metagRoot

F467953

General Info

Members	Datasets	Scaffolds	Average Seq Length
600	279	575	310

Family's Representative Sequence

Representative Sequence	3300005458\|Ga0070681_10032989\|Ga0070681_100329893
Length	342
Sequence	MATPLTSSPTASFATPLPTGTPLTLRTAATALGISALYLLLAKWLVGFKSDQLFLAGLFNVLFFLSGPTRRFILGFSVFIIFWIIFDFMKAFPNYHYNTVHIGDIYRTEKRLFGMPLILDGSVVPGVRSTPNEYWLIHHTTFLDIASGLFYLCWIPLPLVFAGYLFYKNKEAFFRFALTFLTVNLLGFVIYYAYPAAPPWYIQQYGTLFNPHTPGNTAGLARFDNYFHVSVFSSLYAKSSNVFAAMPSLHASYPLTVLYYGIKTRMRWANVLFATIMAGIWFAAVYSSHHYVLDVLAGITCGITGIILFNLLYRNIGWFTRFVQNCIRKISAPGSPTAAEAS

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	2599185184	Mucilaginibacter sp. NFR10	Isolate	Rhizoplane
3	2738541278	Niastella sp. CF465	Isolate	Unclassified
4	2738541283	Pedobacter sp. OK701	Isolate	Unclassified
5	2738541302	Pedobacter sp. CF074	Isolate	Unclassified
6	2739367651	Pedobacter sp. OK291	Isolate	Unclassified
7	2818991437	Pedobacter terrae 518	Isolate	Unclassified
8	2818991442	Chitinophaga pinensis 1204	Isolate	Unclassified
9	2842722452	Pedobacter sp. R-72249	Isolate	Unclassified
10	2842909656	Pedobacter sp. R-72393	Isolate	Unclassified
11	2849281842	Pedobacter sp. AK013	Isolate	Rhizosphere
12	2852623160	Mucilaginibacter sp. AK015	Isolate	Rhizosphere
13	2857627736	Pedobacter sp. R-74587	Isolate	Unclassified
14	2884933994	Mucilaginibacter sp. 14171R-50	Isolate	Rhizosphere
15	2902048731	Pedobacter ureilyticus THG-T11	Isolate	Rhizosphere
16	2914759650	Rhizosphaericola mali	Isolate	Rhizosphere
17	2919437846	Mucilaginibacter pocheonensis 3262	Isolate	Rhizosphere
18	2928078545	Mucilaginibacter rubeus 1215	Isolate	Unclassified
19	2928147474	Mucilaginibacter rubeus 2025	Isolate	Unclassified
20	2929239360	Chitinophaga sp. R-73072 Hybrid assembly	Isolate	Unclassified
21	2929921140	Chitinophaga sp. R-72609 Hybrid assembly	Isolate	Unclassified
22	2932082852	Mucilaginibacter sp. 3215	Isolate	Rhizosphere
23	2945997725	Pedobacter sp. W3I1	Isolate	Rhizosphere
24	2954016120	Flavobacterium sp. W4I14	Isolate	Rhizosphere
25	2977232053	Mucilaginibacter terrae SORGH_AS 422	Isolate	Unclassified
26	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
27	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
28	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
29	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
30	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
31	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
32	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
33	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
34	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
35	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
36	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
37	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
38	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
39	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
40	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
41	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
42	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
43	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
44	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
45	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
46	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
47	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
48	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
49	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
50	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
51	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
52	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
53	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
54	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
55	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
56	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
57	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
58	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
59	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
60	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
61	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
62	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
63	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
64	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
65	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
66	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
67	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
68	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
69	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
70	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
71	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
72	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
73	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
74	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
75	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
76	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
77	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
78	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
79	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
80	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
81	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
82	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
83	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
84	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
85	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
86	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
87	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
88	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
89	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
90	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
91	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
92	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
93	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
94	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
95	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
96	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
98	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
99	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
100	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
101	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
102	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
103	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
104	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
105	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
106	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
107	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
108	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
109	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
110	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
111	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
112	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
113	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
114	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
115	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
116	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
117	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
118	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
119	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
120	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
121	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
122	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
123	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
124	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
125	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
126	3300015682	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01	Metagenome	Rhizosphere
127	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
128	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
129	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
135	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
136	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
137	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
139	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
141	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
144	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
190	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
191	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
192	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
193	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
194	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
195	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
196	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
197	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
198	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
199	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
200	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
201	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
202	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
203	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
204	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
205	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
206	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
207	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
208	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
209	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
210	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
211	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
212	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
213	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
214	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
215	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
216	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
217	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
218	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
219	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
220	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
221	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
222	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
223	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
224	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
225	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
226	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
227	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
228	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
229	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
230	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
231	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
232	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
233	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
234	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
235	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
236	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
237	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
238	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
239	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
240	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
241	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
242	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
243	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
244	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
245	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
246	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
247	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
248	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
249	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
250	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
251	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
252	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
253	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
255	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
256	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
257	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
258	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
261	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
262	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
263	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
264	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
265	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
266	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
267	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
268	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
269	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
270	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
271	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
272	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
273	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
274	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
275	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
276	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
277	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
278	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
279	8003151029	Chitinophaga sp. GbtcB8	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	95.67
Metatranscriptomes	0.17
Isolates	4.17

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14
Nodule	0
Rhizoplane	0.33
Rhizosphere	73.83
Stem	0
Stem Tuber	0
Unclassified	11.83

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_13895874	2162886012	Bacteria	3096
2	JGI24736J21556_1001293	3300001904	Bacteria	4583
3	JGI24736J21556_1002894	3300001904	Bacteria	3008
4	JGI24740J21852_10002008	3300001979	Bacteria	9298
5	JGI24739J22299_10000110	3300001989	Bacteria	25280
6	JGI24739J22299_10022980	3300001989	Bacteria	2208
7	JGI24737J22298_10000110	3300001990	Bacteria	24863
8	JGI24737J22298_10002285	3300001990	Bacteria	6817
9	JGI24735J21928_10000004	3300002067	Bacteria	381713
10	JGI24735J21928_10022873	3300002067	Bacteria	1899
11	JGI24744J21845_10006353	3300002077	Bacteria	2453
12	JGI25162J39368_1000017	3300002737	Bacteria	281385
13	JGI25154J39366_1000001	3300002738	Bacteria	483450
14	JGI25164J39214_1001206	3300002772	Bacteria	7002
15	JGI25152J39213_1000067	3300002773	Bacteria	68480
16	JGI25150J39212_1000001	3300002774	Bacteria	1318726
17	JGI25151J46595_10000005	3300003187	Bacteria	431598
18	JGI25153J46596_10000040	3300003215	Bacteria	165523
19	JGI25153J46596_10000345	3300003215	Bacteria	32628
20	JGI25153J46596_10013174	3300003215	Bacteria	3514
21	rootH1_10018005	3300003316	Bacteria	14041
22	rootH1_10055266	3300003316	Bacteria	4768
23	rootH1_10117900	3300003316	Unclassified	2326
24	rootH1_10189993	3300003316	Bacteria	1531
25	rootH2_10001334	3300003320	Bacteria	238709
26	rootH2_10005500	3300003320	Bacteria	68238
27	rootH2_10005898	3300003320	Bacteria	79627
28	rootH2_10016713	3300003320	Bacteria	1519
29	rootH2_10021637	3300003320	Bacteria	2377
30	rootH2_10026212	3300003320	Bacteria	5754
31	rootH2_10028071	3300003320	Bacteria	16976
32	rootH2_10029493	3300003320	Bacteria	12960
33	rootH2_10047367	3300003320	Bacteria	14620
34	rootH2_10066215	3300003320	Bacteria	7789
35	rootH2_10201796	3300003320	Bacteria	3203
36	rootL2_10003986	3300003322	Bacteria	3765
37	rootL2_10032193	3300003322	Bacteria	9922
38	rootL2_10113060	3300003322	Bacteria	4785
39	rootL2_10122172	3300003322	Bacteria	2642
40	rootL2_10186347	3300003322	Bacteria	4002
41	rootH1_10006319	3300003323	Bacteria	30955
42	rootH1_10045032	3300003323	Bacteria	3628
43	rootH1_10107399	3300003323	Bacteria	3464
44	rootH1_10153916	3300003323	Bacteria	4244
45	rootH1_10179715	3300003323	Bacteria	8733
46	rootH1_10211473	3300003323	Bacteria	4093
47	rootH1_10269415	3300003323	Bacteria	2809
48	rootH1_10277795	3300003323	Bacteria	2101
49	JGI25160J50197_1000551	3300003354	Bacteria	21249
50	JGI25160J50197_1002302	3300003354	Bacteria	8955
51	Ga0055535_1001637	3300003761	Bacteria	10475
52	Ga0055542_1013891	3300003762	Bacteria	1340
53	Ga0055526_1021090	3300003771	Bacteria	2282
54	Ga0055536_1000049	3300003781	Bacteria	113328
55	Ga0055528_1002314	3300003790	Bacteria	10320
56	Ga0055530_10000813	3300003791	Bacteria	25917
57	Ga0055530_10001497	3300003791	Bacteria	16966
58	Ga0055531_10000041	3300003794	Bacteria	135600
59	Ga0055531_10024001	3300003794	Bacteria	2266
60	Ga0058862_11871750	3300004803	Bacteria	1761
61	Ga0065165_1000053	3300005262	Bacteria	189081
62	Ga0065165_1001192	3300005262	Bacteria	30053
63	Ga0065165_1009097	3300005262	Bacteria	4513
64	Ga0065714_10010704	3300005288	Bacteria	2342
65	Ga0065714_10064880	3300005288	Bacteria	16161
66	Ga0065714_10082910	3300005288	Bacteria	2279
67	Ga0065714_10139877	3300005288	Bacteria	1180
68	Ga0065715_10091091	3300005293	Bacteria	6129
69	Ga0070658_10000019	3300005327	Bacteria	194742
70	Ga0070676_10000038	3300005328	Bacteria	39143
71	Ga0070683_100001459	3300005329	Bacteria	18185
72	Ga0070690_100053271	3300005330	Unclassified	2588
73	Ga0068869_100001765	3300005334	Bacteria	12943
74	Ga0070666_10000052	3300005335	Bacteria	99095
75	Ga0070666_10286097	3300005335	Unclassified	1172
76	Ga0070680_100167102	3300005336	Bacteria	1850
77	Ga0068868_100004678	3300005338	Bacteria	9613
78	Ga0070660_100004589	3300005339	Bacteria	9547
79	Ga0070660_100006923	3300005339	Bacteria	7863
80	Ga0070669_100065858	3300005353	Bacteria	2669
81	Ga0070675_100235029	3300005354	Unclassified	1600
82	Ga0070671_100032790	3300005355	Bacteria	4293
83	Ga0070671_100083648	3300005355	Bacteria	2668
84	Ga0070673_100086596	3300005364	Bacteria	2553
85	Ga0070673_100103987	3300005364	Bacteria	2344
86	Ga0070688_100116871	3300005365	Bacteria	1781
87	Ga0070659_100003605	3300005366	Bacteria	11020
88	Ga0070667_100003048	3300005367	Bacteria	14398
89	Ga0070667_100003555	3300005367	Bacteria	13278
90	Ga0070667_100194203	3300005367	Bacteria	1799
91	Ga0070667_100289197	3300005367	Unclassified	1473
92	Ga0070663_100002072	3300005455	Bacteria	11195
93	Ga0070678_100001488	3300005456	Bacteria	12517
94	Ga0070662_100000464	3300005457	Bacteria	24077
95	Ga0070681_10032316	3300005458	Bacteria	5251
96	Ga0070681_10032989	3300005458	Bacteria	5198
97	Ga0068867_100000255	3300005459	Bacteria	35036
98	Ga0070685_10024572	3300005466	Bacteria	3310
99	Ga0070679_100038210	3300005530	Bacteria	4772
100	Ga0070679_100097816	3300005530	Bacteria	2922
101	Ga0070684_100037941	3300005535	Bacteria	4136
102	Ga0068853_100009008	3300005539	Bacteria	8037
103	Ga0068853_100023249	3300005539	Bacteria	5186
104	Ga0068853_100025234	3300005539	Bacteria	4987
105	Ga0068853_100038656	3300005539	Bacteria	4065
106	Ga0070672_100081196	3300005543	Bacteria	2599
107	Ga0070672_100108708	3300005543	Unclassified	2258
108	Ga0070665_100000003	3300005548	Bacteria	811857
109	Ga0070665_100000074	3300005548	Bacteria	192944
110	Ga0068855_100000073	3300005563	Bacteria	121126
111	Ga0068855_100000086	3300005563	Bacteria	111462
112	Ga0068855_100000370	3300005563	Bacteria	55660
113	Ga0068855_100005249	3300005563	Bacteria	15806
114	Ga0068855_100005699	3300005563	Bacteria	15214
115	Ga0068855_100035862	3300005563	Bacteria	5906
116	Ga0068855_100087490	3300005563	Bacteria	3601
117	Ga0068855_100089752	3300005563	Bacteria	3548
118	Ga0068855_100203628	3300005563	Bacteria	2227
119	Ga0068855_100469362	3300005563	Bacteria	1371
120	Ga0068857_100003719	3300005577	Bacteria	12802
121	Ga0068857_100044431	3300005577	Bacteria	3941
122	Ga0068854_100090879	3300005578	Unclassified	2271
123	Ga0068854_100149227	3300005578	Bacteria	1801
124	Ga0068856_100001137	3300005614	Bacteria	27953
125	Ga0068856_100018866	3300005614	Bacteria	6688
126	Ga0068856_100033900	3300005614	Bacteria	5000
127	Ga0068856_100066617	3300005614	Bacteria	3558
128	Ga0068856_100070528	3300005614	Bacteria	3457
129	Ga0068856_100073790	3300005614	Bacteria	3378
130	Ga0068856_100239456	3300005614	Bacteria	1830
131	Ga0068856_100405295	3300005614	Bacteria	1383
132	Ga0068856_100450835	3300005614	Unclassified	1307
133	Ga0068856_100758693	3300005614	Bacteria	990
134	Ga0068852_100000937	3300005616	Bacteria	19263
135	Ga0068852_100001089	3300005616	Bacteria	17919
136	Ga0068852_100003824	3300005616	Bacteria	10574
137	Ga0068852_100197935	3300005616	Bacteria	1900
138	Ga0068852_100404812	3300005616	Unclassified	1343
139	Ga0068859_100000227	3300005617	Bacteria	55148
140	Ga0068859_100007421	3300005617	Bacteria	11131
141	Ga0068864_100015397	3300005618	Bacteria	6359
142	Ga0068866_10082142	3300005718	Bacteria	1733
143	Ga0068851_10027900	3300005834	Bacteria	2786
144	Ga0068851_10145646	3300005834	Bacteria	1291
145	Ga0068863_100012190	3300005841	Bacteria	8302
146	Ga0068863_100018813	3300005841	Bacteria	6609
147	Ga0068863_100060936	3300005841	Bacteria	3568
148	Ga0068858_100003299	3300005842	Bacteria	16064
149	Ga0068860_100000110	3300005843	Bacteria	131175
150	Ga0068860_100000702	3300005843	Bacteria	38399
151	Ga0068860_100016624	3300005843	Bacteria	7176
152	Ga0068860_100259054	3300005843	Bacteria	1695
153	Ga0081540_1038958	3300005983	Unclassified	2497
154	Ga0075366_10000577	3300006195	Bacteria	17211
155	Ga0075366_10002020	3300006195	Bacteria	10299
156	Ga0075366_10002035	3300006195	Bacteria	10260
157	Ga0075366_10022885	3300006195	Bacteria	3638
158	Ga0097621_100000241	3300006237	Bacteria	36577
159	Ga0097621_100030795	3300006237	Bacteria	4252
160	Ga0097621_100033955	3300006237	Bacteria	4066
161	Ga0068871_100000499	3300006358	Bacteria	26769
162	Ga0068871_100002508	3300006358	Bacteria	12525
163	Ga0068871_100065357	3300006358	Bacteria	2979
164	Ga0068865_100000022	3300006881	Bacteria	102976
165	Ga0097620_100000227	3300006931	Bacteria	55148
166	Ga0097620_100007421	3300006931	Bacteria	11131
167	Ga0105240_10000010	3300009093	Bacteria	537830
168	Ga0105240_10000253	3300009093	Bacteria	106101
169	Ga0105240_10000358	3300009093	Bacteria	85909
170	Ga0105240_10000418	3300009093	Bacteria	78645
171	Ga0105240_10000448	3300009093	Bacteria	75837
172	Ga0105240_10012660	3300009093	Bacteria	11631
173	Ga0105240_10018980	3300009093	Bacteria	9208
174	Ga0105240_10025336	3300009093	Bacteria	7797
175	Ga0105240_10081514	3300009093	Bacteria	3976
176	Ga0105240_10093485	3300009093	Bacteria	3670
177	Ga0105240_10128146	3300009093	Bacteria	3047
178	Ga0105240_10137659	3300009093	Bacteria	2922
179	Ga0105240_10711916	3300009093	Bacteria	1095
180	Ga0105243_10040383	3300009148	Bacteria	3644
181	Ga0105241_10001498	3300009174	Bacteria	17918
182	Ga0105241_10002955	3300009174	Bacteria	12694
183	Ga0105241_10003853	3300009174	Bacteria	11119
184	Ga0105241_10005285	3300009174	Bacteria	9536
185	Ga0105241_10014101	3300009174	Bacteria	5856
186	Ga0105242_10055385	3300009176	Bacteria	3244
187	Ga0105237_10000065	3300009545	Bacteria	139423
188	Ga0105237_10000137	3300009545	Bacteria	102639
189	Ga0105237_10001288	3300009545	Bacteria	33371
190	Ga0105237_10001545	3300009545	Bacteria	30045
191	Ga0105237_10007138	3300009545	Bacteria	12276
192	Ga0105237_10009321	3300009545	Bacteria	10515
193	Ga0105237_10015255	3300009545	Bacteria	8004
194	Ga0105237_10034397	3300009545	Bacteria	5131
195	Ga0105237_10040020	3300009545	Bacteria	4730
196	Ga0105237_10050397	3300009545	Bacteria	4183
197	Ga0105238_10003185	3300009551	Bacteria	16373
198	Ga0105238_10019950	3300009551	Bacteria	6824
199	Ga0105238_10042619	3300009551	Bacteria	4595
200	Ga0105238_10097954	3300009551	Bacteria	2917
201	Ga0105238_10129459	3300009551	Bacteria	2502
202	Ga0105238_10351142	3300009551	Bacteria	1464
203	Ga0105249_10001331	3300009553	Bacteria	21632
204	Ga0105249_10191020	3300009553	Bacteria	1999
205	Ga0105239_10000005	3300010375	Bacteria	496066
206	Ga0105239_10000079	3300010375	Bacteria	135513
207	Ga0105239_10000761	3300010375	Bacteria	45527
208	Ga0105239_10006813	3300010375	Bacteria	13177
209	Ga0105239_10007964	3300010375	Bacteria	12104
210	Ga0105239_10008530	3300010375	Bacteria	11646
211	Ga0105239_10023359	3300010375	Bacteria	6809
212	Ga0105239_10024600	3300010375	Bacteria	6634
213	Ga0105239_10046424	3300010375	Bacteria	4760
214	Ga0105239_10092076	3300010375	Bacteria	3346
215	Ga0105239_10112544	3300010375	Bacteria	3018
216	Ga0105239_10195883	3300010375	Unclassified	2263
217	Ga0105239_10662191	3300010375	Unclassified	1193
218	Ga0105246_10005012	3300011119	Bacteria	8052
219	Ga0105246_10046950	3300011119	Bacteria	2947
220	Ga0157373_10001506	3300013100	Bacteria	17761
221	Ga0157373_10023325	3300013100	Bacteria	4487
222	Ga0157371_10000051	3300013102	Bacteria	180272
223	Ga0157371_10000622	3300013102	Bacteria	42231
224	Ga0157371_10001433	3300013102	Bacteria	24766
225	Ga0157371_10015641	3300013102	Bacteria	5683
226	Ga0157371_10019972	3300013102	Bacteria	4934
227	Ga0157371_10028783	3300013102	Bacteria	4021
228	Ga0157371_10037577	3300013102	Bacteria	3464
229	Ga0157370_10000640	3300013104	Bacteria	43586
230	Ga0157370_10000695	3300013104	Bacteria	42043
231	Ga0157370_10004105	3300013104	Bacteria	16885
232	Ga0157370_10011378	3300013104	Bacteria	9314
233	Ga0157370_10026041	3300013104	Bacteria	5780
234	Ga0157370_10054307	3300013104	Bacteria	3818
235	Ga0157370_10116178	3300013104	Bacteria	2499
236	Ga0157370_10121527	3300013104	Bacteria	2438
237	Ga0157370_10133433	3300013104	Bacteria	2316
238	Ga0157370_10293118	3300013104	Bacteria	1503
239	Ga0157369_10000033	3300013105	Bacteria	201124
240	Ga0157369_10000165	3300013105	Bacteria	93924
241	Ga0157369_10010756	3300013105	Bacteria	10416
242	Ga0157369_10389263	3300013105	Bacteria	1447
243	Ga0157369_10477502	3300013105	Bacteria	1290
244	Ga0157374_10000003	3300013296	Bacteria	854471
245	Ga0157374_10000130	3300013296	Bacteria	68718
246	Ga0157374_10001204	3300013296	Bacteria	22127
247	Ga0157374_10018303	3300013296	Bacteria	6181
248	Ga0157374_10151104	3300013296	Bacteria	2258
249	Ga0157374_10279880	3300013296	Bacteria	1647
250	Ga0157374_10313138	3300013296	Bacteria	1554
251	Ga0157378_10030294	3300013297	Bacteria	4782
252	Ga0157378_10076773	3300013297	Bacteria	3011
253	Ga0157378_10146013	3300013297	Unclassified	2200
254	Ga0157378_10423368	3300013297	Unclassified	1316
255	Ga0163162_10000064	3300013306	Bacteria	103542
256	Ga0163162_10000453	3300013306	Bacteria	37951
257	Ga0163162_10001089	3300013306	Bacteria	25177
258	Ga0163162_10001699	3300013306	Bacteria	20655
259	Ga0163162_10005622	3300013306	Bacteria	12113
260	Ga0163162_10038047	3300013306	Bacteria	4802
261	Ga0163162_10093923	3300013306	Bacteria	3085
262	Ga0163162_10226448	3300013306	Unclassified	1999
263	Ga0157372_10000021	3300013307	Bacteria	207801
264	Ga0157372_10000813	3300013307	Bacteria	33849
265	Ga0157372_10001155	3300013307	Bacteria	28553
266	Ga0157372_10001418	3300013307	Bacteria	25849
267	Ga0157372_10011107	3300013307	Bacteria	9578
268	Ga0157372_10061621	3300013307	Bacteria	4201
269	Ga0157372_10104354	3300013307	Bacteria	3240
270	Ga0157375_10119766	3300013308	Bacteria	2740
271	Ga0157375_10172201	3300013308	Bacteria	2313
272	Ga0163163_10038203	3300014325	Bacteria	4677
273	Ga0163163_10210196	3300014325	Bacteria	1995
274	Ga0182008_10000275	3300014497	Bacteria	40323
275	Ga0182008_10005048	3300014497	Bacteria	7582
276	Ga0182008_10024577	3300014497	Bacteria	3066
277	Ga0157377_10059461	3300014745	Bacteria	2178
278	Ga0157379_10056041	3300014968	Bacteria	3523
279	Ga0157379_10276115	3300014968	Unclassified	1529
280	Ga0157376_10008737	3300014969	Bacteria	7323
281	Ga0157376_10071027	3300014969	Bacteria	2957
282	Ga0182006_1000160	3300015261	Bacteria	71698
283	Ga0182006_1000168	3300015261	Bacteria	69340
284	Ga0182006_1001242	3300015261	Bacteria	15807
285	Ga0182007_10000015	3300015262	Bacteria	207893
286	Ga0182007_10002140	3300015262	Bacteria	10073
287	Ga0182007_10016362	3300015262	Bacteria	2738
288	Ga0182007_10022516	3300015262	Bacteria	2224
289	Ga0182005_1000206	3300015265	Bacteria	39651
290	Ga0183373_1005	3300015682	Bacteria	351562
291	Ga0163161_10000178	3300017792	Bacteria	58130
292	Ga0163161_10000215	3300017792	Bacteria	52730
293	Ga0163161_10002011	3300017792	Bacteria	14710
294	Ga0163161_10013631	3300017792	Bacteria	5660
295	Ga0163161_10017175	3300017792	Bacteria	5060
296	Ga0163161_10026751	3300017792	Bacteria	4088
297	Ga0213876_10011576	3300021384	Bacteria	4708
298	Ga0209436_103080	3300025208	Bacteria	4593
299	Ga0209563_103327	3300025230	Bacteria	3355
300	Ga0207427_100208	3300025231	Bacteria	53345
301	Ga0209437_100024	3300025233	Bacteria	592878
302	Ga0209437_100052	3300025233	Bacteria	380548
303	Ga0209258_100145	3300025242	Bacteria	163672
304	Ga0209258_108502	3300025242	Bacteria	1436
305	Ga0207425_1000002	3300025245	Bacteria	1362590
306	Ga0209646_1000002	3300025246	Bacteria	1425781
307	Ga0209026_1000229	3300025250	Bacteria	76521
308	Ga0209026_1001960	3300025250	Bacteria	8277
309	Ga0209026_1004883	3300025250	Bacteria	3798
310	Ga0209148_1000177	3300025254	Bacteria	127365
311	Ga0209129_1000002	3300025258	Bacteria	1359086
312	Ga0209129_1008282	3300025258	Bacteria	2920
313	Ga0209233_1000067	3300025261	Bacteria	380554
314	Ga0209233_1007883	3300025261	Bacteria	3338
315	Ga0209673_1000034	3300025273	Bacteria	328788
316	Ga0209676_1000001	3300025292	Bacteria	1852142
317	Ga0209025_1000004	3300025294	Bacteria	1361782
318	Ga0209564_1002599	3300025295	Bacteria	13842
319	Ga0209758_1000006	3300025297	Bacteria	1359562
320	Ga0209758_1005816	3300025297	Bacteria	9238
321	Ga0209758_1015876	3300025297	Bacteria	3867
322	Ga0209050_1000258	3300025298	Bacteria	113741
323	Ga0209050_1000353	3300025298	Bacteria	88509
324	Ga0209050_1006252	3300025298	Bacteria	7133
325	Ga0209050_1011212	3300025298	Bacteria	4289
326	Ga0207426_1000002	3300025302	Bacteria	1249660
327	Ga0207426_1000324	3300025302	Bacteria	91661
328	Ga0207426_1000558	3300025302	Bacteria	51284
329	Ga0207426_1008155	3300025302	Unclassified	4272
330	Ga0209257_1000001	3300025304	Bacteria	2274655
331	Ga0209257_1000974	3300025304	Bacteria	39098
332	Ga0207656_10023948	3300025321	Bacteria	2464
333	Ga0207656_10102271	3300025321	Bacteria	1315
334	Ga0207680_10000035	3300025903	Bacteria	73889
335	Ga0207680_10115644	3300025903	Unclassified	1747
336	Ga0207647_10000093	3300025904	Bacteria	68094
337	Ga0207647_10000494	3300025904	Bacteria	31578
338	Ga0207647_10008244	3300025904	Bacteria	7487
339	Ga0207647_10110261	3300025904	Bacteria	1627
340	Ga0207645_10005282	3300025907	Bacteria	9404
341	Ga0207705_10000069	3300025909	Bacteria	133094
342	Ga0207654_10003070	3300025911	Bacteria	8458
343	Ga0207654_10009083	3300025911	Bacteria	5041
344	Ga0207707_10011067	3300025912	Bacteria	7846
345	Ga0207707_10110400	3300025912	Bacteria	2404
346	Ga0207695_10000019	3300025913	Bacteria	732137
347	Ga0207695_10000021	3300025913	Bacteria	679399
348	Ga0207695_10000039	3300025913	Bacteria	454801
349	Ga0207695_10000073	3300025913	Bacteria	312565
350	Ga0207695_10000990	3300025913	Bacteria	50315
351	Ga0207695_10001318	3300025913	Bacteria	42076
352	Ga0207695_10002972	3300025913	Bacteria	24457
353	Ga0207695_10008050	3300025913	Bacteria	13271
354	Ga0207695_10022888	3300025913	Bacteria	7077
355	Ga0207695_10054334	3300025913	Bacteria	4183
356	Ga0207695_10100699	3300025913	Bacteria	2884
357	Ga0207695_10159703	3300025913	Unclassified	2186
358	Ga0207695_10166846	3300025913	Bacteria	2129
359	Ga0207671_10000424	3300025914	Bacteria	58429
360	Ga0207671_10000502	3300025914	Bacteria	53150
361	Ga0207671_10000657	3300025914	Bacteria	45082
362	Ga0207671_10003844	3300025914	Bacteria	14692
363	Ga0207671_10004413	3300025914	Bacteria	13479
364	Ga0207671_10004886	3300025914	Bacteria	12600
365	Ga0207671_10008639	3300025914	Bacteria	8605
366	Ga0207671_10009440	3300025914	Bacteria	8155
367	Ga0207671_10012517	3300025914	Bacteria	6814
368	Ga0207671_10042844	3300025914	Unclassified	3349
369	Ga0207660_10060213	3300025917	Bacteria	2728
370	Ga0207657_10005438	3300025919	Bacteria	13306
371	Ga0207657_10012800	3300025919	Bacteria	8257
372	Ga0207652_10395727	3300025921	Bacteria	1247
373	Ga0207694_10002351	3300025924	Bacteria	15472
374	Ga0207694_10006989	3300025924	Bacteria	8566
375	Ga0207694_10070151	3300025924	Bacteria	2738
376	Ga0207650_10008042	3300025925	Bacteria	7185
377	Ga0207644_10007945	3300025931	Bacteria	6938
378	Ga0207644_10010421	3300025931	Bacteria	6125
379	Ga0207690_10013862	3300025932	Bacteria	4856
380	Ga0207706_10000243	3300025933	Bacteria	59842
381	Ga0207709_10054519	3300025935	Bacteria	2465
382	Ga0207704_10000011	3300025938	Bacteria	180140
383	Ga0207704_10074942	3300025938	Bacteria	2162
384	Ga0207691_10200901	3300025940	Bacteria	1735
385	Ga0207689_10001620	3300025942	Bacteria	21317
386	Ga0207661_10020179	3300025944	Bacteria	4976
387	Ga0207667_10000009	3300025949	Bacteria	603135
388	Ga0207667_10000229	3300025949	Bacteria	78821
389	Ga0207667_10000863	3300025949	Bacteria	39055
390	Ga0207667_10001845	3300025949	Bacteria	26612
391	Ga0207667_10009882	3300025949	Bacteria	11196
392	Ga0207667_10044088	3300025949	Bacteria	4729
393	Ga0207667_10171593	3300025949	Bacteria	2229
394	Ga0207667_10353002	3300025949	Bacteria	1499
395	Ga0207667_10407598	3300025949	Bacteria	1384
396	Ga0207651_10046268	3300025960	Bacteria	2924
397	Ga0207651_10079630	3300025960	Bacteria	2354
398	Ga0207712_10080903	3300025961	Unclassified	2364
399	Ga0207668_10372900	3300025972	Bacteria	1199
400	Ga0207640_10030709	3300025981	Bacteria	3312
401	Ga0207640_10032385	3300025981	Bacteria	3241
402	Ga0207658_10132277	3300025986	Bacteria	2006
403	Ga0207677_10006173	3300026023	Bacteria	6547
404	Ga0207703_10002779	3300026035	Bacteria	14978
405	Ga0207639_10018016	3300026041	Bacteria	5010
406	Ga0207639_10091672	3300026041	Bacteria	2433
407	Ga0207639_10103614	3300026041	Bacteria	2305
408	Ga0207678_10071626	3300026067	Bacteria	2972
409	Ga0207702_10004829	3300026078	Bacteria	11875
410	Ga0207702_10025931	3300026078	Bacteria	4866
411	Ga0207702_10032670	3300026078	Bacteria	4343
412	Ga0207702_10098803	3300026078	Unclassified	2572
413	Ga0207702_10153499	3300026078	Bacteria	2097
414	Ga0207641_10000454	3300026088	Bacteria	46782
415	Ga0207648_10001014	3300026089	Bacteria	31612
416	Ga0207648_10078524	3300026089	Bacteria	2879
417	Ga0207676_10023949	3300026095	Bacteria	4512
418	Ga0207674_10000801	3300026116	Bacteria	40866
419	Ga0207674_10042161	3300026116	Bacteria	4716
420	Ga0207683_10008234	3300026121	Bacteria	8919
421	Ga0207698_10002911	3300026142	Bacteria	10230
422	Ga0207698_10008397	3300026142	Bacteria	6530
423	Ga0207698_10023622	3300026142	Bacteria	4298
424	Ga0268266_10000010	3300028379	Bacteria	1030233
425	Ga0268266_10000078	3300028379	Bacteria	213632
426	Ga0268264_10000052	3300028381	Bacteria	321218
427	Ga0268264_10001040	3300028381	Bacteria	27886
428	Ga0268264_10001805	3300028381	Bacteria	19566
429	Ga0268264_10121055	3300028381	Unclassified	2306
430	Ga0307517_10001368	3300028786	Bacteria	40988
431	Ga0307515_10000001	3300028794	Bacteria	4259510
432	Ga0307515_10000076	3300028794	Bacteria	228736
433	Ga0307515_10001207	3300028794	Bacteria	59017
434	Ga0307515_10001361	3300028794	Bacteria	55260
435	Ga0307515_10241940	3300028794	Unclassified	1573
436	Ga0307511_10000367	3300030521	Bacteria	48024
437	Ga0265327_10000010	3300031251	Bacteria	566817
438	Ga0265327_10000410	3300031251	Bacteria	78900
439	Ga0265327_10003232	3300031251	Bacteria	15840
440	Ga0265327_10006798	3300031251	Bacteria	9023
441	Ga0265327_10105336	3300031251	Bacteria	1355
442	Ga0307513_10064519	3300031456	Bacteria	3859
443	Ga0307509_10012304	3300031507	Bacteria	10251
444	Ga0307509_10138546	3300031507	Bacteria	2374
445	Ga0265313_10089376	3300031595	Bacteria	1386
446	Ga0307508_10023528	3300031616	Bacteria	5593
447	Ga0307516_10001688	3300031730	Bacteria	30411
448	Ga0307405_10000038	3300031731	Bacteria	86305
449	Ga0307407_10000005	3300031903	Bacteria	233125
450	Ga0307409_100051051	3300031995	Bacteria	3163
451	Ga0307416_100000001	3300032002	Bacteria	515017
452	Ga0307414_10002208	3300032004	Bacteria	10149
453	Ga0307411_10228103	3300032005	Bacteria	1450
454	Ga0307507_10000034	3300033179	Bacteria	188697
455	Ga0307510_10000058	3300033180	Bacteria	85118
456	Ga0307510_10001439	3300033180	Bacteria	26186
457	Ga0395899_0000121	3300037312	Bacteria	125324
458	Ga0395899_0000461	3300037312	Bacteria	46076
459	Ga0395899_0001870	3300037312	Bacteria	17378
460	Ga0395900_0000014	3300037418	Bacteria	386513
461	Ga0395900_0000358	3300037418	Bacteria	66350
462	Ga0395900_0052244	3300037418	Bacteria	4207
463	Ga0395898_0002626	3300037466	Bacteria	20893
464	Ga0395898_0155021	3300037466	Bacteria	2191
465	Ga0395905_0000037	3300037471	Bacteria	261808
466	Ga0395905_0003177	3300037471	Bacteria	17687
467	Ga0395905_0058696	3300037471	Bacteria	3598
468	Ga0395905_0081293	3300037471	Bacteria	3037
469	Ga0395901_0000117	3300038443	Bacteria	105071
470	Ga0395901_0024869	3300038443	Bacteria	6147
471	Ga0436365_1030238	3300039437	Bacteria	41914
472	Ga0439436_0024209	3300041404	Bacteria	1793
473	Ga0439465_0034043	3300041413	Unclassified	1630
474	Ga0451849_1379840	3300041505	Unclassified	1475
475	Ga0439457_004699	3300042014	Bacteria	3529
476	Ga0466972_0000015	3300044658	Bacteria	210687
477	Ga0466972_0004695	3300044658	Bacteria	6846
478	Ga0466966_0061790	3300044684	Bacteria	2362
479	Ga0466961_0083363	3300044693	Bacteria	2022
480	Ga0466964_0011076	3300044706	Unclassified	3408
481	Ga0466968_0066786	3300044735	Bacteria	1558
482	Ga0466970_0212923	3300044765	Unclassified	1077
483	Ga0466957_0000015	3300044842	Bacteria	68333
484	Ga0466959_0011900	3300045049	Bacteria	6270
485	Ga0466959_0049429	3300045049	Unclassified	3090
486	Ga0466958_0093181	3300045836	Bacteria	1866
487	Ga0495638_0000015	3300046460	Bacteria	414645
488	Ga0495638_0079889	3300046460	Bacteria	1988
489	Ga0495638_0083554	3300046460	Unclassified	1934
490	Ga0495638_0139772	3300046460	Bacteria	1415
491	Ga0495638_0250028	3300046460	Bacteria	978
492	Ga0495650_0000087	3300046471	Bacteria	234870
493	Ga0495585_0000448	3300046492	Bacteria	39402
494	Ga0495606_0000052	3300046507	Bacteria	201529
495	Ga0495606_0005009	3300046507	Bacteria	12914
496	Ga0495606_0025337	3300046507	Bacteria	4250
497	Ga0495606_0034254	3300046507	Bacteria	3488
498	Ga0495606_0049613	3300046507	Bacteria	2751
499	Ga0495606_0205622	3300046507	Bacteria	1119
500	Ga0495610_0000151	3300046512	Bacteria	76854
501	Ga0495610_0000334	3300046512	Bacteria	49810
502	Ga0495610_0002055	3300046512	Bacteria	17197
503	Ga0495631_0010283	3300046518	Bacteria	4635
504	Ga0495644_0015718	3300046523	Unclassified	2901
505	Ga0495648_0001850	3300046524	Bacteria	20297
506	Ga0495654_0043052	3300046530	Bacteria	2239
507	Ga0495609_0006890	3300046538	Bacteria	5739
508	Ga0495633_0000005	3300046558	Bacteria	357644
509	Ga0495633_0000177	3300046558	Bacteria	82953
510	Ga0495633_0003630	3300046558	Bacteria	10200
511	Ga0495668_0008698	3300046616	Bacteria	6307
512	Ga0495611_0000761	3300046648	Bacteria	18065
513	Ga0495611_0086007	3300046648	Bacteria	1450
514	Ga0495625_0000008	3300046660	Bacteria	536165
515	Ga0495625_0000791	3300046660	Bacteria	43870
516	Ga0495625_0042410	3300046660	Bacteria	3307
517	Ga0495661_0000579	3300046665	Bacteria	37896
518	Ga0495661_0008385	3300046665	Bacteria	7150
519	Ga0495649_0000018	3300046694	Bacteria	220586
520	Ga0495660_0011188	3300046810	Bacteria	5209
521	Ga0495683_0025072	3300047323	Unclassified	3058
522	Ga0495687_000039	3300047443	Bacteria	245077
523	Ga0495687_001584	3300047443	Bacteria	20599
524	Ga0495687_001870	3300047443	Bacteria	18236
525	Ga0495686_0000046	3300047472	Bacteria	281963
526	Ga0495686_0000052	3300047472	Bacteria	262622
527	Ga0495686_0006150	3300047472	Bacteria	9282
528	Ga0495686_0078419	3300047472	Bacteria	2021
529	Ga0495686_0233614	3300047472	Unclassified	1040
530	Ga0496101_0236721	3300048904	Bacteria	1420
531	Ga0496121_0000054	3300048924	Bacteria	307236
532	Ga0496122_0001404	3300048925	Bacteria	39047
533	Ga0496123_0005598	3300048926	Bacteria	12559
534	Ga0496125_0057641	3300048928	Bacteria	3144
535	Ga0496126_0025128	3300048929	Bacteria	5737
536	Ga0495678_015437	3300049459	Bacteria	3514
537	Ga0501300_003865	3300049523	Unclassified	2229
538	Ga0501034_0003353	3300049571	Bacteria	18278
539	Ga0501034_0028880	3300049571	Bacteria	5641
540	Ga0501257_001449	3300049686	Bacteria	4923
541	Ga0501225_0001485	3300049705	Bacteria	7349
542	Ga0501241_000464	3300049758	Bacteria	8805
543	Ga0501264_000009	3300049761	Bacteria	27868
544	Ga0501035_0148029	3300049822	Bacteria	2039
545	Ga0501044_0068849	3300049823	Bacteria	3604
546	Ga0501044_0164574	3300049823	Bacteria	2193
547	Ga0501226_003753	3300049853	Unclassified	1786
548	nmdc:mga0k408_256_c2	3300050493	Bacteria	19110
549	nmdc:mga0k408_7035_c1	3300050493	Bacteria	6005
550	nmdc:mga0k408_884_c1	3300050493	Bacteria	16424
551	Ga0500635_0014074	3300053080	Bacteria	2336
552	Ga0500644_0000146	3300053088	Bacteria	44082
553	Ga0500646_0008458	3300053090	Bacteria	2631
554	Ga0500583_0000008	3300053092	Bacteria	161152
555	Ga0500583_0001883	3300053092	Bacteria	6139
556	Ga0500583_0002934	3300053092	Bacteria	5253
557	Ga0500583_0008301	3300053092	Bacteria	3718
558	Ga0500562_018404	3300053108	Bacteria	1804
559	Ga0500608_030663	3300053122	Bacteria	2549
560	Ga0500618_000124	3300053125	Bacteria	63455
561	Ga0500658_0001637	3300053134	Bacteria	8929
562	Ga0500559_0031094	3300053136	Bacteria	2290
563	Ga0500561_0047823	3300053137	Bacteria	1156
564	Ga0500568_0020330	3300053139	Bacteria	2874
565	Ga0500577_0000301	3300053142	Bacteria	12802
566	Ga0500588_0005287	3300053146	Bacteria	2858
567	Ga0500616_0000037	3300053153	Bacteria	390473
568	Ga0500616_0023713	3300053153	Bacteria	3416
569	Ga0500616_0024945	3300053153	Bacteria	3318
570	Ga0500622_0000010	3300053156	Bacteria	398804
571	Ga0500622_0000044	3300053156	Bacteria	158778
572	Ga0500622_0000531	3300053156	Bacteria	35360
573	Ga0500622_0004975	3300053156	Bacteria	8099
574	Ga0500624_000486	3300053157	Bacteria	11714
575	Ga0500636_0105101	3300053177	Bacteria	1601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009174	Ga0105241_10005285	Ga0105241_100052858	265
2	3300009545	Ga0105237_10001545	Ga0105237_1000154516	265
3	3300009553	Ga0105249_10001331	Ga0105249_1000133111	265
4	3300010375	Ga0105239_10195883	Ga0105239_101958832	265
5	3300011119	Ga0105246_10046950	Ga0105246_100469502	265
6	3300013297	Ga0157378_10423368	Ga0157378_104233682	265
7	3300013306	Ga0163162_10005622	Ga0163162_100056225	265
8	3300013308	Ga0157375_10119766	Ga0157375_101197664	265
9	3300014325	Ga0163163_10210196	Ga0163163_102101962	265
10	3300014968	Ga0157379_10056041	Ga0157379_100560414	265
11	3300003320	rootH2_10029493	rootH2_1002949311	269
12	3300005338	Ga0068868_100004678	Ga0068868_1000046788	270
13	3300005355	Ga0070671_100032790	Ga0070671_1000327902	270
14	3300005364	Ga0070673_100086596	Ga0070673_1000865962	270
15	3300025931	Ga0207644_10010421	Ga0207644_100104212	270
16	3300025960	Ga0207651_10046268	Ga0207651_100462683	270
17	3300026023	Ga0207677_10006173	Ga0207677_100061737	270
18	3300046616	Ga0495668_0008698	Ga0495668_0008698_5475_6287	270
19	3300046507	Ga0495606_0049613	Ga0495606_0049613_18_959	271
20	3300013297	Ga0157378_10076773	Ga0157378_100767733	275
21	3300014969	Ga0157376_10071027	Ga0157376_100710273	275
22	3300005334	Ga0068869_100001765	Ga0068869_1000017656	277
23	3300005335	Ga0070666_10000052	Ga0070666_100000527	277
24	3300005364	Ga0070673_100103987	Ga0070673_1001039873	277
25	3300005367	Ga0070667_100003555	Ga0070667_1000035558	277
26	3300005543	Ga0070672_100108708	Ga0070672_1001087083	277
27	3300005616	Ga0068852_100003824	Ga0068852_1000038243	277
28	3300005617	Ga0068859_100000227	Ga0068859_10000022751	277
29	3300005618	Ga0068864_100015397	Ga0068864_1000153974	277
30	3300005841	Ga0068863_100018813	Ga0068863_1000188134	277
31	3300005842	Ga0068858_100003299	Ga0068858_10000329912	277
32	3300005843	Ga0068860_100259054	Ga0068860_1002590541	277
33	3300006931	Ga0097620_100000227	Ga0097620_10000022751	277
34	3300025903	Ga0207680_10000035	Ga0207680_1000003510	277
35	3300025914	Ga0207671_10000502	Ga0207671_1000050238	277
36	3300025942	Ga0207689_10001620	Ga0207689_1000162014	277
37	3300025972	Ga0207668_10372900	Ga0207668_103729001	277
38	3300026035	Ga0207703_10002779	Ga0207703_100027799	277
39	3300026088	Ga0207641_10000454	Ga0207641_1000045416	277
40	3300026095	Ga0207676_10023949	Ga0207676_100239492	277
41	3300026142	Ga0207698_10008397	Ga0207698_100083973	277
42	3300028381	Ga0268264_10001805	Ga0268264_1000180514	277
43	3300005578	Ga0068854_100149227	Ga0068854_1001492272	279
44	3300049459	Ga0495678_015437	Ga0495678_015437_1132_2112	279
45	3300013296	Ga0157374_10151104	Ga0157374_101511043	280
46	3300013297	Ga0157378_10030294	Ga0157378_100302944	280
47	3300014745	Ga0157377_10059461	Ga0157377_100594612	280
48	3300014968	Ga0157379_10276115	Ga0157379_102761151	280
49	3300046460	Ga0495638_0250028	Ga0495638_0250028_91_933	280
50	3300005367	Ga0070667_100003048	Ga0070667_1000030482	281
51	3300005614	Ga0068856_100018866	Ga0068856_1000188665	281
52	3300009545	Ga0105237_10040020	Ga0105237_100400202	281
53	3300033179	Ga0307507_10000034	Ga0307507_10000034177	282
54	3300037312	Ga0395899_0000121	Ga0395899_0000121_92333_93181	282
55	3300006195	Ga0075366_10002020	Ga0075366_100020203	283
56	3300046660	Ga0495625_0000791	Ga0495625_0000791_39652_40590	283
57	3300050493	nmdc:mga0k408_884_c1	nmdc:mga0k408_884_c1_7844_8782	283
58	3300002773	JGI25152J39213_1000067	JGI25152J39213_100006728	284
59	3300002774	JGI25150J39212_1000001	JGI25150J39212_1000001852	284
60	3300003187	JGI25151J46595_10000005	JGI25151J46595_10000005352	284
61	3300003215	JGI25153J46596_10000040	JGI25153J46596_10000040115	284
62	3300003323	rootH1_10179715	rootH1_101797157	284
63	3300025245	Ga0207425_1000002	Ga0207425_1000002329	284
64	3300025258	Ga0209129_1000002	Ga0209129_1000002329	284
65	3300025294	Ga0209025_1000004	Ga0209025_1000004861	284
66	3300025297	Ga0209758_1000006	Ga0209758_1000006861	284
67	3300053156	Ga0500622_0004975	Ga0500622_0004975_3585_4439	284
68	3300005288	Ga0065714_10139877	Ga0065714_101398771	286
69	3300006237	Ga0097621_100030795	Ga0097621_1000307954	287
70	3300006358	Ga0068871_100002508	Ga0068871_1000025083	287
71	3300009551	Ga0105238_10129459	Ga0105238_101294592	287
72	3300025938	Ga0207704_10074942	Ga0207704_100749423	287
73	3300025914	Ga0207671_10009440	Ga0207671_100094403	289
74	3300025981	Ga0207640_10030709	Ga0207640_100307092	290
75	3300010375	Ga0105239_10006813	Ga0105239_1000681315	291
76	3300017792	Ga0163161_10013631	Ga0163161_100136312	291
77	3300025302	Ga0207426_1000324	Ga0207426_100032460	292
78	3300005365	Ga0070688_100116871	Ga0070688_1001168712	293
79	3300005834	Ga0068851_10027900	Ga0068851_100279003	293
80	3300005841	Ga0068863_100012190	Ga0068863_1000121904	293
81	3300006358	Ga0068871_100065357	Ga0068871_1000653572	293
82	3300025321	Ga0207656_10023948	Ga0207656_100239483	293
83	3300025925	Ga0207650_10008042	Ga0207650_100080424	293
84	3300041505	Ga0451849_1379840	Ga0451849_1379840_143_1048	293
85	3300053146	Ga0500588_0005287	Ga0500588_0005287_1152_2117	294
86	3300044658	Ga0466972_0004695	Ga0466972_0004695_5399_6289	296
87	3300049686	Ga0501257_001449	Ga0501257_001449_444_1334	296
88	3300049761	Ga0501264_000009	Ga0501264_000009_13802_14692	296
89	3300049853	Ga0501226_003753	Ga0501226_003753_491_1381	296
90	3300046460	Ga0495638_0083554	Ga0495638_0083554_90_1028	297
91	3300053108	Ga0500562_018404	Ga0500562_018404_530_1423	297
92	3300003323	rootH1_10045032	rootH1_100450323	298
93	iso_pu_bacteria	2914759650	2914760031	299
94	3300026089	Ga0207648_10078524	Ga0207648_100785242	300
95	3300037471	Ga0395905_0058696	Ga0395905_0058696_1488_2396	300
96	3300003322	rootL2_10032193	rootL2_100321936	301
97	3300003323	rootH1_10153916	rootH1_101539165	301
98	3300005617	Ga0068859_100007421	Ga0068859_1000074215	301
99	3300006931	Ga0097620_100007421	Ga0097620_1000074215	301
100	3300028794	Ga0307515_10000076	Ga0307515_1000007685	301
101	3300031456	Ga0307513_10064519	Ga0307513_100645194	301
102	3300031507	Ga0307509_10012304	Ga0307509_100123042	301
103	3300031616	Ga0307508_10023528	Ga0307508_100235283	301
104	3300005563	Ga0068855_100087490	Ga0068855_1000874903	302
105	3300013102	Ga0157371_10028783	Ga0157371_100287834	302
106	3300049523	Ga0501300_003865	Ga0501300_003865_177_1091	302
107	3300003320	rootH2_10028071	rootH2_100280717	303
108	3300003323	rootH1_10211473	rootH1_102114735	303
109	3300030521	Ga0307511_10000367	Ga0307511_100003675	303
110	3300031251	Ga0265327_10000410	Ga0265327_1000041029	303
111	3300003316	rootH1_10055266	rootH1_100552663	304
112	3300005335	Ga0070666_10286097	Ga0070666_102860972	304
113	3300005539	Ga0068853_100009008	Ga0068853_1000090086	304
114	3300005548	Ga0070665_100000074	Ga0070665_10000007454	304
115	3300005616	Ga0068852_100197935	Ga0068852_1001979352	304
116	3300005843	Ga0068860_100000110	Ga0068860_100000110104	304
117	3300009093	Ga0105240_10000253	Ga0105240_1000025319	304
118	3300009174	Ga0105241_10001498	Ga0105241_100014989	304
119	3300009545	Ga0105237_10009321	Ga0105237_100093213	304
120	3300009551	Ga0105238_10003185	Ga0105238_1000318511	304
121	3300010375	Ga0105239_10008530	Ga0105239_100085303	304
122	3300013297	Ga0157378_10146013	Ga0157378_101460132	304
123	3300013306	Ga0163162_10001089	Ga0163162_1000108921	304
124	3300013307	Ga0157372_10061621	Ga0157372_100616215	304
125	3300025903	Ga0207680_10115644	Ga0207680_101156442	304
126	3300025911	Ga0207654_10003070	Ga0207654_100030705	304
127	3300025913	Ga0207695_10000990	Ga0207695_1000099020	304
128	3300025914	Ga0207671_10004413	Ga0207671_100044137	304
129	3300025924	Ga0207694_10002351	Ga0207694_100023519	304
130	3300025961	Ga0207712_10080903	Ga0207712_100809032	304
131	3300026041	Ga0207639_10018016	Ga0207639_100180164	304
132	3300026142	Ga0207698_10023622	Ga0207698_100236222	304
133	3300028379	Ga0268266_10000010	Ga0268266_10000010678	304
134	3300028381	Ga0268264_10000052	Ga0268264_10000052107	304
135	3300044735	Ga0466968_0066786	Ga0466968_0066786_77_1054	304
136	3300046460	Ga0495638_0079889	Ga0495638_0079889_653_1594	304
137	3300046524	Ga0495648_0001850	Ga0495648_0001850_9082_10023	304
138	3300046648	Ga0495611_0086007	Ga0495611_0086007_33_974	304
139	3300047443	Ga0495687_000039	Ga0495687_000039_144125_145066	304
140	3300053092	Ga0500583_0008301	Ga0500583_0008301_255_1196	304
141	3300053139	Ga0500568_0020330	Ga0500568_0020330_1095_2036	304
142	3300003320	rootH2_10047367	rootH2_1004736710	305
143	3300003320	rootH2_10201796	rootH2_102017963	305
144	3300005466	Ga0070685_10024572	Ga0070685_100245724	305
145	3300005563	Ga0068855_100089752	Ga0068855_1000897522	305
146	3300009093	Ga0105240_10025336	Ga0105240_100253363	305
147	3300021384	Ga0213876_10011576	Ga0213876_100115762	305
148	3300025913	Ga0207695_10022888	Ga0207695_100228885	305
149	3300025949	Ga0207667_10044088	Ga0207667_100440883	305
150	3300026078	Ga0207702_10098803	Ga0207702_100988033	305
151	3300028794	Ga0307515_10001207	Ga0307515_100012078	305
152	3300031730	Ga0307516_10001688	Ga0307516_100016888	305
153	3300039437	Ga0436365_1030238	Ga0436365_1030238_11836_12771	305
154	3300044658	Ga0466972_0000015	Ga0466972_0000015_25509_26432	305
155	3300053125	Ga0500618_000124	Ga0500618_000124_40316_41260	305
156	iso_pu_bacteria	2738541278	2738730067	305
157	3300003316	rootH1_10117900	rootH1_101179003	306
158	3300003322	rootL2_10122172	rootL2_101221721	306
159	3300028794	Ga0307515_10001361	Ga0307515_1000136132	306
160	3300028794	Ga0307515_10241940	Ga0307515_102419402	306
161	3300049571	Ga0501034_0003353	Ga0501034_0003353_14608_15546	306
162	3300049571	Ga0501034_0028880	Ga0501034_0028880_1895_2833	306
163	3300049822	Ga0501035_0148029	Ga0501035_0148029_674_1612	306
164	3300049823	Ga0501044_0068849	Ga0501044_0068849_1253_2191	306
165	iso_pu_bacteria	2929239360	2929241774	306
166	iso_pu_bacteria	2929921140	2929922927	306
167	iso_pu_bacteria	8003151029	8003152267	306
168	3300005327	Ga0070658_10000019	Ga0070658_1000001941	307
169	3300005563	Ga0068855_100005249	Ga0068855_1000052498	307
170	3300005563	Ga0068855_100005699	Ga0068855_1000056995	307
171	3300005577	Ga0068857_100003719	Ga0068857_1000037197	307
172	3300005578	Ga0068854_100090879	Ga0068854_1000908792	307
173	3300005614	Ga0068856_100239456	Ga0068856_1002394562	307
174	3300005616	Ga0068852_100000937	Ga0068852_10000093716	307
175	3300009545	Ga0105237_10015255	Ga0105237_100152555	307
176	3300009551	Ga0105238_10042619	Ga0105238_100426193	307
177	3300013104	Ga0157370_10293118	Ga0157370_102931181	307
178	3300013105	Ga0157369_10010756	Ga0157369_100107566	307
179	3300013307	Ga0157372_10001418	Ga0157372_100014183	307
180	3300014325	Ga0163163_10038203	Ga0163163_100382035	307
181	3300025904	Ga0207647_10008244	Ga0207647_100082444	307
182	3300025909	Ga0207705_10000069	Ga0207705_1000006941	307
183	3300025913	Ga0207695_10159703	Ga0207695_101597032	307
184	3300025914	Ga0207671_10042844	Ga0207671_100428442	307
185	3300025924	Ga0207694_10006989	Ga0207694_100069897	307
186	3300025949	Ga0207667_10001845	Ga0207667_1000184511	307
187	3300025949	Ga0207667_10353002	Ga0207667_103530021	307
188	3300025981	Ga0207640_10032385	Ga0207640_100323852	307
189	3300026116	Ga0207674_10000801	Ga0207674_100008017	307
190	3300026142	Ga0207698_10002911	Ga0207698_100029116	307
191	3300046648	Ga0495611_0000761	Ga0495611_0000761_4897_5853	307
192	3300047472	Ga0495686_0233614	Ga0495686_0233614_102_1025	307
193	3300053137	Ga0500561_0047823	Ga0500561_0047823_21_947	307
194	3300053156	Ga0500622_0000010	Ga0500622_0000010_347548_348483	307
195	3300053156	Ga0500622_0000044	Ga0500622_0000044_50295_51230	307
196	iso_pu_bacteria	2599185184	2599478212	307
197	iso_pu_bacteria	2738541283	2738756255	307
198	iso_pu_bacteria	2818991442	2819574122	307
199	iso_pu_bacteria	2857627736	2857630964	307
200	iso_pu_bacteria	2902048731	2902049810	307
201	iso_pu_bacteria	2928078545	2928080737	307
202	iso_pu_bacteria	2928147474	2928150962	307
203	iso_pu_bacteria	2932082852	2932082880	307
204	3300003323	rootH1_10269415	rootH1_102694152	308
205	3300005262	Ga0065165_1009097	Ga0065165_10090973	308
206	3300005329	Ga0070683_100001459	Ga0070683_10000145916	308
207	3300005330	Ga0070690_100053271	Ga0070690_1000532713	308
208	3300005367	Ga0070667_100289197	Ga0070667_1002891972	308
209	3300005535	Ga0070684_100037941	Ga0070684_1000379415	308
210	3300005563	Ga0068855_100000370	Ga0068855_10000037043	308
211	3300005834	Ga0068851_10145646	Ga0068851_101456461	308
212	3300005841	Ga0068863_100060936	Ga0068863_1000609362	308
213	3300005843	Ga0068860_100000702	Ga0068860_10000070223	308
214	3300005843	Ga0068860_100016624	Ga0068860_1000166242	308
215	3300005983	Ga0081540_1038958	Ga0081540_10389582	308
216	3300009093	Ga0105240_10000448	Ga0105240_1000044811	308
217	3300009545	Ga0105237_10007138	Ga0105237_100071385	308
218	3300010375	Ga0105239_10092076	Ga0105239_100920763	308
219	3300010375	Ga0105239_10112544	Ga0105239_101125442	308
220	3300013296	Ga0157374_10313138	Ga0157374_103131382	308
221	3300013306	Ga0163162_10001699	Ga0163162_1000169914	308
222	3300013306	Ga0163162_10226448	Ga0163162_102264481	308
223	3300013307	Ga0157372_10104354	Ga0157372_101043543	308
224	3300015265	Ga0182005_1000206	Ga0182005_100020622	308
225	3300025208	Ga0209436_103080	Ga0209436_1030802	308
226	3300025302	Ga0207426_1008155	Ga0207426_10081554	308
227	3300025321	Ga0207656_10102271	Ga0207656_101022711	308
228	3300025913	Ga0207695_10000073	Ga0207695_10000073196	308
229	3300025914	Ga0207671_10012517	Ga0207671_100125175	308
230	3300025944	Ga0207661_10020179	Ga0207661_100201793	308
231	3300025949	Ga0207667_10000863	Ga0207667_100008633	308
232	3300028381	Ga0268264_10001040	Ga0268264_1000104015	308
233	3300028381	Ga0268264_10121055	Ga0268264_101210552	308
234	3300028794	Ga0307515_10000001	Ga0307515_10000001663	308
235	3300031251	Ga0265327_10000010	Ga0265327_10000010319	308
236	3300031251	Ga0265327_10006798	Ga0265327_100067987	308
237	3300037471	Ga0395905_0081293	Ga0395905_0081293_1599_2540	308
238	3300044765	Ga0466970_0212923	Ga0466970_0212923_74_1018	308
239	3300048924	Ga0496121_0000054	Ga0496121_0000054_65758_66687	308
240	3300053153	Ga0500616_0024945	Ga0500616_0024945_368_1306	308
241	iso_pu_bacteria	2738541302	2738855555	308
242	iso_pu_bacteria	2739367651	2739589985	308
243	iso_pu_bacteria	2818991437	2819548595	308
244	iso_pu_bacteria	2842722452	2842722703	308
245	iso_pu_bacteria	2842909656	2842913461	308
246	iso_pu_bacteria	2849281842	2849283946	308
247	iso_pu_bacteria	2852623160	2852623358	308
248	iso_pu_bacteria	2884933994	2884937765	308
249	iso_pu_bacteria	2919437846	2919438914	308
250	iso_pu_bacteria	2945997725	2945999632	308
251	iso_pu_bacteria	2977232053	2977236121	308
252	3300001979	JGI24740J21852_10002008	JGI24740J21852_100020084	309
253	3300002738	JGI25154J39366_1000001	JGI25154J39366_1000001210	309
254	3300003215	JGI25153J46596_10000345	JGI25153J46596_1000034520	309
255	3300003320	rootH2_10005898	rootH2_1000589846	309
256	3300003320	rootH2_10066215	rootH2_100662156	309
257	3300003323	rootH1_10006319	rootH1_100063194	309
258	3300003354	JGI25160J50197_1000551	JGI25160J50197_100055113	309
259	3300005353	Ga0070669_100065858	Ga0070669_1000658582	309
260	3300005354	Ga0070675_100235029	Ga0070675_1002350292	309
261	3300009545	Ga0105237_10034397	Ga0105237_100343973	309
262	3300010375	Ga0105239_10023359	Ga0105239_100233596	309
263	3300025242	Ga0209258_108502	Ga0209258_1085022	309
264	3300025246	Ga0209646_1000002	Ga0209646_1000002210	309
265	3300025250	Ga0209026_1000229	Ga0209026_100022931	309
266	3300025302	Ga0207426_1000002	Ga0207426_1000002447	309
267	3300031251	Ga0265327_10105336	Ga0265327_101053362	309
268	3300031507	Ga0307509_10138546	Ga0307509_101385462	309
269	3300041404	Ga0439436_0024209	Ga0439436_0024209_198_1175	309
270	3300042014	Ga0439457_004699	Ga0439457_004699_603_1538	309
271	3300044842	Ga0466957_0000015	Ga0466957_0000015_50818_51753	309
272	3300045049	Ga0466959_0049429	Ga0466959_0049429_1953_2936	309
273	3300046460	Ga0495638_0139772	Ga0495638_0139772_128_1063	309
274	3300046507	Ga0495606_0005009	Ga0495606_0005009_7130_8068	309
275	3300049705	Ga0501225_0001485	Ga0501225_0001485_5853_6788	309
276	3300049823	Ga0501044_0164574	Ga0501044_0164574_659_1600	309
277	3300053090	Ga0500646_0008458	Ga0500646_0008458_1414_2349	309
278	3300053092	Ga0500583_0000008	Ga0500583_0000008_4389_5324	309
279	3300053092	Ga0500583_0002934	Ga0500583_0002934_2854_3831	309
280	3300001989	JGI24739J22299_10000110	JGI24739J22299_1000011010	310
281	3300001989	JGI24739J22299_10022980	JGI24739J22299_100229802	310
282	3300001990	JGI24737J22298_10000110	JGI24737J22298_1000011012	310
283	3300002067	JGI24735J21928_10000004	JGI24735J21928_10000004226	310
284	3300003215	JGI25153J46596_10013174	JGI25153J46596_100131742	310
285	3300003316	rootH1_10018005	rootH1_100180057	310
286	3300003320	rootH2_10016713	rootH2_100167132	310
287	3300003322	rootL2_10113060	rootL2_101130605	310
288	3300003354	JGI25160J50197_1002302	JGI25160J50197_10023022	310
289	3300003771	Ga0055526_1021090	Ga0055526_10210902	310
290	3300003781	Ga0055536_1000049	Ga0055536_10000497	310
291	3300003790	Ga0055528_1002314	Ga0055528_10023149	310
292	3300003791	Ga0055530_10000813	Ga0055530_1000081313	310
293	3300003791	Ga0055530_10001497	Ga0055530_100014977	310
294	3300003794	Ga0055531_10024001	Ga0055531_100240012	310
295	3300004803	Ga0058862_11871750	Ga0058862_118717502	310
296	3300005262	Ga0065165_1000053	Ga0065165_100005317	310
297	3300005336	Ga0070680_100167102	Ga0070680_1001671022	310
298	3300005458	Ga0070681_10032316	Ga0070681_100323162	310
299	3300005530	Ga0070679_100097816	Ga0070679_1000978162	310
300	3300005614	Ga0068856_100033900	Ga0068856_1000339004	310
301	3300006195	Ga0075366_10002035	Ga0075366_100020356	310
302	3300006195	Ga0075366_10022885	Ga0075366_100228852	310
303	3300013102	Ga0157371_10015641	Ga0157371_100156415	310
304	3300013102	Ga0157371_10019972	Ga0157371_100199724	310
305	3300013102	Ga0157371_10037577	Ga0157371_100375772	310
306	3300013104	Ga0157370_10000640	Ga0157370_100006407	310
307	3300013104	Ga0157370_10004105	Ga0157370_100041055	310
308	3300013104	Ga0157370_10116178	Ga0157370_101161782	310
309	3300013306	Ga0163162_10093923	Ga0163162_100939231	310
310	3300013307	Ga0157372_10011107	Ga0157372_100111079	310
311	3300017792	Ga0163161_10000215	Ga0163161_1000021523	310
312	3300025273	Ga0209673_1000034	Ga0209673_1000034180	310
313	3300025292	Ga0209676_1000001	Ga0209676_100000192	310
314	3300025295	Ga0209564_1002599	Ga0209564_10025994	310
315	3300025297	Ga0209758_1005816	Ga0209758_10058165	310
316	3300025297	Ga0209758_1015876	Ga0209758_10158762	310
317	3300025298	Ga0209050_1000258	Ga0209050_10002587	310
318	3300025298	Ga0209050_1000353	Ga0209050_100035320	310
319	3300025298	Ga0209050_1006252	Ga0209050_10062527	310
320	3300025298	Ga0209050_1011212	Ga0209050_10112123	310
321	3300025302	Ga0207426_1000558	Ga0207426_100055829	310
322	3300025304	Ga0209257_1000974	Ga0209257_100097430	310
323	3300025904	Ga0207647_10110261	Ga0207647_101102612	310
324	3300025912	Ga0207707_10011067	Ga0207707_100110673	310
325	3300025917	Ga0207660_10060213	Ga0207660_100602131	310
326	3300026078	Ga0207702_10032670	Ga0207702_100326704	310
327	3300028786	Ga0307517_10001368	Ga0307517_100013683	310
328	3300033180	Ga0307510_10000058	Ga0307510_1000005871	310
329	3300046460	Ga0495638_0000015	Ga0495638_0000015_46542_47492	310
330	3300046471	Ga0495650_0000087	Ga0495650_0000087_144398_145333	310
331	3300046492	Ga0495585_0000448	Ga0495585_0000448_18522_19457	310
332	3300046507	Ga0495606_0000052	Ga0495606_0000052_49525_50460	310
333	3300046507	Ga0495606_0025337	Ga0495606_0025337_2310_3245	310
334	3300046507	Ga0495606_0034254	Ga0495606_0034254_191_1126	310
335	3300046512	Ga0495610_0000151	Ga0495610_0000151_21941_22876	310
336	3300046512	Ga0495610_0000334	Ga0495610_0000334_35729_36664	310
337	3300046512	Ga0495610_0002055	Ga0495610_0002055_11983_12918	310
338	3300046558	Ga0495633_0003630	Ga0495633_0003630_3554_4489	310
339	3300046660	Ga0495625_0000008	Ga0495625_0000008_414876_415811	310
340	3300046660	Ga0495625_0042410	Ga0495625_0042410_1303_2238	310
341	3300046665	Ga0495661_0008385	Ga0495661_0008385_5906_6841	310
342	3300046694	Ga0495649_0000018	Ga0495649_0000018_120354_121289	310
343	3300046810	Ga0495660_0011188	Ga0495660_0011188_1425_2360	310
344	3300047443	Ga0495687_001584	Ga0495687_001584_7048_7983	310
345	3300050493	nmdc:mga0k408_7035_c1	nmdc:mga0k408_7035_c1_3013_3948	310
346	3300053153	Ga0500616_0000037	Ga0500616_0000037_17120_18070	310
347	3300003323	rootH1_10277795	rootH1_102777952	311
348	3300005367	Ga0070667_100194203	Ga0070667_1001942032	311
349	3300005458	Ga0070681_10032989	Ga0070681_100329893	311
350	3300005539	Ga0068853_100038656	Ga0068853_1000386563	311
351	3300005563	Ga0068855_100469362	Ga0068855_1004693622	311
352	3300006195	Ga0075366_10000577	Ga0075366_100005779	311
353	3300009093	Ga0105240_10000358	Ga0105240_1000035850	311
354	3300009093	Ga0105240_10000418	Ga0105240_1000041850	311
355	3300009093	Ga0105240_10081514	Ga0105240_100815142	311
356	3300009093	Ga0105240_10137659	Ga0105240_101376593	311
357	3300009545	Ga0105237_10000137	Ga0105237_100001375	311
358	3300009545	Ga0105237_10050397	Ga0105237_100503973	311
359	3300009551	Ga0105238_10097954	Ga0105238_100979544	311
360	3300009551	Ga0105238_10351142	Ga0105238_103511422	311
361	3300010375	Ga0105239_10000079	Ga0105239_1000007916	311
362	3300010375	Ga0105239_10000761	Ga0105239_100007612	311
363	3300010375	Ga0105239_10024600	Ga0105239_100246002	311
364	3300013100	Ga0157373_10001506	Ga0157373_100015068	311
365	3300013104	Ga0157370_10000695	Ga0157370_1000069537	311
366	3300013104	Ga0157370_10011378	Ga0157370_100113789	311
367	3300013104	Ga0157370_10133433	Ga0157370_101334333	311
368	3300013296	Ga0157374_10000003	Ga0157374_10000003678	311
369	3300013307	Ga0157372_10000813	Ga0157372_100008136	311
370	3300014497	Ga0182008_10000275	Ga0182008_1000027512	311
371	3300014497	Ga0182008_10005048	Ga0182008_100050485	311
372	3300014497	Ga0182008_10024577	Ga0182008_100245773	311
373	3300014969	Ga0157376_10008737	Ga0157376_100087376	311
374	3300015261	Ga0182006_1000160	Ga0182006_100016041	311
375	3300015262	Ga0182007_10002140	Ga0182007_100021409	311
376	3300015262	Ga0182007_10016362	Ga0182007_100163623	311
377	3300017792	Ga0163161_10002011	Ga0163161_1000201112	311
378	3300017792	Ga0163161_10017175	Ga0163161_100171754	311
379	3300025912	Ga0207707_10110400	Ga0207707_101104002	311
380	3300025913	Ga0207695_10000021	Ga0207695_10000021427	311
381	3300025913	Ga0207695_10000039	Ga0207695_1000003981	311
382	3300025913	Ga0207695_10008050	Ga0207695_100080503	311
383	3300025913	Ga0207695_10100699	Ga0207695_101006993	311
384	3300025914	Ga0207671_10000424	Ga0207671_100004244	311
385	3300025914	Ga0207671_10008639	Ga0207671_100086395	311
386	3300025949	Ga0207667_10407598	Ga0207667_104075982	311
387	3300025986	Ga0207658_10132277	Ga0207658_101322772	311
388	3300026041	Ga0207639_10103614	Ga0207639_101036142	311
389	3300031251	Ga0265327_10003232	Ga0265327_1000323210	311
390	3300031595	Ga0265313_10089376	Ga0265313_100893762	311
391	3300041413	Ga0439465_0034043	Ga0439465_0034043_472_1407	311
392	3300044706	Ga0466964_0011076	Ga0466964_0011076_141_1136	311
393	3300045049	Ga0466959_0011900	Ga0466959_0011900_2317_3342	311
394	3300045836	Ga0466958_0093181	Ga0466958_0093181_189_1214	311
395	3300047472	Ga0495686_0000046	Ga0495686_0000046_198260_199258	311
396	3300048925	Ga0496122_0001404	Ga0496122_0001404_201_1139	311
397	3300048926	Ga0496123_0005598	Ga0496123_0005598_8914_9852	311
398	3300048928	Ga0496125_0057641	Ga0496125_0057641_1261_2199	311
399	3300050493	nmdc:mga0k408_256_c2	nmdc:mga0k408_256_c2_8163_9098	311
400	3300001904	JGI24736J21556_1001293	JGI24736J21556_10012932	312
401	3300001904	JGI24736J21556_1002894	JGI24736J21556_10028943	312
402	3300001990	JGI24737J22298_10002285	JGI24737J22298_100022857	312
403	3300002067	JGI24735J21928_10022873	JGI24735J21928_100228732	312
404	3300002077	JGI24744J21845_10006353	JGI24744J21845_100063533	312
405	3300002737	JGI25162J39368_1000017	JGI25162J39368_1000017128	312
406	3300002772	JGI25164J39214_1001206	JGI25164J39214_10012064	312
407	3300003316	rootH1_10189993	rootH1_101899932	312
408	3300003320	rootH2_10001334	rootH2_10001334160	312
409	3300003320	rootH2_10005500	rootH2_100055004	312
410	3300003320	rootH2_10021637	rootH2_100216372	312
411	3300003320	rootH2_10026212	rootH2_100262122	312
412	3300003322	rootL2_10003986	rootL2_100039864	312
413	3300003322	rootL2_10186347	rootL2_101863472	312
414	3300003323	rootH1_10107399	rootH1_101073993	312
415	3300003761	Ga0055535_1001637	Ga0055535_10016372	312
416	3300003762	Ga0055542_1013891	Ga0055542_10138912	312
417	3300003794	Ga0055531_10000041	Ga0055531_1000004120	312
418	3300005262	Ga0065165_1001192	Ga0065165_100119210	312
419	3300005288	Ga0065714_10010704	Ga0065714_100107042	312
420	3300005288	Ga0065714_10064880	Ga0065714_1006488015	312
421	3300005288	Ga0065714_10082910	Ga0065714_100829102	312
422	3300005328	Ga0070676_10000038	Ga0070676_1000003821	312
423	3300005339	Ga0070660_100006923	Ga0070660_1000069232	312
424	3300005355	Ga0070671_100083648	Ga0070671_1000836481	312
425	3300005366	Ga0070659_100003605	Ga0070659_10000360514	312
426	3300005455	Ga0070663_100002072	Ga0070663_1000020729	312
427	3300005456	Ga0070678_100001488	Ga0070678_1000014887	312
428	3300005457	Ga0070662_100000464	Ga0070662_10000046410	312
429	3300005459	Ga0068867_100000255	Ga0068867_10000025525	312
430	3300005539	Ga0068853_100023249	Ga0068853_1000232493	312
431	3300005539	Ga0068853_100025234	Ga0068853_1000252346	312
432	3300005543	Ga0070672_100081196	Ga0070672_1000811963	312
433	3300005548	Ga0070665_100000003	Ga0070665_100000003304	312
434	3300005563	Ga0068855_100000073	Ga0068855_10000007352	312
435	3300005563	Ga0068855_100000086	Ga0068855_10000008679	312
436	3300005563	Ga0068855_100035862	Ga0068855_1000358623	312
437	3300005563	Ga0068855_100203628	Ga0068855_1002036282	312
438	3300005577	Ga0068857_100044431	Ga0068857_1000444314	312
439	3300005614	Ga0068856_100001137	Ga0068856_10000113712	312
440	3300005614	Ga0068856_100070528	Ga0068856_1000705283	312
441	3300005614	Ga0068856_100073790	Ga0068856_1000737906	312
442	3300005614	Ga0068856_100405295	Ga0068856_1004052951	312
443	3300005614	Ga0068856_100450835	Ga0068856_1004508352	312
444	3300005614	Ga0068856_100758693	Ga0068856_1007586931	312
445	3300005616	Ga0068852_100001089	Ga0068852_1000010892	312
446	3300005616	Ga0068852_100404812	Ga0068852_1004048122	312
447	3300005718	Ga0068866_10082142	Ga0068866_100821422	312
448	3300006237	Ga0097621_100000241	Ga0097621_10000024114	312
449	3300006237	Ga0097621_100033955	Ga0097621_1000339555	312
450	3300006358	Ga0068871_100000499	Ga0068871_1000004994	312
451	3300006881	Ga0068865_100000022	Ga0068865_10000002213	312
452	3300009093	Ga0105240_10000010	Ga0105240_10000010439	312
453	3300009093	Ga0105240_10012660	Ga0105240_100126608	312
454	3300009093	Ga0105240_10018980	Ga0105240_100189805	312
455	3300009093	Ga0105240_10128146	Ga0105240_101281464	312
456	3300009093	Ga0105240_10711916	Ga0105240_107119161	312
457	3300009148	Ga0105243_10040383	Ga0105243_100403833	312
458	3300009174	Ga0105241_10002955	Ga0105241_1000295511	312
459	3300009174	Ga0105241_10003853	Ga0105241_100038538	312
460	3300009174	Ga0105241_10014101	Ga0105241_100141016	312
461	3300009176	Ga0105242_10055385	Ga0105242_100553852	312
462	3300009545	Ga0105237_10000065	Ga0105237_1000006584	312
463	3300009545	Ga0105237_10001288	Ga0105237_1000128814	312
464	3300009551	Ga0105238_10019950	Ga0105238_100199505	312
465	3300009553	Ga0105249_10191020	Ga0105249_101910202	312
466	3300010375	Ga0105239_10000005	Ga0105239_10000005187	312
467	3300010375	Ga0105239_10007964	Ga0105239_100079645	312
468	3300010375	Ga0105239_10046424	Ga0105239_100464245	312
469	3300010375	Ga0105239_10662191	Ga0105239_106621911	312
470	3300011119	Ga0105246_10005012	Ga0105246_100050125	312
471	3300013100	Ga0157373_10023325	Ga0157373_100233255	312
472	3300013102	Ga0157371_10000051	Ga0157371_1000005187	312
473	3300013102	Ga0157371_10000622	Ga0157371_1000062222	312
474	3300013102	Ga0157371_10001433	Ga0157371_1000143312	312
475	3300013104	Ga0157370_10026041	Ga0157370_100260415	312
476	3300013104	Ga0157370_10054307	Ga0157370_100543073	312
477	3300013104	Ga0157370_10121527	Ga0157370_101215272	312
478	3300013105	Ga0157369_10000033	Ga0157369_1000003338	312
479	3300013105	Ga0157369_10000165	Ga0157369_100001659	312
480	3300013105	Ga0157369_10389263	Ga0157369_103892632	312
481	3300013105	Ga0157369_10477502	Ga0157369_104775021	312
482	3300013296	Ga0157374_10000130	Ga0157374_1000013023	312
483	3300013296	Ga0157374_10001204	Ga0157374_1000120410	312
484	3300013296	Ga0157374_10279880	Ga0157374_102798802	312
485	3300013306	Ga0163162_10000064	Ga0163162_1000006447	312
486	3300013306	Ga0163162_10000453	Ga0163162_1000045314	312
487	3300013306	Ga0163162_10038047	Ga0163162_100380473	312
488	3300013307	Ga0157372_10000021	Ga0157372_1000002129	312
489	3300013307	Ga0157372_10001155	Ga0157372_1000115529	312
490	3300013308	Ga0157375_10172201	Ga0157375_101722012	312
491	3300015261	Ga0182006_1000168	Ga0182006_100016838	312
492	3300015261	Ga0182006_1001242	Ga0182006_10012424	312
493	3300015262	Ga0182007_10000015	Ga0182007_10000015111	312
494	3300015262	Ga0182007_10022516	Ga0182007_100225162	312
495	3300017792	Ga0163161_10000178	Ga0163161_1000017841	312
496	3300017792	Ga0163161_10026751	Ga0163161_100267515	312
497	3300025230	Ga0209563_103327	Ga0209563_1033273	312
498	3300025231	Ga0207427_100208	Ga0207427_1002089	312
499	3300025233	Ga0209437_100024	Ga0209437_100024186	312
500	3300025233	Ga0209437_100052	Ga0209437_10005242	312
501	3300025242	Ga0209258_100145	Ga0209258_10014547	312
502	3300025250	Ga0209026_1001960	Ga0209026_10019607	312
503	3300025250	Ga0209026_1004883	Ga0209026_10048832	312
504	3300025254	Ga0209148_1000177	Ga0209148_1000177103	312
505	3300025258	Ga0209129_1008282	Ga0209129_10082822	312
506	3300025261	Ga0209233_1000067	Ga0209233_100006742	312
507	3300025261	Ga0209233_1007883	Ga0209233_10078834	312
508	3300025304	Ga0209257_1000001	Ga0209257_1000001850	312
509	3300025904	Ga0207647_10000093	Ga0207647_1000009351	312
510	3300025904	Ga0207647_10000494	Ga0207647_1000049422	312
511	3300025907	Ga0207645_10005282	Ga0207645_100052828	312
512	3300025911	Ga0207654_10009083	Ga0207654_100090836	312
513	3300025913	Ga0207695_10000019	Ga0207695_1000001917	312
514	3300025913	Ga0207695_10001318	Ga0207695_100013187	312
515	3300025913	Ga0207695_10002972	Ga0207695_1000297216	312
516	3300025913	Ga0207695_10054334	Ga0207695_100543345	312
517	3300025914	Ga0207671_10000657	Ga0207671_1000065712	312
518	3300025914	Ga0207671_10003844	Ga0207671_100038444	312
519	3300025914	Ga0207671_10004886	Ga0207671_100048864	312
520	3300025919	Ga0207657_10005438	Ga0207657_100054388	312
521	3300025924	Ga0207694_10070151	Ga0207694_100701512	312
522	3300025931	Ga0207644_10007945	Ga0207644_100079457	312
523	3300025932	Ga0207690_10013862	Ga0207690_100138623	312
524	3300025933	Ga0207706_10000243	Ga0207706_1000024347	312
525	3300025935	Ga0207709_10054519	Ga0207709_100545192	312
526	3300025938	Ga0207704_10000011	Ga0207704_1000001113	312
527	3300025940	Ga0207691_10200901	Ga0207691_102009012	312
528	3300025949	Ga0207667_10000009	Ga0207667_10000009193	312
529	3300025949	Ga0207667_10000229	Ga0207667_1000022952	312
530	3300025949	Ga0207667_10009882	Ga0207667_1000988210	312
531	3300025949	Ga0207667_10171593	Ga0207667_101715932	312
532	3300025960	Ga0207651_10079630	Ga0207651_100796302	312
533	3300026041	Ga0207639_10091672	Ga0207639_100916721	312
534	3300026067	Ga0207678_10071626	Ga0207678_100716265	312
535	3300026078	Ga0207702_10004829	Ga0207702_100048294	312
536	3300026078	Ga0207702_10153499	Ga0207702_101534992	312
537	3300026089	Ga0207648_10001014	Ga0207648_100010146	312
538	3300026116	Ga0207674_10042161	Ga0207674_100421614	312
539	3300026121	Ga0207683_10008234	Ga0207683_100082342	312
540	3300028379	Ga0268266_10000078	Ga0268266_1000007894	312
541	3300031731	Ga0307405_10000038	Ga0307405_1000003850	312
542	3300031903	Ga0307407_10000005	Ga0307407_10000005145	312
543	3300031995	Ga0307409_100051051	Ga0307409_1000510511	312
544	3300032002	Ga0307416_100000001	Ga0307416_10000000136	312
545	3300032004	Ga0307414_10002208	Ga0307414_100022085	312
546	3300032005	Ga0307411_10228103	Ga0307411_102281032	312
547	3300033180	Ga0307510_10001439	Ga0307510_1000143910	312
548	3300037312	Ga0395899_0000461	Ga0395899_0000461_24892_25830	312
549	3300037312	Ga0395899_0001870	Ga0395899_0001870_8128_9066	312
550	3300037418	Ga0395900_0000014	Ga0395900_0000014_170146_171084	312
551	3300037466	Ga0395898_0002626	Ga0395898_0002626_1744_2682	312
552	3300037471	Ga0395905_0000037	Ga0395905_0000037_170136_171074	312
553	3300038443	Ga0395901_0000117	Ga0395901_0000117_83793_84731	312
554	3300044684	Ga0466966_0061790	Ga0466966_0061790_1230_2168	312
555	3300044693	Ga0466961_0083363	Ga0466961_0083363_540_1478	312
556	3300046518	Ga0495631_0010283	Ga0495631_0010283_3113_4054	312
557	3300046523	Ga0495644_0015718	Ga0495644_0015718_214_1152	312
558	3300046530	Ga0495654_0043052	Ga0495654_0043052_68_1006	312
559	3300046538	Ga0495609_0006890	Ga0495609_0006890_2099_3037	312
560	3300046558	Ga0495633_0000005	Ga0495633_0000005_90949_91899	312
561	3300046558	Ga0495633_0000177	Ga0495633_0000177_31728_32666	312
562	3300046665	Ga0495661_0000579	Ga0495661_0000579_26435_27373	312
563	3300047323	Ga0495683_0025072	Ga0495683_0025072_2096_3037	312
564	3300047443	Ga0495687_001870	Ga0495687_001870_5771_6709	312
565	3300047472	Ga0495686_0000052	Ga0495686_0000052_140682_141623	312
566	3300047472	Ga0495686_0006150	Ga0495686_0006150_191_1129	312
567	3300047472	Ga0495686_0078419	Ga0495686_0078419_217_1158	312
568	3300048904	Ga0496101_0236721	Ga0496101_0236721_166_1116	312
569	3300048929	Ga0496126_0025128	Ga0496126_0025128_2695_3645	312
570	3300049758	Ga0501241_000464	Ga0501241_000464_5690_6640	312
571	3300053080	Ga0500635_0014074	Ga0500635_0014074_252_1190	312
572	3300053088	Ga0500644_0000146	Ga0500644_0000146_15332_16306	312
573	3300053092	Ga0500583_0001883	Ga0500583_0001883_4274_5248	312
574	3300053122	Ga0500608_030663	Ga0500608_030663_377_1318	312
575	3300053134	Ga0500658_0001637	Ga0500658_0001637_1451_2425	312
576	3300053142	Ga0500577_0000301	Ga0500577_0000301_4781_5755	312
577	3300053153	Ga0500616_0023713	Ga0500616_0023713_1152_2126	312
578	3300053156	Ga0500622_0000531	Ga0500622_0000531_25007_25957	312
579	3300053157	Ga0500624_000486	Ga0500624_000486_2570_3511	312
580	iso_pu_bacteria	2954016120	2954016374	312
581	3300005339	Ga0070660_100004589	Ga0070660_1000045894	313
582	3300005530	Ga0070679_100038210	Ga0070679_1000382102	313
583	3300005614	Ga0068856_100066617	Ga0068856_1000666175	313
584	3300009093	Ga0105240_10093485	Ga0105240_100934852	313
585	3300013296	Ga0157374_10018303	Ga0157374_100183037	313
586	3300015682	Ga0183373_1005	Ga0183373_1005144	313
587	3300025913	Ga0207695_10166846	Ga0207695_101668463	313
588	3300025919	Ga0207657_10012800	Ga0207657_100128004	313
589	3300025921	Ga0207652_10395727	Ga0207652_103957271	313
590	3300026078	Ga0207702_10025931	Ga0207702_100259312	313
591	3300037418	Ga0395900_0000358	Ga0395900_0000358_41316_42257	313
592	3300037418	Ga0395900_0052244	Ga0395900_0052244_2544_3485	313
593	3300037466	Ga0395898_0155021	Ga0395898_0155021_75_1016	313
594	3300037471	Ga0395905_0003177	Ga0395905_0003177_3771_4712	313
595	3300038443	Ga0395901_0024869	Ga0395901_0024869_4060_5001	313
596	3300046507	Ga0495606_0205622	Ga0495606_0205622_115_1062	313
597	2162886012	MBSR1b_contig_13895874	MBSR1b_0704.00002160	314
598	3300005293	Ga0065715_10091091	Ga0065715_100910915	314
599	3300053136	Ga0500559_0031094	Ga0500559_0031094_975_1958	314
600	3300053177	Ga0500636_0105101	Ga0500636_0105101_437_1420	314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14378

PAP2_3

PAP2 superfamily

119

308

0.78 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6ebu-assembly1.cif.gz_A	crystal structure of aquifex aeolicus lpxe	0.7627	112	287
6ebu-assembly1.cif.gz_A	crystal structure of aquifex aeolicus lpxe	0.7054	112	287
8bm3-assembly4.cif.gz_D	h207a mutant of e. coli pgpb, a pap2 type phosphatidyl glycerol phosphate and c55-pp phosphatase, in complex with farnesyl pyrophosphate	0.6296	120	292
5jki-assembly1.cif.gz_A	crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis	0.5701	61	313
5jki-assembly1.cif.gz_A	crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis	0.5608	61	313

ID	Description	Score	Start	End	Superfamily
af_A0A1D8PEJ5_1_514_1.20.144.10	Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase	0.804	112	312	1.20.144.10
af_Q66H88_95_284_1.20.144.10	Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase	0.6669	112	292	1.20.144.10
af_Q75HI8_51_243_1.20.144.10	Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase	0.6647	115	303	1.20.144.10
af_Q9BUM1_5_197_1.20.144.10	Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase	0.6575	112	296	1.20.144.10
af_Q4D544_53_235_1.20.144.10	Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase	0.6454	92	306	1.20.144.10

ID	Description	Score	Start	End	GO Terms
AF-X1QSS6-F1-model_v4	Inositolphosphotransferase Aur1/Ipt1 domain-containing protein	0.9887	78	288	GO:0016020
AF-A0A2E0VS75-F1-model_v4	PA-phosphatase	0.9873	23	312	GO:0016020
AF-A0A2A3UC75-F1-model_v4	deleted	0.9855	8	312
AF-A0A1T5MHN0-F1-model_v4	PAP2 superfamily protein	0.985	17	312	GO:0016020
AF-A0A2A5HH73-F1-model_v4	PA-phosphatase	0.9843	78	309	GO:0016020

Feature Viewer

pLDDT	pTM	Quality
91.8	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467953

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF14378

PAP2_3

PAP2 superfamily

119

308

0.78

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map