F467995

General Info

Members Datasets Scaffolds Average Seq Length
600 260 1200 202

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0253938|Ga0395900_0253938_596_1261
Length 221
Sequence VSIFRSRAEKKLVESGLDPGRLPPGQYLTEKWPVLHAGSVPKTDLAAWDFKVFGEVESPITLTYAELQALPQTEVTIDIHCVTRWSRFDTSFTGAHWRELAELVRPKSSARFVVAHAEQGFTSNVPLEALEDDNALVAWEADGEPLEPEHGWPLRLVVPSRYFWKSAKWLRALELLATDQPGFWERYGYHNDADYGRRSATPSESAKVSPLTEGHVRRGRS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
162 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
163 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
164 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
165 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
166 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 11.5
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0253938 3300037418 Bacteria 1758
2 Ga0070683_100002448 3300005329 Bacteria 14771
3 Ga0070683_100137254 3300005329 Bacteria 2316
4 Ga0070680_100527764 3300005336 Bacteria 1011
5 Ga0070682_100096275 3300005337 Bacteria 1945
6 Ga0068868_100111185 3300005338 Bacteria 2226
7 Ga0070660_100052317 3300005339 Bacteria 3149
8 Ga0070689_100031098 3300005340 Bacteria 4056
9 Ga0070691_10041882 3300005341 Bacteria 2166
10 Ga0070687_100263509 3300005343 Bacteria 1077
11 Ga0070692_10047294 3300005345 Bacteria 2226
12 Ga0070668_100252035 3300005347 Bacteria 1466
13 Ga0070671_100079242 3300005355 Bacteria 2745
14 Ga0070674_100036833 3300005356 Bacteria 3287
15 Ga0070674_100300261 3300005356 Bacteria 1280
16 Ga0070673_100158018 3300005364 Bacteria 1926
17 Ga0070673_100244313 3300005364 Bacteria 1562
18 Ga0070673_100527103 3300005364 Bacteria 1071
19 Ga0070688_100001134 3300005365 Bacteria 13349
20 Ga0070709_10136104 3300005434 Bacteria 1683
21 Ga0070709_10293697 3300005434 Bacteria 1185
22 Ga0070714_100040721 3300005435 Bacteria 3917
23 Ga0070714_100161003 3300005435 Bacteria 2030
24 Ga0070714_100988633 3300005435 Bacteria 818
25 Ga0070713_100029387 3300005436 Bacteria 4352
26 Ga0070713_100195697 3300005436 Bacteria 1823
27 Ga0070713_100939973 3300005436 Bacteria 832
28 Ga0070710_10021804 3300005437 Bacteria 3343
29 Ga0070710_10063229 3300005437 Bacteria 2114
30 Ga0070710_10380217 3300005437 Unclassified 942
31 Ga0070701_10012731 3300005438 Bacteria 3801
32 Ga0070711_100056121 3300005439 Bacteria 2722
33 Ga0070711_100059772 3300005439 Bacteria 2647
34 Ga0070711_100165682 3300005439 Bacteria 1680
35 Ga0070705_100028791 3300005440 Bacteria 3046
36 Ga0070705_100131640 3300005440 Bacteria 1632
37 Ga0070705_101029581 3300005440 Bacteria 670
38 Ga0070700_100054961 3300005441 Bacteria 2490
39 Ga0070700_100498924 3300005441 Bacteria 936
40 Ga0070694_100036340 3300005444 Bacteria 3263
41 Ga0070694_100166738 3300005444 Bacteria 1620
42 Ga0070694_100656807 3300005444 Bacteria 849
43 Ga0070708_100060745 3300005445 Bacteria 3374
44 Ga0070708_100090104 3300005445 Bacteria 2791
45 Ga0070708_100607799 3300005445 Unclassified 1031
46 Ga0070678_100052251 3300005456 Bacteria 2966
47 Ga0070662_100566380 3300005457 Bacteria 953
48 Ga0070681_10563643 3300005458 Bacteria 1053
49 Ga0068867_100035456 3300005459 Bacteria 3618
50 Ga0070685_10015389 3300005466 Bacteria 4062
51 Ga0070706_100028202 3300005467 Bacteria 5167
52 Ga0070706_100082459 3300005467 Bacteria 2979
53 Ga0070706_100120508 3300005467 Bacteria 2445
54 Ga0070706_100123820 3300005467 Bacteria 2410
55 Ga0070706_100129347 3300005467 Bacteria 2356
56 Ga0070707_100008485 3300005468 Bacteria 9544
57 Ga0070707_100018817 3300005468 Bacteria 6503
58 Ga0070707_100043068 3300005468 Bacteria 4321
59 Ga0070698_100113498 3300005471 Bacteria 2674
60 Ga0070698_100183608 3300005471 Bacteria 2030
61 Ga0070698_100267837 3300005471 Bacteria 1640
62 Ga0070698_100409392 3300005471 Unclassified 1290
63 Ga0070699_100004055 3300005518 Bacteria 12948
64 Ga0070699_100068745 3300005518 Bacteria 3077
65 Ga0070699_100070086 3300005518 Bacteria 3047
66 Ga0070699_100238903 3300005518 Bacteria 1621
67 Ga0070699_100445726 3300005518 Bacteria 1173
68 Ga0070684_100009615 3300005535 Bacteria 7621
69 Ga0070684_100126956 3300005535 Bacteria 2298
70 Ga0070697_100239288 3300005536 Bacteria 1550
71 Ga0070697_100363801 3300005536 Bacteria 1251
72 Ga0070697_100386059 3300005536 Bacteria 1213
73 Ga0070697_100478993 3300005536 Bacteria 1087
74 Ga0068853_100097749 3300005539 Bacteria 2592
75 Ga0070672_100082126 3300005543 Bacteria 2585
76 Ga0070695_100136219 3300005545 Bacteria 1698
77 Ga0070695_100556830 3300005545 Bacteria 894
78 Ga0070696_100035132 3300005546 Bacteria 3449
79 Ga0070696_100055831 3300005546 Bacteria 2754
80 Ga0070696_100144780 3300005546 Bacteria 1740
81 Ga0070696_100168238 3300005546 Bacteria 1619
82 Ga0070693_100156257 3300005547 Bacteria 1449
83 Ga0070704_100021401 3300005549 Bacteria 4192
84 Ga0070704_100044144 3300005549 Bacteria 3095
85 Ga0070704_100177476 3300005549 Bacteria 1700
86 Ga0070704_100374555 3300005549 Bacteria 1208
87 Ga0068855_100674158 3300005563 Bacteria 1108
88 Ga0070664_100007271 3300005564 Bacteria 8924
89 Ga0070664_100161160 3300005564 Bacteria 1985
90 Ga0068857_100022264 3300005577 Bacteria 5575
91 Ga0068856_100007450 3300005614 Bacteria 10679
92 Ga0068856_100222700 3300005614 Bacteria 1902
93 Ga0070702_100042008 3300005615 Bacteria 2568
94 Ga0070702_100336988 3300005615 Bacteria 1057
95 Ga0070702_100349381 3300005615 Bacteria 1041
96 Ga0068852_100298764 3300005616 Bacteria 1558
97 Ga0068861_100426258 3300005719 Bacteria 1183
98 Ga0068862_100296780 3300005844 Bacteria 1486
99 Ga0068862_101475792 3300005844 Bacteria 685
100 Ga0081455_10033859 3300005937 Bacteria 4585
101 Ga0081455_10068298 3300005937 Bacteria 2959
102 Ga0081455_10434521 3300005937 Bacteria 901
103 Ga0081538_10100629 3300005981 Bacteria 1457
104 Ga0081540_1026128 3300005983 Bacteria 3341
105 Ga0081539_10002800 3300005985 Bacteria 23310
106 Ga0070717_10033031 3300006028 Bacteria 4172
107 Ga0070717_10251692 3300006028 Bacteria 1561
108 Ga0075365_10019603 3300006038 Bacteria 4178
109 Ga0075363_100072166 3300006048 Bacteria 1877
110 Ga0070715_10009031 3300006163 Bacteria 3498
111 Ga0070715_10087657 3300006163 Bacteria 1425
112 Ga0070715_10232354 3300006163 Bacteria 954
113 Ga0070716_100045782 3300006173 Bacteria 2458
114 Ga0070716_100696944 3300006173 Bacteria 775
115 Ga0070712_100015156 3300006175 Bacteria 4957
116 Ga0070712_100035908 3300006175 Bacteria 3368
117 Ga0070712_100047057 3300006175 Bacteria 2984
118 Ga0070712_100067461 3300006175 Bacteria 2545
119 Ga0070712_100093166 3300006175 Bacteria 2211
120 Ga0070712_100282469 3300006175 Bacteria 1337
121 Ga0097621_100726400 3300006237 Bacteria 916
122 Ga0068871_100099557 3300006358 Bacteria 2434
123 Ga0075428_100032860 3300006844 Bacteria 5729
124 Ga0075428_100401715 3300006844 Bacteria 1468
125 Ga0075428_100715878 3300006844 Bacteria 1066
126 Ga0075428_101232591 3300006844 Bacteria 788
127 Ga0075430_100141022 3300006846 Bacteria 2007
128 Ga0075430_100474011 3300006846 Bacteria 1033
129 Ga0075431_100023555 3300006847 Bacteria 6301
130 Ga0075431_100089313 3300006847 Bacteria 3181
131 Ga0075431_100293273 3300006847 Bacteria 1645
132 Ga0075433_10001563 3300006852 Bacteria 16931
133 Ga0075433_10010945 3300006852 Bacteria 7297
134 Ga0075433_10070110 3300006852 Bacteria 3080
135 Ga0075433_10194377 3300006852 Bacteria 1805
136 Ga0075434_100023612 3300006871 Bacteria 5996
137 Ga0075434_100039430 3300006871 Bacteria 4680
138 Ga0075434_100048318 3300006871 Bacteria 4222
139 Ga0075434_100116762 3300006871 Bacteria 2682
140 Ga0075434_100291961 3300006871 Bacteria 1650
141 Ga0075429_100005393 3300006880 Bacteria 11003
142 Ga0068865_100050764 3300006881 Bacteria 2867
143 Ga0068865_100208831 3300006881 Bacteria 1520
144 Ga0075436_100014890 3300006914 Bacteria 5329
145 Ga0075436_100023075 3300006914 Bacteria 4273
146 Ga0075436_100029761 3300006914 Bacteria 3755
147 Ga0075436_100036815 3300006914 Bacteria 3378
148 Ga0075436_100146483 3300006914 Bacteria 1661
149 Ga0075435_100006788 3300007076 Bacteria 8123
150 Ga0075435_100044774 3300007076 Bacteria 3545
151 Ga0111539_10020230 3300009094 Bacteria 8203
152 Ga0111539_10033204 3300009094 Bacteria 6267
153 Ga0111539_10182953 3300009094 Bacteria 2448
154 Ga0111539_10254328 3300009094 Bacteria 2046
155 Ga0105245_10002969 3300009098 Bacteria 15201
156 Ga0105245_10021247 3300009098 Bacteria 5691
157 Ga0105245_10023440 3300009098 Bacteria 5418
158 Ga0105245_10114264 3300009098 Bacteria 2514
159 Ga0105245_10527400 3300009098 Bacteria 1200
160 Ga0105247_10125599 3300009101 Bacteria 1667
161 Ga0114129_10003097 3300009147 Bacteria 23330
162 Ga0114129_10006703 3300009147 Bacteria 16355
163 Ga0114129_10013111 3300009147 Bacteria 11805
164 Ga0114129_10030355 3300009147 Bacteria 7649
165 Ga0114129_10063631 3300009147 Bacteria 5150
166 Ga0114129_10079170 3300009147 Bacteria 4570
167 Ga0114129_10138619 3300009147 Bacteria 3337
168 Ga0114129_10229494 3300009147 Bacteria 2501
169 Ga0114129_10517596 3300009147 Bacteria 1556
170 Ga0105243_10014835 3300009148 Bacteria 5895
171 Ga0105243_10290528 3300009148 Bacteria 1477
172 Ga0105243_10317478 3300009148 Bacteria 1418
173 Ga0105241_10079111 3300009174 Bacteria 2570
174 Ga0105242_11548150 3300009176 Bacteria 695
175 Ga0105248_10161945 3300009177 Bacteria 2523
176 Ga0105248_10598752 3300009177 Bacteria 1244
177 Ga0105238_10227857 3300009551 Bacteria 1840
178 Ga0105249_10069715 3300009553 Bacteria 3245
179 Ga0105249_10108948 3300009553 Bacteria 2615
180 Ga0105239_10001224 3300010375 Bacteria 34981
181 Ga0157369_10573323 3300013105 Bacteria 1166
182 Ga0157374_10002604 3300013296 Bacteria 15209
183 Ga0163162_10028569 3300013306 Bacteria 5519
184 Ga0157375_10011701 3300013308 Bacteria 7754
185 Ga0157375_10012783 3300013308 Bacteria 7453
186 Ga0157375_10263383 3300013308 Bacteria 1885
187 Ga0157375_10948393 3300013308 Bacteria 1002
188 Ga0157380_10013146 3300014326 Bacteria 6027
189 Ga0157377_10051582 3300014745 Bacteria 2321
190 Ga0157377_10283519 3300014745 Bacteria 1087
191 Ga0157379_10228948 3300014968 Bacteria 1685
192 Ga0157376_10030319 3300014969 Bacteria 4319
193 Ga0157376_10570486 3300014969 Bacteria 1122
194 Ga0157376_10671571 3300014969 Bacteria 1039
195 Ga0207653_10026741 3300025885 Bacteria 1851
196 Ga0207692_10084488 3300025898 Bacteria 1706
197 Ga0207710_10061733 3300025900 Bacteria 1701
198 Ga0207688_10101911 3300025901 Bacteria 1659
199 Ga0207688_10122067 3300025901 Bacteria 1521
200 Ga0207680_10082903 3300025903 Bacteria 2019
201 Ga0207685_10010745 3300025905 Bacteria 2720
202 Ga0207685_10021100 3300025905 Bacteria 2177
203 Ga0207685_10160847 3300025905 Bacteria 1025
204 Ga0207685_10354401 3300025905 Bacteria 741
205 Ga0207699_10004795 3300025906 Bacteria 6471
206 Ga0207699_10212812 3300025906 Bacteria 1315
207 Ga0207643_10066657 3300025908 Bacteria 2065
208 Ga0207643_10127558 3300025908 Bacteria 1511
209 Ga0207684_10054520 3300025910 Bacteria 3392
210 Ga0207684_10078688 3300025910 Bacteria 2804
211 Ga0207684_10311045 3300025910 Bacteria 1358
212 Ga0207684_10355981 3300025910 Bacteria 1260
213 Ga0207684_10493842 3300025910 Bacteria 1049
214 Ga0207684_10811251 3300025910 Bacteria 791
215 Ga0207693_10004094 3300025915 Bacteria 12390
216 Ga0207693_10004171 3300025915 Bacteria 12266
217 Ga0207693_10086802 3300025915 Bacteria 2452
218 Ga0207693_10126158 3300025915 Bacteria 2012
219 Ga0207663_10006216 3300025916 Bacteria 6090
220 Ga0207660_10475002 3300025917 Bacteria 1013
221 Ga0207662_10114638 3300025918 Bacteria 1684
222 Ga0207657_10074572 3300025919 Bacteria 2865
223 Ga0207646_10007910 3300025922 Bacteria 10730
224 Ga0207646_10031294 3300025922 Bacteria 4817
225 Ga0207646_10079659 3300025922 Bacteria 2929
226 Ga0207646_10238455 3300025922 Bacteria 1643
227 Ga0207646_10567102 3300025922 Unclassified 1020
228 Ga0207687_10023141 3300025927 Bacteria 4139
229 Ga0207687_10025640 3300025927 Bacteria 3945
230 Ga0207687_10073108 3300025927 Bacteria 2454
231 Ga0207687_10348247 3300025927 Bacteria 1206
232 Ga0207687_10475362 3300025927 Bacteria 1040
233 Ga0207700_10000001 3300025928 Bacteria 1122509
234 Ga0207700_10102675 3300025928 Bacteria 2284
235 Ga0207664_10275387 3300025929 Bacteria 1475
236 Ga0207644_10040919 3300025931 Bacteria 3277
237 Ga0207706_10168975 3300025933 Bacteria 1922
238 Ga0207706_10431365 3300025933 Bacteria 1141
239 Ga0207706_10767639 3300025933 Bacteria 821
240 Ga0207709_10193934 3300025935 Bacteria 1445
241 Ga0207670_10027924 3300025936 Bacteria 3575
242 Ga0207669_10047158 3300025937 Bacteria 2550
243 Ga0207669_10127093 3300025937 Bacteria 1744
244 Ga0207669_10841416 3300025937 Bacteria 763
245 Ga0207704_10043408 3300025938 Bacteria 2655
246 Ga0207704_10263062 3300025938 Bacteria 1302
247 Ga0207665_10014230 3300025939 Bacteria 5235
248 Ga0207691_10007005 3300025940 Bacteria 10877
249 Ga0207711_10032021 3300025941 Bacteria 4444
250 Ga0207711_10154278 3300025941 Bacteria 2074
251 Ga0207661_10004885 3300025944 Bacteria 9396
252 Ga0207661_10016805 3300025944 Bacteria 5402
253 Ga0207667_10374717 3300025949 Bacteria 1450
254 Ga0207712_10108555 3300025961 Bacteria 2077
255 Ga0207668_10141848 3300025972 Bacteria 1849
256 Ga0207677_10040408 3300026023 Bacteria 3075
257 Ga0207677_10070003 3300026023 Bacteria 2470
258 Ga0207677_10757696 3300026023 Bacteria 866
259 Ga0207639_10112408 3300026041 Bacteria 2222
260 Ga0207678_10344964 3300026067 Bacteria 1284
261 Ga0207708_10026418 3300026075 Bacteria 4393
262 Ga0207702_10040747 3300026078 Bacteria 3893
263 Ga0207702_10178862 3300026078 Bacteria 1952
264 Ga0207702_10524356 3300026078 Bacteria 1157
265 Ga0207641_10116423 3300026088 Bacteria 2378
266 Ga0207648_10033273 3300026089 Bacteria 4547
267 Ga0207648_10794817 3300026089 Bacteria 880
268 Ga0207674_10001668 3300026116 Bacteria 28575
269 Ga0207674_10053097 3300026116 Bacteria 4131
270 Ga0207674_10084178 3300026116 Bacteria 3179
271 Ga0207675_100006676 3300026118 Bacteria 10918
272 Ga0207683_10013193 3300026121 Bacteria 7048
273 Ga0207698_10050131 3300026142 Bacteria 3182
274 Ga0207428_10021153 3300027907 Bacteria 5510
275 Ga0207428_10061240 3300027907 Bacteria 2980
276 Ga0268265_11053098 3300028380 Bacteria 806
277 Ga0265334_10067458 3300028573 Bacteria 1337
278 Ga0265316_10605955 3300031344 Bacteria 776
279 Ga0316576_10040551 3300031727 Bacteria 3347
280 Ga0307406_10098815 3300031901 Bacteria 1983
281 Ga0307412_10231203 3300031911 Bacteria 1424
282 Ga0307409_100203407 3300031995 Bacteria 1774
283 Ga0307416_100110882 3300032002 Bacteria 2417
284 Ga0307415_100090302 3300032126 Bacteria 2215
285 Ga0307415_100879729 3300032126 Bacteria 824
286 Ga0373958_0003926 3300034819 Bacteria 2174
287 Ga0373929_0067580 3300035085 Bacteria 849
288 Ga0373949_0003340 3300035090 Bacteria 3849
289 Ga0373941_0001929 3300035115 Bacteria 4496
290 Ga0373942_0004574 3300035207 Bacteria 3208
291 Ga0373961_0007173 3300035241 Bacteria 2690
292 Ga0373962_0003520 3300035242 Bacteria 3761
293 Ga0373931_0002701 3300035691 Bacteria 7892
294 Ga0373937_0148116 3300036401 Bacteria 2198
295 Ga0395899_0008359 3300037312 Bacteria 7967
296 Ga0395899_0013793 3300037312 Bacteria 6177
297 Ga0395899_0015204 3300037312 Bacteria 5869
298 Ga0395899_0057237 3300037312 Bacteria 2879
299 Ga0395899_0065808 3300037312 Bacteria 2663
300 Ga0395899_0066387 3300037312 Bacteria 2649
301 Ga0395899_0143519 3300037312 Bacteria 1697
302 Ga0395899_0195619 3300037312 Bacteria 1413
303 Ga0395900_0006998 3300037418 Bacteria 11683
304 Ga0395900_0008636 3300037418 Bacteria 10470
305 Ga0395900_0010995 3300037418 Bacteria 9253
306 Ga0395900_0020170 3300037418 Bacteria 6801
307 Ga0395900_0025066 3300037418 Bacteria 6105
308 Ga0395900_0028554 3300037418 Bacteria 5716
309 Ga0395900_0032257 3300037418 Bacteria 5385
310 Ga0395900_0047265 3300037418 Bacteria 4431
311 Ga0395900_0056158 3300037418 Bacteria 4053
312 Ga0395900_0064843 3300037418 Bacteria 3752
313 Ga0395900_0065243 3300037418 Bacteria 3740
314 Ga0395900_0071180 3300037418 Bacteria 3574
315 Ga0395900_0084313 3300037418 Bacteria 3265
316 Ga0395900_0088684 3300037418 Bacteria 3180
317 Ga0395900_0093486 3300037418 Bacteria 3089
318 Ga0395900_0095560 3300037418 Bacteria 3053
319 Ga0395900_0125244 3300037418 Bacteria 2635
320 Ga0395900_0130008 3300037418 Bacteria 2581
321 Ga0395900_0156106 3300037418 Bacteria 2330
322 Ga0395900_0166139 3300037418 Bacteria 2249
323 Ga0395900_0685392 3300037418 Bacteria 959
324 Ga0395900_0795713 3300037418 Bacteria 874
325 Ga0395900_1259545 3300037418 Bacteria 654
326 Ga0395898_0009044 3300037466 Bacteria 10488
327 Ga0395898_0027223 3300037466 Bacteria 5741
328 Ga0395898_0035149 3300037466 Bacteria 4987
329 Ga0395898_0035391 3300037466 Bacteria 4966
330 Ga0395898_0036792 3300037466 Bacteria 4858
331 Ga0395898_0043216 3300037466 Bacteria 4441
332 Ga0395898_0061923 3300037466 Bacteria 3635
333 Ga0395898_0068134 3300037466 Bacteria 3444
334 Ga0395898_0075921 3300037466 Bacteria 3245
335 Ga0395898_0091691 3300037466 Bacteria 2923
336 Ga0395898_0093835 3300037466 Bacteria 2884
337 Ga0395898_0106778 3300037466 Bacteria 2685
338 Ga0395898_0121035 3300037466 Bacteria 2507
339 Ga0395898_0148492 3300037466 Bacteria 2243
340 Ga0395898_0201714 3300037466 Bacteria 1899
341 Ga0395898_0225957 3300037466 Bacteria 1785
342 Ga0395898_0253254 3300037466 Bacteria 1679
343 Ga0395898_0274918 3300037466 Bacteria 1606
344 Ga0395898_0299268 3300037466 Bacteria 1535
345 Ga0395898_0505362 3300037466 Bacteria 1149
346 Ga0395898_0919804 3300037466 Bacteria 812
347 Ga0395905_0009887 3300037471 Bacteria 9296
348 Ga0395905_0016452 3300037471 Bacteria 7031
349 Ga0395905_0028406 3300037471 Bacteria 5274
350 Ga0395905_0046649 3300037471 Bacteria 4063
351 Ga0395905_0050598 3300037471 Bacteria 3892
352 Ga0395905_0068168 3300037471 Bacteria 3333
353 Ga0395905_0083578 3300037471 Bacteria 2991
354 Ga0395905_0084085 3300037471 Bacteria 2981
355 Ga0395905_0110499 3300037471 Bacteria 2581
356 Ga0395905_0140019 3300037471 Bacteria 2276
357 Ga0395905_0194278 3300037471 Bacteria 1903
358 Ga0395905_0210238 3300037471 Bacteria 1823
359 Ga0395905_0214335 3300037471 Bacteria 1803
360 Ga0395905_0222576 3300037471 Bacteria 1766
361 Ga0395905_0250284 3300037471 Bacteria 1655
362 Ga0395905_0253543 3300037471 Bacteria 1644
363 Ga0395905_0354945 3300037471 Unclassified 1358
364 Ga0395905_0461052 3300037471 Bacteria 1169
365 Ga0395905_1065294 3300037471 Bacteria 712
366 Ga0395901_0002203 3300038443 Bacteria 19874
367 Ga0395901_0008484 3300038443 Bacteria 10384
368 Ga0395901_0010147 3300038443 Bacteria 9541
369 Ga0395901_0010320 3300038443 Bacteria 9459
370 Ga0395901_0016132 3300038443 Bacteria 7608
371 Ga0395901_0018190 3300038443 Bacteria 7174
372 Ga0395901_0026774 3300038443 Bacteria 5920
373 Ga0395901_0028587 3300038443 Bacteria 5734
374 Ga0395901_0029809 3300038443 Bacteria 5620
375 Ga0395901_0033446 3300038443 Bacteria 5309
376 Ga0395901_0037264 3300038443 Bacteria 5030
377 Ga0395901_0037984 3300038443 Bacteria 4980
378 Ga0395901_0041629 3300038443 Bacteria 4762
379 Ga0395901_0052126 3300038443 Bacteria 4253
380 Ga0395901_0058669 3300038443 Bacteria 4003
381 Ga0395901_0060326 3300038443 Bacteria 3947
382 Ga0395901_0062642 3300038443 Bacteria 3870
383 Ga0395901_0079217 3300038443 Bacteria 3430
384 Ga0395901_0080137 3300038443 Bacteria 3408
385 Ga0395901_0160237 3300038443 Bacteria 2363
386 Ga0395901_0186424 3300038443 Bacteria 2176
387 Ga0395901_0238728 3300038443 Bacteria 1896
388 Ga0395901_0245825 3300038443 Bacteria 1865
389 Ga0395901_0332244 3300038443 Bacteria 1571
390 Ga0395901_0349756 3300038443 Bacteria 1525
391 Ga0395901_0379420 3300038443 Bacteria 1455
392 Ga0395901_0447282 3300038443 Bacteria 1322
393 Ga0395901_0650795 3300038443 Bacteria 1057
394 Ga0395901_0793866 3300038443 Bacteria 936
395 Ga0395901_0841588 3300038443 Bacteria 903
396 Ga0451789_1224026 3300041443 Bacteria 1686
397 Ga0451793_0645183 3300041452 Bacteria 1767
398 Ga0451795_0481492 3300041456 Bacteria 1968
399 Ga0451802_0050302 3300041460 Bacteria 2031
400 Ga0451807_0287879 3300041486 Bacteria 3397
401 Ga0451833_0455699 3300041491 Bacteria 1388
402 Ga0451835_0177913 3300041492 Bacteria 3211
403 Ga0451839_1531166 3300041496 Bacteria 1701
404 Ga0451845_0626299 3300041501 Bacteria 1111
405 Ga0451847_0886257 3300041503 Bacteria 1450
406 Ga0451855_0382208 3300041511 Bacteria 874
407 Ga0450923_018675 3300042125 Bacteria 1329
408 Ga0439458_0041209 3300042157 Bacteria 1121
409 Ga0451577_0142680 3300042876 Bacteria 2153
410 Ga0466965_0106102 3300044683 Bacteria 1441
411 Ga0466964_0003056 3300044706 Bacteria 6076
412 Ga0466968_0037239 3300044735 Bacteria 2040
413 Ga0466960_0037308 3300044901 Bacteria 2279
414 Ga0451576_1065573 3300045051 Bacteria 846
415 Ga0466967_0004561 3300045976 Bacteria 9379
416 Ga0466967_0050161 3300045976 Bacteria 3654
417 Ga0495592_0147780 3300046454 Bacteria 1628
418 Ga0495603_0076542 3300046455 Bacteria 1964
419 Ga0495603_0098927 3300046455 Bacteria 1703
420 Ga0495641_0219855 3300046461 Bacteria 852
421 Ga0495651_0155213 3300046462 Bacteria 1646
422 Ga0495582_0098509 3300046473 Bacteria 1636
423 Ga0495582_0128035 3300046473 Bacteria 1433
424 Ga0495605_0203509 3300046474 Bacteria 862
425 Ga0495639_0281685 3300046475 Bacteria 826
426 Ga0495664_0079127 3300046477 Bacteria 1970
427 Ga0495584_0180859 3300046491 Bacteria 1072
428 Ga0495584_0388706 3300046491 Bacteria 709
429 Ga0495594_0503664 3300046499 Bacteria 688
430 Ga0495607_0168242 3300046501 Bacteria 1109
431 Ga0495616_0081889 3300046513 Bacteria 1543
432 Ga0495616_0105966 3300046513 Bacteria 1312
433 Ga0495618_0069519 3300046514 Bacteria 2239
434 Ga0495631_0180251 3300046518 Bacteria 905
435 Ga0495642_0064222 3300046528 Bacteria 1527
436 Ga0495665_0075423 3300046531 Bacteria 1775
437 Ga0495656_0171372 3300046615 Bacteria 1061
438 Ga0495659_0063217 3300046664 Bacteria 1372
439 Ga0495659_0215610 3300046664 Bacteria 791
440 Ga0495588_0043942 3300046674 Bacteria 2287
441 Ga0495588_0305575 3300046674 Bacteria 837
442 Ga0495647_0008084 3300046681 Bacteria 3535
443 Ga0495658_0533707 3300046683 Bacteria 751
444 Ga0495613_0371863 3300046689 Bacteria 979
445 Ga0495581_0024096 3300047315 Bacteria 3526
446 Ga0495636_0170991 3300047318 Bacteria 983
447 Ga0495676_0095474 3300047321 Bacteria 2212
448 Ga0495676_0617608 3300047321 Bacteria 705
449 Ga0495680_0132855 3300047322 Bacteria 1827
450 Ga0495614_0048180 3300048089 Bacteria 1827
451 Ga0496100_0041638 3300048903 Bacteria 2929
452 Ga0496100_0127558 3300048903 Bacteria 1787
453 Ga0496100_0475606 3300048903 Bacteria 960
454 Ga0496101_0187374 3300048904 Bacteria 1595
455 Ga0496101_0197739 3300048904 Bacteria 1553
456 Ga0496101_0435745 3300048904 Bacteria 1034
457 Ga0496102_0001216 3300048905 Bacteria 23348
458 Ga0496102_0098373 3300048905 Bacteria 2715
459 Ga0496102_0284675 3300048905 Bacteria 1558
460 Ga0496104_0021069 3300048907 Bacteria 5980
461 Ga0496104_0241061 3300048907 Bacteria 1720
462 Ga0496104_0325030 3300048907 Bacteria 1451
463 Ga0496104_0607788 3300048907 Bacteria 1003
464 Ga0496105_0004138 3300048908 Bacteria 10882
465 Ga0496105_0054456 3300048908 Bacteria 3303
466 Ga0496105_0086079 3300048908 Bacteria 2597
467 Ga0496105_0126450 3300048908 Bacteria 2107
468 Ga0496105_0296174 3300048908 Bacteria 1301
469 Ga0496106_0059103 3300048909 Bacteria 2903
470 Ga0496107_0044574 3300048910 Bacteria 3188
471 Ga0496107_0047666 3300048910 Bacteria 3085
472 Ga0496108_0010709 3300048911 Bacteria 7441
473 Ga0496108_0054575 3300048911 Bacteria 3353
474 Ga0496108_0184769 3300048911 Bacteria 1805
475 Ga0496108_0187603 3300048911 Bacteria 1791
476 Ga0496109_0000533 3300048912 Bacteria 32234
477 Ga0496109_0004031 3300048912 Bacteria 12269
478 Ga0496109_0083395 3300048912 Bacteria 2947
479 Ga0496109_0136623 3300048912 Bacteria 2291
480 Ga0496109_0185376 3300048912 Bacteria 1955
481 Ga0496109_0225240 3300048912 Bacteria 1764
482 Ga0496109_0426074 3300048912 Bacteria 1253
483 Ga0496109_0627098 3300048912 Bacteria 1012
484 Ga0496109_1050407 3300048912 Bacteria 752
485 Ga0496110_0003502 3300048913 Bacteria 12044
486 Ga0496110_0020341 3300048913 Bacteria 5605
487 Ga0496110_0139189 3300048913 Bacteria 2194
488 Ga0496110_0197564 3300048913 Bacteria 1827
489 Ga0496110_0333936 3300048913 Bacteria 1381
490 Ga0496110_0396570 3300048913 Bacteria 1258
491 Ga0496110_0468390 3300048913 Bacteria 1148
492 Ga0496110_0483449 3300048913 Bacteria 1128
493 Ga0496110_1019623 3300048913 Bacteria 735
494 Ga0496111_0039435 3300048914 Bacteria 3386
495 Ga0496111_0065155 3300048914 Bacteria 2644
496 Ga0496111_0131654 3300048914 Bacteria 1851
497 Ga0496111_0184533 3300048914 Bacteria 1551
498 Ga0496112_0001663 3300048915 Bacteria 17282
499 Ga0496112_0007876 3300048915 Bacteria 9488
500 Ga0496112_0087822 3300048915 Bacteria 3076
501 Ga0496112_0089512 3300048915 Bacteria 3046
502 Ga0496112_0291283 3300048915 Bacteria 1578
503 Ga0496112_0349173 3300048915 Bacteria 1422
504 Ga0496112_1094251 3300048915 Bacteria 715
505 Ga0496113_0017292 3300048916 Bacteria 5002
506 Ga0496113_0051063 3300048916 Bacteria 3085
507 Ga0496113_0077965 3300048916 Bacteria 2535
508 Ga0496113_0133627 3300048916 Bacteria 1949
509 Ga0496114_0074540 3300048917 Bacteria 2857
510 Ga0496114_0211486 3300048917 Bacteria 1701
511 Ga0496114_0767699 3300048917 Bacteria 842
512 Ga0496115_0014883 3300048918 Bacteria 5899
513 Ga0496115_0061918 3300048918 Bacteria 3018
514 Ga0496115_0197638 3300048918 Bacteria 1661
515 Ga0501031_0003860 3300049568 Bacteria 9641
516 Ga0501032_0004241 3300049569 Bacteria 10832
517 Ga0501033_0018944 3300049570 Bacteria 5202
518 Ga0501036_0337575 3300049572 Bacteria 1258
519 Ga0501037_0016483 3300049573 Bacteria 5439
520 Ga0501038_0058803 3300049574 Bacteria 3294
521 Ga0501040_0015378 3300049576 Bacteria 5060
522 Ga0501040_0178319 3300049576 Bacteria 1505
523 Ga0501041_0026906 3300049577 Bacteria 3464
524 Ga0501041_0084632 3300049577 Bacteria 1954
525 Ga0501042_0008571 3300049578 Bacteria 6762
526 Ga0501042_0051592 3300049578 Bacteria 2934
527 Ga0501046_0011444 3300049580 Bacteria 7582
528 Ga0501046_0161042 3300049580 Bacteria 1688
529 Ga0501046_0569934 3300049580 Bacteria 806
530 Ga0501048_0001065 3300049582 Bacteria 20549
531 Ga0501048_0079640 3300049582 Bacteria 2312
532 Ga0501068_0024072 3300049584 Bacteria 3573
533 Ga0501069_0006041 3300049585 Bacteria 6321
534 Ga0501070_0002312 3300049586 Bacteria 16724
535 Ga0501071_0746223 3300049587 Bacteria 754
536 Ga0501072_0007268 3300049588 Bacteria 8403
537 Ga0501072_0245362 3300049588 Bacteria 1426
538 Ga0501073_0269645 3300049589 Bacteria 1174
539 Ga0501074_0081500 3300049590 Bacteria 2320
540 Ga0501075_0001970 3300049591 Bacteria 13550
541 Ga0501075_0063025 3300049591 Bacteria 2795
542 Ga0501076_0004573 3300049592 Bacteria 9850
543 Ga0501076_0279096 3300049592 Bacteria 1368
544 Ga0501079_0023435 3300049741 Bacteria 4737
545 Ga0501079_0393702 3300049741 Bacteria 1086
546 Ga0501080_0042363 3300049742 Bacteria 4239
547 Ga0501080_0566179 3300049742 Bacteria 1011
548 Ga0501081_0114947 3300049743 Bacteria 1912
549 Ga0501081_0175770 3300049743 Bacteria 1547
550 Ga0501083_0011445 3300049744 Bacteria 6223
551 Ga0501035_0055677 3300049822 Bacteria 3530
552 Ga0501044_0014676 3300049823 Bacteria 8446
553 Ga0501045_0251202 3300049824 Bacteria 1316
554 nmdc:mga03n38_68385_c1 3300050490 Bacteria 1637
555 nmdc:mga0yw44_184067_c1 3300050492 Bacteria 1376
556 nmdc:mga05p37_121751_c1 3300050507 Bacteria 3204
557 nmdc:mga05p37_273671_c1 3300050507 Bacteria 2017
558 nmdc:mga05p37_281927_c1 3300050507 Bacteria 1981
559 nmdc:mga05p37_2932_c1 3300050507 Bacteria 19794
560 nmdc:mga05p37_330459_c1 3300050507 Bacteria 1801
561 nmdc:mga05p37_39286_c1 3300050507 Bacteria 5810
562 nmdc:mga05p37_5738_c1 3300050507 Bacteria 14599
563 nmdc:mga09592_49700_c1 3300050508 Bacteria 3536
564 nmdc:mga0qj67_27495_c1 3300050509 Bacteria 4410
565 nmdc:mga06r32_146002_c1 3300050510 Bacteria 2343
566 nmdc:mga06r32_701945_c1 3300050510 Bacteria 977
567 nmdc:mga08y16_144236_c1 3300050511 Bacteria 2475
568 nmdc:mga08y16_405114_c1 3300050511 Bacteria 1395
569 nmdc:mga08y16_486917_c1 3300050511 Bacteria 1255
570 nmdc:mga0n895_262297_c1 3300050512 Bacteria 1753
571 nmdc:mga0n895_62789_c1 3300050512 Bacteria 3673
572 nmdc:mga0n895_676866_c1 3300050512 Bacteria 1029
573 nmdc:mga0n895_7675_c1 3300050512 Bacteria 9277
574 nmdc:mga0n895_9840_c1 3300050512 Bacteria 8406
575 nmdc:mga0rr50_133739_c1 3300050513 Bacteria 1989
576 nmdc:mga0rr50_13420_c1 3300050513 Bacteria 5333
577 nmdc:mga0rr50_161675_c1 3300050513 Bacteria 1818
578 nmdc:mga0rr50_170179_c1 3300050513 Bacteria 1775
579 nmdc:mga0rr50_48807_c1 3300050513 Bacteria 3131
580 nmdc:mga0rr50_90658_c1 3300050513 Bacteria 2379
581 nmdc:mga08x19_125954_c1 3300050514 Bacteria 1720
582 nmdc:mga08x19_14065_c1 3300050514 Bacteria 4849
583 nmdc:mga08x19_21083_c1 3300050514 Bacteria 4019
584 nmdc:mga08x19_34998_c1 3300050514 Bacteria 3177
585 nmdc:mga0a205_150848_c1 3300050515 Bacteria 2224
586 nmdc:mga0a205_209214_c1 3300050515 Bacteria 1839
587 nmdc:mga0a205_31879_c1 3300050515 Bacteria 5052
588 nmdc:mga0a205_526098_c1 3300050515 Bacteria 1039
589 nmdc:mga0a205_618263_c1 3300050515 Bacteria 936
590 nmdc:mga0a205_6767_c1 3300050515 Bacteria 10367
591 nmdc:mga0a205_7102_c1 3300050515 Bacteria 10117
592 Ga0495595_0179768 3300053084 Bacteria 1049
593 Ga0495619_0085446 3300053085 Bacteria 2131
594 Ga0495619_0378066 3300053085 Bacteria 979
595 Ga0501084_0010484 3300054114 Bacteria 7660
596 Ga0501084_0137402 3300054114 Bacteria 2057
597 Ga0501082_0012954 3300060353 Bacteria 7168
598 Ga0501082_0030910 3300060353 Bacteria 4616
599 Ga0501082_0246719 3300060353 Bacteria 1554
600 Ga0530510_0016424 3300061734 Bacteria 5240
601 Ga0395900_0253938
602 Ga0070683_100002448
603 Ga0070683_100137254
604 Ga0070680_100527764
605 Ga0070682_100096275
606 Ga0068868_100111185
607 Ga0070660_100052317
608 Ga0070689_100031098
609 Ga0070691_10041882
610 Ga0070687_100263509
611 Ga0070692_10047294
612 Ga0070668_100252035
613 Ga0070671_100079242
614 Ga0070674_100036833
615 Ga0070674_100300261
616 Ga0070673_100158018
617 Ga0070673_100244313
618 Ga0070673_100527103
619 Ga0070688_100001134
620 Ga0070709_10136104
621 Ga0070709_10293697
622 Ga0070714_100040721
623 Ga0070714_100161003
624 Ga0070714_100988633
625 Ga0070713_100029387
626 Ga0070713_100195697
627 Ga0070713_100939973
628 Ga0070710_10021804
629 Ga0070710_10063229
630 Ga0070710_10380217
631 Ga0070701_10012731
632 Ga0070711_100056121
633 Ga0070711_100059772
634 Ga0070711_100165682
635 Ga0070705_100028791
636 Ga0070705_100131640
637 Ga0070705_101029581
638 Ga0070700_100054961
639 Ga0070700_100498924
640 Ga0070694_100036340
641 Ga0070694_100166738
642 Ga0070694_100656807
643 Ga0070708_100060745
644 Ga0070708_100090104
645 Ga0070708_100607799
646 Ga0070678_100052251
647 Ga0070662_100566380
648 Ga0070681_10563643
649 Ga0068867_100035456
650 Ga0070685_10015389
651 Ga0070706_100028202
652 Ga0070706_100082459
653 Ga0070706_100120508
654 Ga0070706_100123820
655 Ga0070706_100129347
656 Ga0070707_100008485
657 Ga0070707_100018817
658 Ga0070707_100043068
659 Ga0070698_100113498
660 Ga0070698_100183608
661 Ga0070698_100267837
662 Ga0070698_100409392
663 Ga0070699_100004055
664 Ga0070699_100068745
665 Ga0070699_100070086
666 Ga0070699_100238903
667 Ga0070699_100445726
668 Ga0070684_100009615
669 Ga0070684_100126956
670 Ga0070697_100239288
671 Ga0070697_100363801
672 Ga0070697_100386059
673 Ga0070697_100478993
674 Ga0068853_100097749
675 Ga0070672_100082126
676 Ga0070695_100136219
677 Ga0070695_100556830
678 Ga0070696_100035132
679 Ga0070696_100055831
680 Ga0070696_100144780
681 Ga0070696_100168238
682 Ga0070693_100156257
683 Ga0070704_100021401
684 Ga0070704_100044144
685 Ga0070704_100177476
686 Ga0070704_100374555
687 Ga0068855_100674158
688 Ga0070664_100007271
689 Ga0070664_100161160
690 Ga0068857_100022264
691 Ga0068856_100007450
692 Ga0068856_100222700
693 Ga0070702_100042008
694 Ga0070702_100336988
695 Ga0070702_100349381
696 Ga0068852_100298764
697 Ga0068861_100426258
698 Ga0068862_100296780
699 Ga0068862_101475792
700 Ga0081455_10033859
701 Ga0081455_10068298
702 Ga0081455_10434521
703 Ga0081538_10100629
704 Ga0081540_1026128
705 Ga0081539_10002800
706 Ga0070717_10033031
707 Ga0070717_10251692
708 Ga0075365_10019603
709 Ga0075363_100072166
710 Ga0070715_10009031
711 Ga0070715_10087657
712 Ga0070715_10232354
713 Ga0070716_100045782
714 Ga0070716_100696944
715 Ga0070712_100015156
716 Ga0070712_100035908
717 Ga0070712_100047057
718 Ga0070712_100067461
719 Ga0070712_100093166
720 Ga0070712_100282469
721 Ga0097621_100726400
722 Ga0068871_100099557
723 Ga0075428_100032860
724 Ga0075428_100401715
725 Ga0075428_100715878
726 Ga0075428_101232591
727 Ga0075430_100141022
728 Ga0075430_100474011
729 Ga0075431_100023555
730 Ga0075431_100089313
731 Ga0075431_100293273
732 Ga0075433_10001563
733 Ga0075433_10010945
734 Ga0075433_10070110
735 Ga0075433_10194377
736 Ga0075434_100023612
737 Ga0075434_100039430
738 Ga0075434_100048318
739 Ga0075434_100116762
740 Ga0075434_100291961
741 Ga0075429_100005393
742 Ga0068865_100050764
743 Ga0068865_100208831
744 Ga0075436_100014890
745 Ga0075436_100023075
746 Ga0075436_100029761
747 Ga0075436_100036815
748 Ga0075436_100146483
749 Ga0075435_100006788
750 Ga0075435_100044774
751 Ga0111539_10020230
752 Ga0111539_10033204
753 Ga0111539_10182953
754 Ga0111539_10254328
755 Ga0105245_10002969
756 Ga0105245_10021247
757 Ga0105245_10023440
758 Ga0105245_10114264
759 Ga0105245_10527400
760 Ga0105247_10125599
761 Ga0114129_10003097
762 Ga0114129_10006703
763 Ga0114129_10013111
764 Ga0114129_10030355
765 Ga0114129_10063631
766 Ga0114129_10079170
767 Ga0114129_10138619
768 Ga0114129_10229494
769 Ga0114129_10517596
770 Ga0105243_10014835
771 Ga0105243_10290528
772 Ga0105243_10317478
773 Ga0105241_10079111
774 Ga0105242_11548150
775 Ga0105248_10161945
776 Ga0105248_10598752
777 Ga0105238_10227857
778 Ga0105249_10069715
779 Ga0105249_10108948
780 Ga0105239_10001224
781 Ga0157369_10573323
782 Ga0157374_10002604
783 Ga0163162_10028569
784 Ga0157375_10011701
785 Ga0157375_10012783
786 Ga0157375_10263383
787 Ga0157375_10948393
788 Ga0157380_10013146
789 Ga0157377_10051582
790 Ga0157377_10283519
791 Ga0157379_10228948
792 Ga0157376_10030319
793 Ga0157376_10570486
794 Ga0157376_10671571
795 Ga0207653_10026741
796 Ga0207692_10084488
797 Ga0207710_10061733
798 Ga0207688_10101911
799 Ga0207688_10122067
800 Ga0207680_10082903
801 Ga0207685_10010745
802 Ga0207685_10021100
803 Ga0207685_10160847
804 Ga0207685_10354401
805 Ga0207699_10004795
806 Ga0207699_10212812
807 Ga0207643_10066657
808 Ga0207643_10127558
809 Ga0207684_10054520
810 Ga0207684_10078688
811 Ga0207684_10311045
812 Ga0207684_10355981
813 Ga0207684_10493842
814 Ga0207684_10811251
815 Ga0207693_10004094
816 Ga0207693_10004171
817 Ga0207693_10086802
818 Ga0207693_10126158
819 Ga0207663_10006216
820 Ga0207660_10475002
821 Ga0207662_10114638
822 Ga0207657_10074572
823 Ga0207646_10007910
824 Ga0207646_10031294
825 Ga0207646_10079659
826 Ga0207646_10238455
827 Ga0207646_10567102
828 Ga0207687_10023141
829 Ga0207687_10025640
830 Ga0207687_10073108
831 Ga0207687_10348247
832 Ga0207687_10475362
833 Ga0207700_10000001
834 Ga0207700_10102675
835 Ga0207664_10275387
836 Ga0207644_10040919
837 Ga0207706_10168975
838 Ga0207706_10431365
839 Ga0207706_10767639
840 Ga0207709_10193934
841 Ga0207670_10027924
842 Ga0207669_10047158
843 Ga0207669_10127093
844 Ga0207669_10841416
845 Ga0207704_10043408
846 Ga0207704_10263062
847 Ga0207665_10014230
848 Ga0207691_10007005
849 Ga0207711_10032021
850 Ga0207711_10154278
851 Ga0207661_10004885
852 Ga0207661_10016805
853 Ga0207667_10374717
854 Ga0207712_10108555
855 Ga0207668_10141848
856 Ga0207677_10040408
857 Ga0207677_10070003
858 Ga0207677_10757696
859 Ga0207639_10112408
860 Ga0207678_10344964
861 Ga0207708_10026418
862 Ga0207702_10040747
863 Ga0207702_10178862
864 Ga0207702_10524356
865 Ga0207641_10116423
866 Ga0207648_10033273
867 Ga0207648_10794817
868 Ga0207674_10001668
869 Ga0207674_10053097
870 Ga0207674_10084178
871 Ga0207675_100006676
872 Ga0207683_10013193
873 Ga0207698_10050131
874 Ga0207428_10021153
875 Ga0207428_10061240
876 Ga0268265_11053098
877 Ga0265334_10067458
878 Ga0265316_10605955
879 Ga0316576_10040551
880 Ga0307406_10098815
881 Ga0307412_10231203
882 Ga0307409_100203407
883 Ga0307416_100110882
884 Ga0307415_100090302
885 Ga0307415_100879729
886 Ga0373958_0003926
887 Ga0373929_0067580
888 Ga0373949_0003340
889 Ga0373941_0001929
890 Ga0373942_0004574
891 Ga0373961_0007173
892 Ga0373962_0003520
893 Ga0373931_0002701
894 Ga0373937_0148116
895 Ga0395899_0008359
896 Ga0395899_0013793
897 Ga0395899_0015204
898 Ga0395899_0057237
899 Ga0395899_0065808
900 Ga0395899_0066387
901 Ga0395899_0143519
902 Ga0395899_0195619
903 Ga0395900_0006998
904 Ga0395900_0008636
905 Ga0395900_0010995
906 Ga0395900_0020170
907 Ga0395900_0025066
908 Ga0395900_0028554
909 Ga0395900_0032257
910 Ga0395900_0047265
911 Ga0395900_0056158
912 Ga0395900_0064843
913 Ga0395900_0065243
914 Ga0395900_0071180
915 Ga0395900_0084313
916 Ga0395900_0088684
917 Ga0395900_0093486
918 Ga0395900_0095560
919 Ga0395900_0125244
920 Ga0395900_0130008
921 Ga0395900_0156106
922 Ga0395900_0166139
923 Ga0395900_0685392
924 Ga0395900_0795713
925 Ga0395900_1259545
926 Ga0395898_0009044
927 Ga0395898_0027223
928 Ga0395898_0035149
929 Ga0395898_0035391
930 Ga0395898_0036792
931 Ga0395898_0043216
932 Ga0395898_0061923
933 Ga0395898_0068134
934 Ga0395898_0075921
935 Ga0395898_0091691
936 Ga0395898_0093835
937 Ga0395898_0106778
938 Ga0395898_0121035
939 Ga0395898_0148492
940 Ga0395898_0201714
941 Ga0395898_0225957
942 Ga0395898_0253254
943 Ga0395898_0274918
944 Ga0395898_0299268
945 Ga0395898_0505362
946 Ga0395898_0919804
947 Ga0395905_0009887
948 Ga0395905_0016452
949 Ga0395905_0028406
950 Ga0395905_0046649
951 Ga0395905_0050598
952 Ga0395905_0068168
953 Ga0395905_0083578
954 Ga0395905_0084085
955 Ga0395905_0110499
956 Ga0395905_0140019
957 Ga0395905_0194278
958 Ga0395905_0210238
959 Ga0395905_0214335
960 Ga0395905_0222576
961 Ga0395905_0250284
962 Ga0395905_0253543
963 Ga0395905_0354945
964 Ga0395905_0461052
965 Ga0395905_1065294
966 Ga0395901_0002203
967 Ga0395901_0008484
968 Ga0395901_0010147
969 Ga0395901_0010320
970 Ga0395901_0016132
971 Ga0395901_0018190
972 Ga0395901_0026774
973 Ga0395901_0028587
974 Ga0395901_0029809
975 Ga0395901_0033446
976 Ga0395901_0037264
977 Ga0395901_0037984
978 Ga0395901_0041629
979 Ga0395901_0052126
980 Ga0395901_0058669
981 Ga0395901_0060326
982 Ga0395901_0062642
983 Ga0395901_0079217
984 Ga0395901_0080137
985 Ga0395901_0160237
986 Ga0395901_0186424
987 Ga0395901_0238728
988 Ga0395901_0245825
989 Ga0395901_0332244
990 Ga0395901_0349756
991 Ga0395901_0379420
992 Ga0395901_0447282
993 Ga0395901_0650795
994 Ga0395901_0793866
995 Ga0395901_0841588
996 Ga0451789_1224026
997 Ga0451793_0645183
998 Ga0451795_0481492
999 Ga0451802_0050302
1000 Ga0451807_0287879
1001 Ga0451833_0455699
1002 Ga0451835_0177913
1003 Ga0451839_1531166
1004 Ga0451845_0626299
1005 Ga0451847_0886257
1006 Ga0451855_0382208
1007 Ga0450923_018675
1008 Ga0439458_0041209
1009 Ga0451577_0142680
1010 Ga0466965_0106102
1011 Ga0466964_0003056
1012 Ga0466968_0037239
1013 Ga0466960_0037308
1014 Ga0451576_1065573
1015 Ga0466967_0004561
1016 Ga0466967_0050161
1017 Ga0495592_0147780
1018 Ga0495603_0076542
1019 Ga0495603_0098927
1020 Ga0495641_0219855
1021 Ga0495651_0155213
1022 Ga0495582_0098509
1023 Ga0495582_0128035
1024 Ga0495605_0203509
1025 Ga0495639_0281685
1026 Ga0495664_0079127
1027 Ga0495584_0180859
1028 Ga0495584_0388706
1029 Ga0495594_0503664
1030 Ga0495607_0168242
1031 Ga0495616_0081889
1032 Ga0495616_0105966
1033 Ga0495618_0069519
1034 Ga0495631_0180251
1035 Ga0495642_0064222
1036 Ga0495665_0075423
1037 Ga0495656_0171372
1038 Ga0495659_0063217
1039 Ga0495659_0215610
1040 Ga0495588_0043942
1041 Ga0495588_0305575
1042 Ga0495647_0008084
1043 Ga0495658_0533707
1044 Ga0495613_0371863
1045 Ga0495581_0024096
1046 Ga0495636_0170991
1047 Ga0495676_0095474
1048 Ga0495676_0617608
1049 Ga0495680_0132855
1050 Ga0495614_0048180
1051 Ga0496100_0041638
1052 Ga0496100_0127558
1053 Ga0496100_0475606
1054 Ga0496101_0187374
1055 Ga0496101_0197739
1056 Ga0496101_0435745
1057 Ga0496102_0001216
1058 Ga0496102_0098373
1059 Ga0496102_0284675
1060 Ga0496104_0021069
1061 Ga0496104_0241061
1062 Ga0496104_0325030
1063 Ga0496104_0607788
1064 Ga0496105_0004138
1065 Ga0496105_0054456
1066 Ga0496105_0086079
1067 Ga0496105_0126450
1068 Ga0496105_0296174
1069 Ga0496106_0059103
1070 Ga0496107_0044574
1071 Ga0496107_0047666
1072 Ga0496108_0010709
1073 Ga0496108_0054575
1074 Ga0496108_0184769
1075 Ga0496108_0187603
1076 Ga0496109_0000533
1077 Ga0496109_0004031
1078 Ga0496109_0083395
1079 Ga0496109_0136623
1080 Ga0496109_0185376
1081 Ga0496109_0225240
1082 Ga0496109_0426074
1083 Ga0496109_0627098
1084 Ga0496109_1050407
1085 Ga0496110_0003502
1086 Ga0496110_0020341
1087 Ga0496110_0139189
1088 Ga0496110_0197564
1089 Ga0496110_0333936
1090 Ga0496110_0396570
1091 Ga0496110_0468390
1092 Ga0496110_0483449
1093 Ga0496110_1019623
1094 Ga0496111_0039435
1095 Ga0496111_0065155
1096 Ga0496111_0131654
1097 Ga0496111_0184533
1098 Ga0496112_0001663
1099 Ga0496112_0007876
1100 Ga0496112_0087822
1101 Ga0496112_0089512
1102 Ga0496112_0291283
1103 Ga0496112_0349173
1104 Ga0496112_1094251
1105 Ga0496113_0017292
1106 Ga0496113_0051063
1107 Ga0496113_0077965
1108 Ga0496113_0133627
1109 Ga0496114_0074540
1110 Ga0496114_0211486
1111 Ga0496114_0767699
1112 Ga0496115_0014883
1113 Ga0496115_0061918
1114 Ga0496115_0197638
1115 Ga0501031_0003860
1116 Ga0501032_0004241
1117 Ga0501033_0018944
1118 Ga0501036_0337575
1119 Ga0501037_0016483
1120 Ga0501038_0058803
1121 Ga0501040_0015378
1122 Ga0501040_0178319
1123 Ga0501041_0026906
1124 Ga0501041_0084632
1125 Ga0501042_0008571
1126 Ga0501042_0051592
1127 Ga0501046_0011444
1128 Ga0501046_0161042
1129 Ga0501046_0569934
1130 Ga0501048_0001065
1131 Ga0501048_0079640
1132 Ga0501068_0024072
1133 Ga0501069_0006041
1134 Ga0501070_0002312
1135 Ga0501071_0746223
1136 Ga0501072_0007268
1137 Ga0501072_0245362
1138 Ga0501073_0269645
1139 Ga0501074_0081500
1140 Ga0501075_0001970
1141 Ga0501075_0063025
1142 Ga0501076_0004573
1143 Ga0501076_0279096
1144 Ga0501079_0023435
1145 Ga0501079_0393702
1146 Ga0501080_0042363
1147 Ga0501080_0566179
1148 Ga0501081_0114947
1149 Ga0501081_0175770
1150 Ga0501083_0011445
1151 Ga0501035_0055677
1152 Ga0501044_0014676
1153 Ga0501045_0251202
1154 nmdc:mga03n38_68385_c1
1155 nmdc:mga0yw44_184067_c1
1156 nmdc:mga05p37_121751_c1
1157 nmdc:mga05p37_273671_c1
1158 nmdc:mga05p37_281927_c1
1159 nmdc:mga05p37_2932_c1
1160 nmdc:mga05p37_330459_c1
1161 nmdc:mga05p37_39286_c1
1162 nmdc:mga05p37_5738_c1
1163 nmdc:mga09592_49700_c1
1164 nmdc:mga0qj67_27495_c1
1165 nmdc:mga06r32_146002_c1
1166 nmdc:mga06r32_701945_c1
1167 nmdc:mga08y16_144236_c1
1168 nmdc:mga08y16_405114_c1
1169 nmdc:mga08y16_486917_c1
1170 nmdc:mga0n895_262297_c1
1171 nmdc:mga0n895_62789_c1
1172 nmdc:mga0n895_676866_c1
1173 nmdc:mga0n895_7675_c1
1174 nmdc:mga0n895_9840_c1
1175 nmdc:mga0rr50_133739_c1
1176 nmdc:mga0rr50_13420_c1
1177 nmdc:mga0rr50_161675_c1
1178 nmdc:mga0rr50_170179_c1
1179 nmdc:mga0rr50_48807_c1
1180 nmdc:mga0rr50_90658_c1
1181 nmdc:mga08x19_125954_c1
1182 nmdc:mga08x19_14065_c1
1183 nmdc:mga08x19_21083_c1
1184 nmdc:mga08x19_34998_c1
1185 nmdc:mga0a205_150848_c1
1186 nmdc:mga0a205_209214_c1
1187 nmdc:mga0a205_31879_c1
1188 nmdc:mga0a205_526098_c1
1189 nmdc:mga0a205_618263_c1
1190 nmdc:mga0a205_6767_c1
1191 nmdc:mga0a205_7102_c1
1192 Ga0495595_0179768
1193 Ga0495619_0085446
1194 Ga0495619_0378066
1195 Ga0501084_0010484
1196 Ga0501084_0137402
1197 Ga0501082_0012954
1198 Ga0501082_0030910
1199 Ga0501082_0246719
1200 Ga0530510_0016424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

37

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9229 53 191
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9133 48 191
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.8892 40 192
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8804 39 192
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8802 46 194
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9149 48 191 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8825 52 183 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8802 46 194 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8763 41 191 3.90.420.10
4pw9A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.86 53 189 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A2V6CY43-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9752 67 183
AF-A0A537JBF4-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9687 26 193
AF-A0A2E5V0L6-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9656 48 152
AF-A0A2V6CAY3-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9622 26 181
AF-E1JZF8-F1-model_v4 Oxidoreductase molybdopterin binding 0.9619 53 191 GO:0051536

Map