001040
897 Ga0453684_0030477
898 Ga0466957_0124577
899 Ga0451576_0000034
900 Ga0451576_0000131
901 Ga0466958_0064918
902 Ga0495592_0015574
903 Ga0495592_0120510
904 Ga0495603_0013914
905 Ga0495590_0008583
906 Ga0495590_0023202
907 Ga0495591_001790
908 Ga0495629_0000041
909 Ga0495629_0012956
910 Ga0495629_0015579
911 Ga0495638_0010321
912 Ga0495651_0018070
913 Ga0495651_0033153
914 Ga0495651_0041725
915 Ga0495653_0015181
916 Ga0495653_0049679
917 Ga0495653_0053554
918 Ga0495650_0000084
919 Ga0495580_0000483
920 Ga0495580_0000497
921 Ga0495580_0004287
922 Ga0495580_0005465
923 Ga0495580_0010550
924 Ga0495582_0013809
925 Ga0495605_0001100
926 Ga0495605_0003028
927 Ga0495662_0019048
928 Ga0495662_0022335
929 Ga0495664_0004801
930 Ga0495585_0011381
931 Ga0495596_0004440
932 Ga0495596_0005409
933 Ga0495596_0019621
934 Ga0495583_0000609
935 Ga0495583_0012412
936 Ga0495606_0000075
937 Ga0495606_0027842
938 Ga0495606_0084979
939 Ga0495608_0004020
940 Ga0495608_0006949
941 Ga0495616_0003657
942 Ga0495616_0013000
943 Ga0495618_0015191
944 Ga0495618_0060142
945 Ga0495620_0011729
946 Ga0495628_0001453
947 Ga0495628_0012493
948 Ga0495628_0049454
949 Ga0495630_0008632
950 Ga0495630_0009354
951 Ga0495630_0077529
952 Ga0495644_0000683
953 Ga0495644_0000809
954 Ga0495648_0004880
955 Ga0495648_0006910
956 Ga0495648_0016382
957 Ga0495648_0018115
958 Ga0495648_0036250
959 Ga0495666_0005526
960 Ga0495666_0007842
961 Ga0495652_0005080
962 Ga0495652_0029637
963 Ga0495652_0077784
964 Ga0495652_0208219
965 Ga0495665_0017829
966 Ga0495640_0018174
967 Ga0495640_0031161
968 Ga0495586_0000941
969 Ga0495587_0009399
970 Ga0495587_0014043
971 Ga0495609_0003812
972 Ga0495645_0099018
973 Ga0495633_0012413
974 Ga0495634_0010774
975 Ga0495634_0011168
976 Ga0495611_0002122
977 Ga0495611_0002293
978 Ga0495625_0000888
979 Ga0495625_0040657
980 Ga0495625_0041176
981 Ga0495635_0012192
982 Ga0495635_0024821
983 Ga0495661_0012406
984 Ga0495661_0020675
985 Ga0495599_0017063
986 Ga0495599_0024960
987 Ga0495623_0018520
988 Ga0495623_0044242
989 Ga0495623_0059034
990 Ga0495646_0009890
991 Ga0495646_0018672
992 Ga0495613_0080313
993 Ga0495624_0004140
994 Ga0495624_0011627
995 Ga0495624_0014986
996 Ga0495624_0039993
997 Ga0495670_0002454
998 Ga0495671_0009423
999 Ga0495671_0023223
1000 Ga0495589_0005085
1001 Ga0495589_0005886
1002 Ga0495600_0000303
1003 Ga0495604_0002457
1004 Ga0495604_0005502
1005 Ga0495604_0007470
1006 Ga0495604_0103031
1007 Ga0495636_0007374
1008 Ga0495674_0017721
1009 Ga0495674_0027591
1010 Ga0495672_0000498
1011 Ga0495672_0021035
1012 Ga0495676_0012517
1013 Ga0495680_0054529
1014 Ga0495680_0065303
1015 Ga0495683_0001076
1016 Ga0495683_0001837
1017 Ga0495683_0010814
1018 Ga0495687_001078
1019 Ga0495687_007773
1020 Ga0495675_0012913
1021 Ga0495677_0000842
1022 Ga0495677_0028555
1023 Ga0495679_000007
1024 Ga0495679_005101
1025 Ga0495679_009170
1026 Ga0495685_000482
1027 Ga0495673_0021003
1028 Ga0495673_0029415
1029 Ga0495684_0030428
1030 Ga0495686_0000865
1031 Ga0495686_0000867
1032 Ga0495593_0026167
1033 Ga0495602_0005576
1034 Ga0495602_0024026
1035 Ga0495602_0099151
1036 Ga0495614_0006125
1037 Ga0495626_0000043
1038 Ga0495626_0010010
1039 Ga0495626_0029104
1040 Ga0496100_0016070
1041 Ga0496101_0042608
1042 Ga0496103_0022302
1043 Ga0496104_0027465
1044 Ga0496106_0000071
1045 Ga0496106_0061356
1046 Ga0496109_0103548
1047 Ga0496109_0244006
1048 Ga0496112_0002284
1049 Ga0496112_0094994
1050 Ga0496113_0000731
1051 Ga0496113_0001940
1052 Ga0496115_0013026
1053 Ga0496116_0046349
1054 Ga0496116_0057681
1055 Ga0496117_0000530
1056 Ga0496117_0009247
1057 Ga0496117_0034074
1058 Ga0496118_0001972
1059 Ga0496118_0002189
1060 Ga0496118_0014236
1061 Ga0496118_0029985
1062 Ga0496118_0056276
1063 Ga0496118_0056708
1064 Ga0496121_0000333
1065 Ga0496121_0006639
1066 Ga0496121_0046875
1067 Ga0496121_0079586
1068 Ga0496121_0148248
1069 Ga0496122_0000375
1070 Ga0496123_0000267
1071 Ga0496124_0002800
1072 Ga0496125_0000694
1073 Ga0496126_0000088
1074 Ga0496126_0003517
1075 Ga0496126_0006313
1076 Ga0496126_0006824
1077 Ga0495682_0000398
1078 Ga0495682_0001576
1079 Ga0495682_0025822
1080 Ga0501038_0147078
1081 Ga0501043_0041340
1082 Ga0501047_0200012
1083 Ga0501073_0188914
1084 Ga0501080_0092618
1085 Ga0501279_001782
1086 Ga0501035_0002740
1087 Ga0501035_0058201
1088 Ga0500588_0000145
1089 Ga0501084_0000347
1090 Ga0501082_0014699
1091 2501070797
1092 2501080322
1093 2501413631
1094 2511089702
1095 2511095099
1096 2511104758
1097 2511248903
1098 2512347356
1099 2513551386
1100 2513560028
1101 2513704744
1102 2514048024
1103 2515685313
1104 2515687956
1105 2519459860
1106 2521558934
1107 2550697207
1108 2553003742
1109 2563060031
1110 2585290624
1111 2599740232
1112 2599744092
1113 2600210827
1114 2643791181
1115 2644215390
1116 2652975140
1117 2676743557
1118 2713479252
1119 2723876223
1120 2746086361
1121 2746093361
1122 2753566267
1123 2765568830
1124 2792834689
1125 2808968323
1126 2809003154
1127 2809010431
1128 2809130665
1129 2809146086
1130 2809149857
1131 2817262144
1132 2817279845
1133 2817455550
1134 2819542394
1135 2819591364
1136 2819615456
1137 2819623933
1138 2819633695
1139 2821444684
1140 2829749734
1141 2839096289
1142 2842331828
1143 2842356141
1144 2842459341
1145 2852620001
1146 2855732953
1147 2855771705
1148 2856293254
1149 2857366627
1150 2863427296
1151 2870070097
1152 2881415758
1153 2883090527
1154 2884812918
1155 2884837160
1156 2884853452
1157 2885278546
1158 2894513734
1159 2896155431
1160 2900636405
1161 2902689101
1162 2904437382
1163 2904444625
1164 2904534720
1165 2904567678
1166 2904574920
1167 2904584609
1168 2904591076
1169 2904605296
1170 2904619076
1171 2919048464
1172 2919081015
1173 2919496071
1174 2919544349
1175 2921644141
1176 2923512595
1177 2923527891
1178 2928109502
1179 2928132626
1180 2928137044
1181 2928162052
1182 2928169282
1183 2928175453
1184 2928506572
1185 2928538989
1186 2981992802
1187 642418053
1188 642592062
1189 642620132
1190 651175182
1191 8003957293
1192 8018846266
1193 8020814250
1194 8020940010
1195 8020950361
1196 8020954707
1197 8021125552
1198 8039104491
1199 8040172105
1200 8040173986

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

32

526

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.933 6 502
6rko-assembly1.cif.gz_A cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9242 6 509
7oy2-assembly1.cif.gz_C high resolution structure of cytochrome bd-ii oxidase from e. coli 0.9228 6 502
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.9206 6 502
6rx4-assembly1.cif.gz_A the structure of bd oxidase from escherichia coli 0.9158 7 514
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.4812 22 257 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.4623 13 240 1.20.1630.10
af_Q54NX1_225_415_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4217 13 237 1.20.1250.20
af_Q54NX1_225_415_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3896 13 237 1.20.1250.20
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.377 22 257 1.20.1630.10
ID Description Score Start End GO Terms
AF-T0Y395-F1-model_v4 Cytochrome bd ubiquinol oxidase subunit I (EC 1.10.3.-) 0.9887 118 237 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A376UDY2-F1-model_v4 Cytochrome d ubiquinol oxidase subunit 1 (EC 1.10.3.-) 0.9815 130 236 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A833KMA1-F1-model_v4 deleted 0.967 252 390
AF-A0A6G3XUQ9-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.963 122 240 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A258KH10-F1-model_v4 Cytochrome d terminal oxidase subunit 1 0.9629 6 240 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Map