F467820

General Info

Members Datasets Scaffolds Average Seq Length
598 274 593 108

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000923|Ga0501034_0000923_24584_24949
Length 121
Sequence MTYGDQAMKGTHLRFYTYENRHTRGVPTYEWLLEQAKKLGIHGGSAFRAIAGYGRHGQLHEQHFFELAGEQPVLVEFIVDEGQAQALFALLRREEQALFYARLPAEFGVSNESDPGRGESA

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221586 Lysobacter sp. Root667 Isolate Unclassified
3 2643221612 Lysobacter sp. Root76 Isolate Unclassified
4 2643221727 Lysobacter sp. Root96 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
169 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
209 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 1.34
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10272390 3300005327 Bacteria 1440
2 Ga0070658_10397193 3300005327 Bacteria 1184
3 Ga0070658_11708990 3300005327 Bacteria 545
4 Ga0070676_10131889 3300005328 Bacteria 1581
5 Ga0070683_100011063 3300005329 Bacteria 7778
6 Ga0070683_101687160 3300005329 Bacteria 609
7 Ga0070690_100115446 3300005330 Bacteria 1796
8 Ga0070690_100138207 3300005330 Bacteria 1652
9 Ga0070670_100904456 3300005331 Bacteria 800
10 Ga0068869_100045770 3300005334 Bacteria 3152
11 Ga0068869_100597922 3300005334 Bacteria 931
12 Ga0068869_100841932 3300005334 Unclassified 791
13 Ga0068869_101534036 3300005334 Bacteria 592
14 Ga0070666_10000636 3300005335 Bacteria 21149
15 Ga0070666_10090072 3300005335 Bacteria 2106
16 Ga0070666_10119052 3300005335 Bacteria 1830
17 Ga0070666_10414349 3300005335 Bacteria 970
18 Ga0070666_10666063 3300005335 Bacteria 762
19 Ga0070666_10897491 3300005335 Unclassified 655
20 Ga0070680_100923196 3300005336 Unclassified 753
21 Ga0070680_101437687 3300005336 Bacteria 597
22 Ga0070682_100129892 3300005337 Bacteria 1703
23 Ga0070682_101698030 3300005337 Bacteria 548
24 Ga0068868_100277032 3300005338 Bacteria 1419
25 Ga0070660_100135060 3300005339 Bacteria 1976
26 Ga0070660_100171177 3300005339 Bacteria 1754
27 Ga0070660_100625648 3300005339 Bacteria 901
28 Ga0070660_101720914 3300005339 Bacteria 534
29 Ga0070689_100278762 3300005340 Bacteria 1386
30 Ga0070687_101121461 3300005343 Unclassified 576
31 Ga0070661_100005961 3300005344 Bacteria 8388
32 Ga0070661_100064236 3300005344 Bacteria 2698
33 Ga0070661_100069182 3300005344 Bacteria 2595
34 Ga0070661_100087023 3300005344 Bacteria 2311
35 Ga0070661_101930491 3300005344 Unclassified 502
36 Ga0070668_100156308 3300005347 Bacteria 1848
37 Ga0070668_100626179 3300005347 Bacteria 943
38 Ga0070669_100023581 3300005353 Bacteria 4406
39 Ga0070669_100285666 3300005353 Bacteria 1323
40 Ga0070675_100045154 3300005354 Bacteria 3605
41 Ga0070675_100127202 3300005354 Bacteria 2169
42 Ga0070671_100009336 3300005355 Bacteria 7875
43 Ga0070671_101163552 3300005355 Bacteria 678
44 Ga0070671_101172613 3300005355 Bacteria 676
45 Ga0070674_100077403 3300005356 Bacteria 2368
46 Ga0070674_100197236 3300005356 Bacteria 1552
47 Ga0070674_100298242 3300005356 Bacteria 1284
48 Ga0070673_100095936 3300005364 Bacteria 2433
49 Ga0070673_100166769 3300005364 Bacteria 1877
50 Ga0070688_101450386 3300005365 Unclassified 557
51 Ga0070659_100017290 3300005366 Bacteria 5423
52 Ga0070659_100126317 3300005366 Bacteria 2075
53 Ga0070659_102044431 3300005366 Bacteria 515
54 Ga0070667_100016460 3300005367 Bacteria 6118
55 Ga0070667_100048576 3300005367 Bacteria 3572
56 Ga0070667_100478705 3300005367 Bacteria 1139
57 Ga0070703_10583580 3300005406 Unclassified 514
58 Ga0070709_10069274 3300005434 Bacteria 2271
59 Ga0070714_100005304 3300005435 Bacteria 9823
60 Ga0070713_100011691 3300005436 Bacteria 6404
61 Ga0070710_10041319 3300005437 Bacteria 2546
62 Ga0070711_100445960 3300005439 Bacteria 1059
63 Ga0070711_101395388 3300005439 Bacteria 609
64 Ga0070705_100103281 3300005440 Bacteria 1804
65 Ga0070705_100195073 3300005440 Unclassified 1384
66 Ga0070694_100455891 3300005444 Unclassified 1010
67 Ga0070708_100134519 3300005445 Bacteria 2289
68 Ga0070708_100139381 3300005445 Bacteria 2248
69 Ga0070708_100444039 3300005445 Unclassified 1224
70 Ga0070708_100920982 3300005445 Bacteria 820
71 Ga0070663_100021261 3300005455 Bacteria 4313
72 Ga0070663_100843328 3300005455 Bacteria 788
73 Ga0070663_101505556 3300005455 Bacteria 598
74 Ga0070678_100022303 3300005456 Bacteria 4193
75 Ga0070678_100856209 3300005456 Unclassified 829
76 Ga0070662_100000154 3300005457 Bacteria 39615
77 Ga0070681_10069911 3300005458 Bacteria 3476
78 Ga0070681_10440107 3300005458 Bacteria 1215
79 Ga0070681_11156033 3300005458 Unclassified 695
80 Ga0068867_100220338 3300005459 Bacteria 1529
81 Ga0070685_10000386 3300005466 Bacteria 26505
82 Ga0070685_11031465 3300005466 Bacteria 618
83 Ga0070706_100002053 3300005467 Bacteria 20636
84 Ga0070706_100028768 3300005467 Bacteria 5118
85 Ga0070706_100047930 3300005467 Bacteria 3944
86 Ga0070706_100209714 3300005467 Bacteria 1819
87 Ga0070707_100028231 3300005468 Bacteria 5338
88 Ga0070707_100061402 3300005468 Bacteria 3604
89 Ga0070707_100147521 3300005468 Bacteria 2289
90 Ga0070707_100379822 3300005468 Unclassified 1372
91 Ga0070707_101218694 3300005468 Unclassified 719
92 Ga0070707_101873536 3300005468 Bacteria 567
93 Ga0070698_100112361 3300005471 Bacteria 2689
94 Ga0070698_100146183 3300005471 Bacteria 2313
95 Ga0070698_100568989 3300005471 Bacteria 1073
96 Ga0070698_100830500 3300005471 Bacteria 868
97 Ga0070698_101495844 3300005471 Unclassified 626
98 Ga0070699_100087009 3300005518 Bacteria 2728
99 Ga0070699_101811505 3300005518 Unclassified 559
100 Ga0070679_100224296 3300005530 Bacteria 1840
101 Ga0070679_100315630 3300005530 Bacteria 1512
102 Ga0070679_100469610 3300005530 Unclassified 1202
103 Ga0070679_100883029 3300005530 Bacteria 837
104 Ga0070679_101150169 3300005530 Bacteria 721
105 Ga0070684_100167390 3300005535 Bacteria 1995
106 Ga0070697_100384743 3300005536 Bacteria 1215
107 Ga0070697_100402652 3300005536 Bacteria 1188
108 Ga0070697_100521067 3300005536 Unclassified 1041
109 Ga0068853_100001874 3300005539 Bacteria 15481
110 Ga0068853_100015663 3300005539 Bacteria 6228
111 Ga0068853_100040081 3300005539 Bacteria 3995
112 Ga0068853_100075241 3300005539 Bacteria 2947
113 Ga0068853_100106557 3300005539 Bacteria 2484
114 Ga0068853_100230148 3300005539 Bacteria 1695
115 Ga0068853_100231778 3300005539 Bacteria 1689
116 Ga0070672_100212236 3300005543 Bacteria 1621
117 Ga0070672_100378111 3300005543 Bacteria 1211
118 Ga0070695_100617066 3300005545 Bacteria 853
119 Ga0070696_100003306 3300005546 Bacteria 10765
120 Ga0070696_100070656 3300005546 Bacteria 2456
121 Ga0070696_100134573 3300005546 Bacteria 1801
122 Ga0070696_101721397 3300005546 Bacteria 541
123 Ga0070693_100187558 3300005547 Bacteria 1335
124 Ga0070693_100247271 3300005547 Bacteria 1181
125 Ga0070693_100665219 3300005547 Bacteria 759
126 Ga0070665_100029190 3300005548 Bacteria 5551
127 Ga0070704_100468253 3300005549 Bacteria 1088
128 Ga0068855_100013724 3300005563 Bacteria 9767
129 Ga0068855_100176616 3300005563 Bacteria 2416
130 Ga0068855_101181093 3300005563 Bacteria 796
131 Ga0068855_102330044 3300005563 Unclassified 535
132 Ga0070664_100001161 3300005564 Bacteria 20900
133 Ga0068857_100101392 3300005577 Bacteria 2583
134 Ga0068857_100723888 3300005577 Bacteria 946
135 Ga0068854_100051915 3300005578 Bacteria 2939
136 Ga0068854_100155344 3300005578 Bacteria 1767
137 Ga0068854_100161259 3300005578 Bacteria 1737
138 Ga0068856_100001030 3300005614 Bacteria 29686
139 Ga0068856_100022479 3300005614 Bacteria 6131
140 Ga0068856_100102646 3300005614 Bacteria 2853
141 Ga0068856_100424535 3300005614 Bacteria 1349
142 Ga0068852_100037199 3300005616 Bacteria 4078
143 Ga0068852_100063380 3300005616 Bacteria 3219
144 Ga0068852_100084085 3300005616 Bacteria 2831
145 Ga0068852_100267619 3300005616 Bacteria 1643
146 Ga0068852_100710113 3300005616 Bacteria 1016
147 Ga0068852_100815085 3300005616 Bacteria 948
148 Ga0068859_100435086 3300005617 Bacteria 1408
149 Ga0068859_101659496 3300005617 Bacteria 706
150 Ga0068864_100046469 3300005618 Bacteria 3725
151 Ga0068861_100531705 3300005719 Bacteria 1068
152 Ga0068851_10022844 3300005834 Bacteria 3053
153 Ga0068851_10117736 3300005834 Bacteria 1425
154 Ga0068870_10041766 3300005840 Bacteria 2385
155 Ga0068863_100000329 3300005841 Bacteria 48080
156 Ga0068863_100337055 3300005841 Bacteria 1467
157 Ga0068863_100733872 3300005841 Bacteria 983
158 Ga0068858_100156266 3300005842 Bacteria 2146
159 Ga0068860_100005962 3300005843 Bacteria 12260
160 Ga0068860_101596453 3300005843 Bacteria 674
161 Ga0075368_10030922 3300006042 Bacteria 2075
162 Ga0075363_100324429 3300006048 Bacteria 896
163 Ga0070716_100141982 3300006173 Bacteria 1533
164 Ga0075367_10042468 3300006178 Bacteria 2660
165 Ga0075366_10016688 3300006195 Bacteria 4221
166 Ga0097621_100090608 3300006237 Bacteria 2559
167 Ga0097621_100181762 3300006237 Bacteria 1817
168 Ga0097621_100892723 3300006237 Bacteria 827
169 Ga0075370_10004816 3300006353 Bacteria 6609
170 Ga0068871_100130524 3300006358 Bacteria 2130
171 Ga0068871_100190250 3300006358 Bacteria 1768
172 Ga0068871_100601522 3300006358 Bacteria 1000
173 Ga0068871_101243385 3300006358 Bacteria 699
174 Ga0068871_101451400 3300006358 Unclassified 647
175 Ga0075434_101017625 3300006871 Unclassified 842
176 Ga0068865_100063178 3300006881 Bacteria 2602
177 Ga0068865_100337990 3300006881 Bacteria 1216
178 Ga0097620_100435122 3300006931 Bacteria 1408
179 Ga0097620_101659403 3300006931 Bacteria 706
180 Ga0105240_10000453 3300009093 Bacteria 75454
181 Ga0105240_10132389 3300009093 Bacteria 2990
182 Ga0105240_10148066 3300009093 Bacteria 2799
183 Ga0105240_11096088 3300009093 Bacteria 847
184 Ga0105245_10140723 3300009098 Unclassified 2272
185 Ga0105245_10253709 3300009098 Bacteria 1710
186 Ga0105247_10553859 3300009101 Bacteria 846
187 Ga0114129_10275039 3300009147 Bacteria 2252
188 Ga0105241_10017869 3300009174 Bacteria 5216
189 Ga0105241_10022409 3300009174 Bacteria 4679
190 Ga0105241_10027430 3300009174 Bacteria 4241
191 Ga0105241_11349916 3300009174 Bacteria 681
192 Ga0105241_12012794 3300009174 Bacteria 569
193 Ga0105242_10032861 3300009176 Bacteria 4151
194 Ga0105242_10596970 3300009176 Bacteria 1066
195 Ga0105242_10912695 3300009176 Unclassified 879
196 Ga0105248_10056463 3300009177 Bacteria 4405
197 Ga0105248_10139127 3300009177 Bacteria 2738
198 Ga0105248_10532460 3300009177 Bacteria 1325
199 Ga0105237_10010967 3300009545 Bacteria 9616
200 Ga0105237_10232300 3300009545 Bacteria 1845
201 Ga0105237_10584177 3300009545 Bacteria 1124
202 Ga0105237_11163351 3300009545 Bacteria 778
203 Ga0105237_11823929 3300009545 Bacteria 616
204 Ga0105238_10013371 3300009551 Bacteria 8283
205 Ga0105238_10014095 3300009551 Bacteria 8083
206 Ga0105238_10078507 3300009551 Bacteria 3291
207 Ga0105249_10834358 3300009553 Bacteria 987
208 Ga0105239_10003753 3300010375 Bacteria 18491
209 Ga0105239_10008231 3300010375 Bacteria 11895
210 Ga0105239_10077290 3300010375 Bacteria 3663
211 Ga0105239_10142163 3300010375 Bacteria 2675
212 Ga0105239_10147889 3300010375 Bacteria 2621
213 Ga0105239_10648722 3300010375 Bacteria 1206
214 Ga0105239_11028667 3300010375 Bacteria 947
215 Ga0105239_12011044 3300010375 Bacteria 671
216 Ga0105239_12393319 3300010375 Bacteria 615
217 Ga0105246_10021624 3300011119 Bacteria 4141
218 Ga0105246_10299250 3300011119 Bacteria 1298
219 Ga0157373_10371493 3300013100 Bacteria 1022
220 Ga0157373_10502838 3300013100 Bacteria 876
221 Ga0157371_10454714 3300013102 Bacteria 942
222 Ga0157371_10537674 3300013102 Bacteria 865
223 Ga0157370_10038747 3300013104 Bacteria 4609
224 Ga0157370_10064504 3300013104 Bacteria 3468
225 Ga0157370_10086784 3300013104 Bacteria 2939
226 Ga0157370_10132893 3300013104 Bacteria 2321
227 Ga0157370_11080222 3300013104 Bacteria 725
228 Ga0157369_10000025 3300013105 Bacteria 225515
229 Ga0157369_10004991 3300013105 Bacteria 15535
230 Ga0157369_10013038 3300013105 Bacteria 9414
231 Ga0157369_10076246 3300013105 Bacteria 3594
232 Ga0157369_10285061 3300013105 Bacteria 1720
233 Ga0157369_10323733 3300013105 Bacteria 1602
234 Ga0157374_10022440 3300013296 Bacteria 5631
235 Ga0157374_10096901 3300013296 Bacteria 2821
236 Ga0157374_10235137 3300013296 Bacteria 1801
237 Ga0157378_10000042 3300013297 Bacteria 107945
238 Ga0157378_10326728 3300013297 Bacteria 1492
239 Ga0157378_11250724 3300013297 Bacteria 783
240 Ga0163162_10014416 3300013306 Bacteria 7724
241 Ga0163162_10344519 3300013306 Bacteria 1623
242 Ga0163162_10431279 3300013306 Bacteria 1450
243 Ga0163162_11327730 3300013306 Bacteria 817
244 Ga0157372_10001339 3300013307 Bacteria 26641
245 Ga0157372_10185107 3300013307 Bacteria 2412
246 Ga0157372_10233679 3300013307 Bacteria 2132
247 Ga0157372_10415002 3300013307 Bacteria 1569
248 Ga0157372_11712346 3300013307 Bacteria 723
249 Ga0157375_10001312 3300013308 Bacteria 21447
250 Ga0157375_10003810 3300013308 Bacteria 13074
251 Ga0157375_10865063 3300013308 Bacteria 1050
252 Ga0157375_10943783 3300013308 Unclassified 1005
253 Ga0163163_10000589 3300014325 Bacteria 32012
254 Ga0163163_10037145 3300014325 Bacteria 4737
255 Ga0163163_10061254 3300014325 Bacteria 3728
256 Ga0163163_11552399 3300014325 Bacteria 723
257 Ga0182008_10687647 3300014497 Bacteria 583
258 Ga0157379_10000908 3300014968 Bacteria 23906
259 Ga0157379_10037939 3300014968 Bacteria 4298
260 Ga0157379_10444677 3300014968 Unclassified 1196
261 Ga0157376_10002712 3300014969 Bacteria 12060
262 Ga0157376_10011163 3300014969 Bacteria 6609
263 Ga0157376_10712493 3300014969 Unclassified 1010
264 Ga0157376_10821108 3300014969 Bacteria 943
265 Ga0157376_11519898 3300014969 Bacteria 703
266 Ga0183369_1007 3300015685 Bacteria 414878
267 Ga0207656_10247714 3300025321 Bacteria 872
268 Ga0207653_10166747 3300025885 Unclassified 818
269 Ga0207692_10022970 3300025898 Bacteria 2878
270 Ga0207692_10639495 3300025898 Archaea 686
271 Ga0207692_10892490 3300025898 Unclassified 584
272 Ga0207680_10073742 3300025903 Bacteria 2123
273 Ga0207680_10241176 3300025903 Bacteria 1246
274 Ga0207680_10384178 3300025903 Bacteria 990
275 Ga0207680_10459526 3300025903 Unclassified 904
276 Ga0207699_10041423 3300025906 Bacteria 2660
277 Ga0207699_10053262 3300025906 Bacteria 2398
278 Ga0207699_11024696 3300025906 Unclassified 610
279 Ga0207645_10164774 3300025907 Bacteria 1451
280 Ga0207643_10007592 3300025908 Bacteria 5823
281 Ga0207705_10311711 3300025909 Bacteria 1208
282 Ga0207684_10002473 3300025910 Bacteria 18611
283 Ga0207684_10081385 3300025910 Bacteria 2756
284 Ga0207684_10155359 3300025910 Bacteria 1969
285 Ga0207684_10623371 3300025910 Bacteria 920
286 Ga0207654_10004819 3300025911 Bacteria 6828
287 Ga0207654_10114389 3300025911 Bacteria 1684
288 Ga0207654_10214091 3300025911 Bacteria 1275
289 Ga0207707_10207949 3300025912 Bacteria 1705
290 Ga0207707_10353790 3300025912 Bacteria 1265
291 Ga0207707_11367477 3300025912 Bacteria 566
292 Ga0207707_11433951 3300025912 Unclassified 550
293 Ga0207695_10000172 3300025913 Bacteria 190573
294 Ga0207695_10000295 3300025913 Bacteria 123533
295 Ga0207695_10001580 3300025913 Bacteria 37116
296 Ga0207695_10206121 3300025913 Bacteria 1879
297 Ga0207671_10002240 3300025914 Bacteria 20934
298 Ga0207671_10007489 3300025914 Bacteria 9468
299 Ga0207671_10854415 3300025914 Bacteria 720
300 Ga0207671_11067904 3300025914 Bacteria 635
301 Ga0207671_11377506 3300025914 Bacteria 547
302 Ga0207693_10036438 3300025915 Bacteria 3878
303 Ga0207663_10519965 3300025916 Bacteria 927
304 Ga0207663_10723546 3300025916 Bacteria 789
305 Ga0207660_10284188 3300025917 Unclassified 1314
306 Ga0207660_10836034 3300025917 Bacteria 751
307 Ga0207660_10986309 3300025917 Bacteria 687
308 Ga0207657_10000410 3300025919 Bacteria 45335
309 Ga0207657_10002223 3300025919 Bacteria 21052
310 Ga0207657_11006161 3300025919 Bacteria 639
311 Ga0207649_10002226 3300025920 Bacteria 10961
312 Ga0207649_10028033 3300025920 Bacteria 3313
313 Ga0207646_10029934 3300025922 Bacteria 4942
314 Ga0207646_10490522 3300025922 Bacteria 1107
315 Ga0207646_10556174 3300025922 Bacteria 1031
316 Ga0207646_10612296 3300025922 Unclassified 977
317 Ga0207646_10692131 3300025922 Bacteria 912
318 Ga0207646_11211680 3300025922 Unclassified 661
319 Ga0207646_11326534 3300025922 Bacteria 628
320 Ga0207681_10041657 3300025923 Bacteria 3063
321 Ga0207681_11273904 3300025923 Bacteria 617
322 Ga0207694_10005258 3300025924 Bacteria 9975
323 Ga0207694_10018235 3300025924 Bacteria 5304
324 Ga0207694_10130893 3300025924 Bacteria 2011
325 Ga0207694_11126049 3300025924 Bacteria 664
326 Ga0207650_10261114 3300025925 Bacteria 1405
327 Ga0207650_10639639 3300025925 Bacteria 896
328 Ga0207659_10220803 3300025926 Bacteria 1524
329 Ga0207687_10396617 3300025927 Bacteria 1134
330 Ga0207687_10841326 3300025927 Bacteria 784
331 Ga0207700_10108644 3300025928 Bacteria 2228
332 Ga0207664_10003726 3300025929 Bacteria 10230
333 Ga0207644_10173377 3300025931 Bacteria 1686
334 Ga0207644_11061952 3300025931 Bacteria 680
335 Ga0207690_10011451 3300025932 Bacteria 5303
336 Ga0207690_10730415 3300025932 Bacteria 815
337 Ga0207706_10000508 3300025933 Bacteria 41431
338 Ga0207706_10156147 3300025933 Bacteria 2006
339 Ga0207686_10016819 3300025934 Bacteria 4109
340 Ga0207686_10685019 3300025934 Unclassified 814
341 Ga0207670_10821577 3300025936 Bacteria 775
342 Ga0207669_11492295 3300025937 Bacteria 576
343 Ga0207704_10042757 3300025938 Bacteria 2670
344 Ga0207704_10156433 3300025938 Bacteria 1616
345 Ga0207704_10301915 3300025938 Bacteria 1227
346 Ga0207665_10117859 3300025939 Bacteria 1873
347 Ga0207691_10006401 3300025940 Bacteria 11374
348 Ga0207691_10374699 3300025940 Bacteria 1215
349 Ga0207711_10021731 3300025941 Bacteria 5360
350 Ga0207711_10037051 3300025941 Bacteria 4141
351 Ga0207711_10383507 3300025941 Bacteria 1304
352 Ga0207711_11339957 3300025941 Bacteria 658
353 Ga0207689_10154897 3300025942 Bacteria 1889
354 Ga0207689_10203728 3300025942 Bacteria 1633
355 Ga0207689_10358764 3300025942 Bacteria 1212
356 Ga0207689_11196571 3300025942 Unclassified 640
357 Ga0207661_12166590 3300025944 Bacteria 502
358 Ga0207679_10131629 3300025945 Bacteria 2008
359 Ga0207679_10155612 3300025945 Bacteria 1866
360 Ga0207667_10011351 3300025949 Bacteria 10360
361 Ga0207667_10139451 3300025949 Bacteria 2496
362 Ga0207667_10275932 3300025949 Bacteria 1718
363 Ga0207651_10098854 3300025960 Bacteria 2159
364 Ga0207651_10131940 3300025960 Bacteria 1914
365 Ga0207668_10130335 3300025972 Bacteria 1919
366 Ga0207640_10029596 3300025981 Bacteria 3363
367 Ga0207640_10069773 3300025981 Bacteria 2361
368 Ga0207640_10123740 3300025981 Bacteria 1858
369 Ga0207640_10558153 3300025981 Bacteria 963
370 Ga0207640_10653140 3300025981 Bacteria 896
371 Ga0207640_11525181 3300025981 Unclassified 601
372 Ga0207658_10105428 3300025986 Bacteria 2217
373 Ga0207658_10209934 3300025986 Bacteria 1631
374 Ga0207658_10220671 3300025986 Bacteria 1595
375 Ga0207677_10922458 3300026023 Bacteria 788
376 Ga0207703_10196724 3300026035 Bacteria 1789
377 Ga0207703_10200804 3300026035 Bacteria 1772
378 Ga0207703_12256660 3300026035 Bacteria 520
379 Ga0207639_10000677 3300026041 Bacteria 23536
380 Ga0207639_10011910 3300026041 Bacteria 6050
381 Ga0207639_10076822 3300026041 Bacteria 2631
382 Ga0207639_10108899 3300026041 Bacteria 2253
383 Ga0207639_10157830 3300026041 Bacteria 1908
384 Ga0207639_10504227 3300026041 Bacteria 1106
385 Ga0207639_12158632 3300026041 Bacteria 518
386 Ga0207678_10008780 3300026067 Bacteria 8890
387 Ga0207678_10800936 3300026067 Bacteria 832
388 Ga0207702_10038458 3300026078 Bacteria 4007
389 Ga0207702_10107187 3300026078 Bacteria 2477
390 Ga0207702_10187556 3300026078 Bacteria 1908
391 Ga0207702_11016008 3300026078 Bacteria 823
392 Ga0207702_11057381 3300026078 Bacteria 805
393 Ga0207641_10201357 3300026088 Bacteria 1836
394 Ga0207641_10717756 3300026088 Bacteria 985
395 Ga0207648_10052227 3300026089 Bacteria 3574
396 Ga0207676_10005851 3300026095 Bacteria 8685
397 Ga0207674_10001063 3300026116 Bacteria 35707
398 Ga0207675_100610960 3300026118 Bacteria 1094
399 Ga0207683_10010399 3300026121 Bacteria 7937
400 Ga0207683_10086731 3300026121 Bacteria 2783
401 Ga0207698_10032088 3300026142 Bacteria 3801
402 Ga0207698_10035662 3300026142 Bacteria 3642
403 Ga0207698_10111151 3300026142 Bacteria 2297
404 Ga0207698_10343236 3300026142 Bacteria 1407
405 Ga0207698_10609518 3300026142 Bacteria 1077
406 Ga0207698_11232645 3300026142 Bacteria 762
407 Ga0268266_10878478 3300028379 Unclassified 867
408 Ga0268266_11724295 3300028379 Bacteria 601
409 Ga0268265_11166214 3300028380 Bacteria 767
410 Ga0268264_10005817 3300028381 Bacteria 10454
411 Ga0268264_10251770 3300028381 Bacteria 1641
412 Ga0268264_10907459 3300028381 Bacteria 884
413 Ga0265319_1015822 3300028563 Bacteria 2909
414 Ga0265334_10000382 3300028573 Bacteria 23721
415 Ga0265318_10001274 3300028577 Bacteria 15181
416 Ga0265338_10007834 3300028800 Bacteria 13126
417 Ga0265330_10009713 3300031235 Bacteria 4558
418 Ga0265332_10005222 3300031238 Bacteria 6009
419 Ga0265328_10075222 3300031239 Bacteria 1242
420 Ga0265320_10024409 3300031240 Unclassified 3197
421 Ga0265325_10015537 3300031241 Plasmid 4278
422 Ga0265329_10003497 3300031242 Bacteria 6819
423 Ga0265340_10027094 3300031247 Bacteria 2891
424 Ga0265340_10074088 3300031247 Bacteria 1610
425 Ga0265339_10038858 3300031249 Bacteria 2652
426 Ga0265331_10022059 3300031250 Bacteria 3251
427 Ga0265316_10025765 3300031344 Bacteria 4902
428 Ga0265313_10001323 3300031595 Bacteria 23327
429 Ga0307508_10431975 3300031616 Bacteria 909
430 Ga0265314_10001700 3300031711 Bacteria 23913
431 Ga0265342_10074396 3300031712 Bacteria 1973
432 Ga0307516_10022332 3300031730 Bacteria 6499
433 Ga0307516_10121219 3300031730 Bacteria 2405
434 Ga0307405_10085482 3300031731 Unclassified 2074
435 Ga0307409_102296735 3300031995 Unclassified 569
436 Ga0307416_100791770 3300032002 Unclassified 1043
437 Ga0307414_11577044 3300032004 Bacteria 612
438 Ga0373944_0017219 3300035089 Bacteria 2049
439 Ga0373951_0289890 3300035091 Bacteria 502
440 Ga0373939_0345818 3300035114 Bacteria 604
441 Ga0373955_0728616 3300035172 Bacteria 609
442 Ga0373962_0341069 3300035242 Unclassified 540
443 Ga0373927_0026714 3300035695 Bacteria 3773
444 Ga0373933_0213179 3300035724 Bacteria 1238
445 Ga0373933_1143229 3300035724 Bacteria 513
446 Ga0373937_0060919 3300036401 Bacteria 3469
447 Ga0373937_0827364 3300036401 Bacteria 874
448 Ga0373937_2112024 3300036401 Bacteria 509
449 Ga0373925_0114439 3300037068 Bacteria 2088
450 Ga0395900_0723081 3300037418 Bacteria 928
451 Ga0395898_0921850 3300037466 Bacteria 811
452 Ga0395905_0039348 3300037471 Bacteria 4436
453 Ga0395905_0282659 3300037471 Bacteria 1545
454 Ga0439436_0143599 3300041404 Bacteria 672
455 Ga0439461_0026411 3300041410 Bacteria 1184
456 Ga0451789_1207264 3300041443 Unclassified 631
457 Ga0451789_1245254 3300041443 Bacteria 1311
458 Ga0451791_1900911 3300041451 Bacteria 653
459 Ga0451793_1068317 3300041452 Bacteria 1824
460 Ga0451802_1126562 3300041460 Bacteria 1281
461 Ga0451835_0424047 3300041492 Bacteria 597
462 Ga0451853_3002975 3300041512 Unclassified 878
463 Ga0439432_056911 3300042006 Bacteria 1211
464 Ga0450892_017602 3300042130 Bacteria 680
465 Ga0439446_0001691 3300042156 Bacteria 5114
466 Ga0439434_0011963 3300042435 Bacteria 2564
467 Ga0439435_0065019 3300042436 Bacteria 1069
468 Ga0439464_0008079 3300042439 Bacteria 2759
469 Ga0451576_0716956 3300045051 Bacteria 1051
470 Ga0495592_0453828 3300046454 Bacteria 803
471 Ga0495580_0203665 3300046472 Bacteria 1363
472 Ga0495580_0328574 3300046472 Bacteria 1039
473 Ga0495582_0039275 3300046473 Bacteria 2606
474 Ga0495664_0030767 3300046477 Bacteria 3145
475 Ga0495628_0117503 3300046516 Bacteria 2042
476 Ga0495586_0065544 3300046535 Bacteria 1980
477 Ga0495586_0177840 3300046535 Unclassified 1203
478 Ga0495645_0030665 3300046543 Bacteria 3917
479 Ga0495647_0438914 3300046681 Bacteria 603
480 Ga0495658_0007304 3300046683 Bacteria 5460
481 Ga0495674_0318176 3300047319 Bacteria 1268
482 Ga0495676_0609252 3300047321 Bacteria 711
483 Ga0495684_0759877 3300047471 Bacteria 637
484 Ga0496104_0000016 3300048907 Bacteria 335025
485 Ga0496105_0000010 3300048908 Bacteria 309880
486 Ga0496106_0332564 3300048909 Bacteria 1220
487 Ga0496117_0106840 3300048920 Bacteria 1755
488 Ga0496118_0006022 3300048921 Bacteria 13511
489 Ga0496126_0780083 3300048929 Bacteria 735
490 Ga0501031_0001252 3300049568 Bacteria 15563
491 Ga0501031_0140612 3300049568 Bacteria 1578
492 Ga0501032_0006457 3300049569 Bacteria 8623
493 Ga0501032_0007845 3300049569 Bacteria 7776
494 Ga0501032_0099742 3300049569 Bacteria 1924
495 Ga0501033_0204340 3300049570 Bacteria 1410
496 Ga0501033_0229226 3300049570 Bacteria 1320
497 Ga0501034_0000923 3300049571 Bacteria 42924
498 Ga0501034_0001491 3300049571 Bacteria 30825
499 Ga0501034_0002559 3300049571 Bacteria 21676
500 Ga0501034_0003599 3300049571 Bacteria 17586
501 Ga0501034_0010554 3300049571 Bacteria 9615
502 Ga0501034_0504307 3300049571 Bacteria 1124
503 Ga0501036_0014087 3300049572 Bacteria 6646
504 Ga0501036_0028103 3300049572 Bacteria 4755
505 Ga0501037_0006310 3300049573 Bacteria 8673
506 Ga0501037_0083577 3300049573 Bacteria 2313
507 Ga0501037_0189290 3300049573 Bacteria 1457
508 Ga0501037_0467309 3300049573 Bacteria 859
509 Ga0501038_0001341 3300049574 Bacteria 22396
510 Ga0501038_0003381 3300049574 Bacteria 14873
511 Ga0501038_0242783 3300049574 Bacteria 1429
512 Ga0501038_0300176 3300049574 Bacteria 1261
513 Ga0501039_0017771 3300049575 Bacteria 5455
514 Ga0501042_0228635 3300049578 Bacteria 1342
515 Ga0501042_0733834 3300049578 Bacteria 718
516 Ga0501043_0006766 3300049579 Bacteria 9154
517 Ga0501043_0071732 3300049579 Bacteria 2720
518 Ga0501043_0083343 3300049579 Bacteria 2514
519 Ga0501043_0181532 3300049579 Bacteria 1639
520 Ga0501043_0943949 3300049579 Bacteria 616
521 Ga0501046_0183151 3300049580 Bacteria 1565
522 Ga0501046_0191909 3300049580 Bacteria 1523
523 Ga0501046_1134160 3300049580 Bacteria 539
524 Ga0501047_0000595 3300049581 Bacteria 38475
525 Ga0501047_0003974 3300049581 Bacteria 13903
526 Ga0501047_0013119 3300049581 Bacteria 7848
527 Ga0501047_0064445 3300049581 Bacteria 3534
528 Ga0501047_0082590 3300049581 Bacteria 3088
529 Ga0501047_0329993 3300049581 Bacteria 1364
530 Ga0501067_0000144 3300049583 Bacteria 39618
531 Ga0501067_0373704 3300049583 Bacteria 795
532 Ga0501068_0001199 3300049584 Bacteria 13793
533 Ga0501068_0227222 3300049584 Bacteria 1186
534 Ga0501068_0415538 3300049584 Bacteria 868
535 Ga0501069_0006012 3300049585 Bacteria 6334
536 Ga0501069_0308199 3300049585 Bacteria 929
537 Ga0501070_0001010 3300049586 Bacteria 25228
538 Ga0501070_0003066 3300049586 Bacteria 14548
539 Ga0501070_0015472 3300049586 Bacteria 6417
540 Ga0501070_0247823 3300049586 Bacteria 1457
541 Ga0501070_1123612 3300049586 Unclassified 605
542 Ga0501071_0172013 3300049587 Bacteria 1621
543 Ga0501072_0001429 3300049588 Bacteria 17889
544 Ga0501073_0009880 3300049589 Bacteria 7022
545 Ga0501073_0018135 3300049589 Bacteria 5087
546 Ga0501073_0044855 3300049589 Bacteria 3116
547 Ga0501073_0443259 3300049589 Bacteria 897
548 Ga0501074_0001889 3300049590 Bacteria 14390
549 Ga0501074_0029954 3300049590 Bacteria 3944
550 Ga0501074_0058025 3300049590 Bacteria 2788
551 Ga0501074_0157097 3300049590 Bacteria 1624
552 Ga0501076_1393938 3300049592 Bacteria 576
553 Ga0501079_0014655 3300049741 Bacteria 5978
554 Ga0501079_0068466 3300049741 Bacteria 2740
555 Ga0501079_0434614 3300049741 Bacteria 1030
556 Ga0501080_0000287 3300049742 Bacteria 38182
557 Ga0501080_0006631 3300049742 Bacteria 10412
558 Ga0501080_0018114 3300049742 Bacteria 6520
559 Ga0501080_0042144 3300049742 Bacteria 4252
560 Ga0501080_0081702 3300049742 Bacteria 3001
561 Ga0501080_0104707 3300049742 Bacteria 2624
562 Ga0501080_0253910 3300049742 Bacteria 1603
563 Ga0501080_0574573 3300049742 Bacteria 1002
564 Ga0501080_0642476 3300049742 Bacteria 939
565 Ga0501083_0000432 3300049744 Bacteria 26907
566 Ga0501083_0352072 3300049744 Bacteria 957
567 Ga0501035_0003375 3300049822 Bacteria 15277
568 Ga0501035_0117579 3300049822 Bacteria 2326
569 Ga0501035_0363117 3300049822 Bacteria 1210
570 Ga0501035_0453675 3300049822 Bacteria 1060
571 Ga0501035_0849303 3300049822 Bacteria 726
572 Ga0501044_0003724 3300049823 Bacteria 17136
573 Ga0501044_0012519 3300049823 Bacteria 9187
574 Ga0501044_0048721 3300049823 Bacteria 4375
575 Ga0501044_0050777 3300049823 Bacteria 4278
576 Ga0501044_0809958 3300049823 Bacteria 815
577 Ga0501044_1309717 3300049823 Bacteria 591
578 Ga0501045_0129400 3300049824 Bacteria 1876
579 Ga0501045_0421562 3300049824 Bacteria 993
580 Ga0501045_0936655 3300049824 Bacteria 636
581 nmdc:mga0k408_39917_c1 3300050493 Bacteria 2699
582 nmdc:mga06z11_194346_c1 3300050494 Bacteria 1176
583 nmdc:mga04h51_19027_c1 3300050495 Bacteria 2031
584 nmdc:mga07m45_66517_c1 3300050496 Bacteria 2048
585 nmdc:mga0n895_937279_c1 3300050512 Unclassified 850
586 nmdc:mga0rr50_362065_c1 3300050513 Bacteria 1221
587 nmdc:mga08x19_12435_c1 3300050514 Bacteria 5128
588 nmdc:mga0sz30_127518_c1 3300050516 Bacteria 1120
589 Ga0495601_0442072 3300053077 Bacteria 841
590 Ga0500566_0355859 3300053094 Unclassified 669
591 Ga0501084_1674920 3300054114 Unclassified 531
592 Ga0501082_0003807 3300060353 Bacteria 13196
593 Ga0501082_1078460 3300060353 Bacteria 702

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_362065_c1 nmdc:mga0rr50_362065_c1_903_1199 98
2 3300028563 Ga0265319_1015822 Ga0265319_10158223 101
3 3300028573 Ga0265334_10000382 Ga0265334_1000038219 101
4 3300028577 Ga0265318_10001274 Ga0265318_100012749 101
5 3300028800 Ga0265338_10007834 Ga0265338_100078349 101
6 3300031238 Ga0265332_10005222 Ga0265332_100052223 101
7 3300031242 Ga0265329_10003497 Ga0265329_100034975 101
8 3300031249 Ga0265339_10038858 Ga0265339_100388583 101
9 3300031250 Ga0265331_10022059 Ga0265331_100220594 101
10 3300031344 Ga0265316_10025765 Ga0265316_100257655 101
11 3300031595 Ga0265313_10001323 Ga0265313_1000132319 101
12 3300031712 Ga0265342_10074396 Ga0265342_100743963 101
13 3300049587 Ga0501071_0172013 Ga0501071_0172013_15_332 101
14 iso_pu_bacteria 2643221559 2643816416 101
15 iso_pu_bacteria 2643221586 2643938902 101
16 iso_pu_bacteria 2643221612 2644077355 101
17 iso_pu_bacteria 2643221727 2644694335 101
18 iso_pu_bacteria 2687453130 2687583947 101
19 3300005329 Ga0070683_101687160 Ga0070683_1016871601 103
20 3300005339 Ga0070660_101720914 Ga0070660_1017209141 103
21 3300005344 Ga0070661_100005961 Ga0070661_10000596111 103
22 3300005539 Ga0068853_100040081 Ga0068853_1000400813 103
23 3300005563 Ga0068855_100176616 Ga0068855_1001766162 103
24 3300005578 Ga0068854_100155344 Ga0068854_1001553443 103
25 3300005614 Ga0068856_100022479 Ga0068856_1000224796 103
26 3300005616 Ga0068852_100037199 Ga0068852_1000371994 103
27 3300009093 Ga0105240_10148066 Ga0105240_101480663 103
28 3300009174 Ga0105241_10027430 Ga0105241_100274303 103
29 3300009177 Ga0105248_10056463 Ga0105248_100564633 103
30 3300009545 Ga0105237_10010967 Ga0105237_100109679 103
31 3300009545 Ga0105237_10232300 Ga0105237_102323001 103
32 3300009551 Ga0105238_10014095 Ga0105238_1001409510 103
33 3300009553 Ga0105249_10834358 Ga0105249_108343581 103
34 3300010375 Ga0105239_10003753 Ga0105239_100037534 103
35 3300010375 Ga0105239_10142163 Ga0105239_101421634 103
36 3300013100 Ga0157373_10371493 Ga0157373_103714932 103
37 3300013104 Ga0157370_10038747 Ga0157370_100387474 103
38 3300013105 Ga0157369_10004991 Ga0157369_100049919 103
39 3300013105 Ga0157369_10285061 Ga0157369_102850612 103
40 3300013296 Ga0157374_10022440 Ga0157374_100224403 103
41 3300013297 Ga0157378_11250724 Ga0157378_112507242 103
42 3300013307 Ga0157372_10001339 Ga0157372_1000133914 103
43 3300013308 Ga0157375_10003810 Ga0157375_100038105 103
44 3300025911 Ga0207654_10114389 Ga0207654_101143891 103
45 3300025913 Ga0207695_10000295 Ga0207695_1000029523 103
46 3300025914 Ga0207671_10007489 Ga0207671_100074892 103
47 3300025919 Ga0207657_11006161 Ga0207657_110061611 103
48 3300025920 Ga0207649_10002226 Ga0207649_100022263 103
49 3300025924 Ga0207694_11126049 Ga0207694_111260491 103
50 3300025941 Ga0207711_10037051 Ga0207711_100370513 103
51 3300025942 Ga0207689_10154897 Ga0207689_101548971 103
52 3300025944 Ga0207661_12166590 Ga0207661_121665902 103
53 3300025949 Ga0207667_10139451 Ga0207667_101394512 103
54 3300025981 Ga0207640_10069773 Ga0207640_100697732 103
55 3300026041 Ga0207639_10000677 Ga0207639_1000067723 103
56 3300026078 Ga0207702_10187556 Ga0207702_101875563 103
57 3300026078 Ga0207702_11016008 Ga0207702_110160082 103
58 3300026142 Ga0207698_11232645 Ga0207698_112326452 103
59 3300036401 Ga0373937_0827364 Ga0373937_0827364_231_545 103
60 3300041410 Ga0439461_0026411 Ga0439461_0026411_748_1059 103
61 3300042156 Ga0439446_0001691 Ga0439446_0001691_2230_2541 103
62 3300042435 Ga0439434_0011963 Ga0439434_0011963_579_890 103
63 3300042436 Ga0439435_0065019 Ga0439435_0065019_360_671 103
64 3300005327 Ga0070658_11708990 Ga0070658_117089902 104
65 3300005329 Ga0070683_100011063 Ga0070683_1000110636 104
66 3300005330 Ga0070690_100138207 Ga0070690_1001382072 104
67 3300005334 Ga0068869_100045770 Ga0068869_1000457703 104
68 3300005336 Ga0070680_101437687 Ga0070680_1014376872 104
69 3300005337 Ga0070682_101698030 Ga0070682_1016980301 104
70 3300005339 Ga0070660_100171177 Ga0070660_1001711773 104
71 3300005344 Ga0070661_100064236 Ga0070661_1000642362 104
72 3300005355 Ga0070671_101172613 Ga0070671_1011726132 104
73 3300005366 Ga0070659_102044431 Ga0070659_1020444311 104
74 3300005367 Ga0070667_100016460 Ga0070667_1000164602 104
75 3300005458 Ga0070681_10440107 Ga0070681_104401073 104
76 3300005530 Ga0070679_100315630 Ga0070679_1003156303 104
77 3300005535 Ga0070684_100167390 Ga0070684_1001673902 104
78 3300005539 Ga0068853_100231778 Ga0068853_1002317782 104
79 3300005547 Ga0070693_100665219 Ga0070693_1006652191 104
80 3300005563 Ga0068855_101181093 Ga0068855_1011810932 104
81 3300005577 Ga0068857_100101392 Ga0068857_1001013922 104
82 3300005578 Ga0068854_100161259 Ga0068854_1001612593 104
83 3300005614 Ga0068856_100424535 Ga0068856_1004245352 104
84 3300005616 Ga0068852_100267619 Ga0068852_1002676192 104
85 3300005617 Ga0068859_101659496 Ga0068859_1016594962 104
86 3300005834 Ga0068851_10117736 Ga0068851_101177362 104
87 3300006881 Ga0068865_100337990 Ga0068865_1003379902 104
88 3300006931 Ga0097620_101659403 Ga0097620_1016594031 104
89 3300009093 Ga0105240_10132389 Ga0105240_101323893 104
90 3300009098 Ga0105245_10253709 Ga0105245_102537092 104
91 3300009174 Ga0105241_10022409 Ga0105241_100224098 104
92 3300009545 Ga0105237_10584177 Ga0105237_105841772 104
93 3300009551 Ga0105238_10078507 Ga0105238_100785072 104
94 3300010375 Ga0105239_11028667 Ga0105239_110286672 104
95 3300011119 Ga0105246_10021624 Ga0105246_100216247 104
96 3300013100 Ga0157373_10502838 Ga0157373_105028382 104
97 3300013102 Ga0157371_10454714 Ga0157371_104547142 104
98 3300013104 Ga0157370_10086784 Ga0157370_100867842 104
99 3300013105 Ga0157369_10076246 Ga0157369_100762464 104
100 3300013296 Ga0157374_10235137 Ga0157374_102351372 104
101 3300013307 Ga0157372_10233679 Ga0157372_102336792 104
102 3300014325 Ga0163163_11552399 Ga0163163_115523992 104
103 3300014497 Ga0182008_10687647 Ga0182008_106876471 104
104 3300014969 Ga0157376_10821108 Ga0157376_108211081 104
105 3300025321 Ga0207656_10247714 Ga0207656_102477142 104
106 3300025912 Ga0207707_10207949 Ga0207707_102079492 104
107 3300025913 Ga0207695_10206121 Ga0207695_102061212 104
108 3300025917 Ga0207660_10836034 Ga0207660_108360342 104
109 3300025919 Ga0207657_10002223 Ga0207657_1000222319 104
110 3300025920 Ga0207649_10028033 Ga0207649_100280333 104
111 3300025924 Ga0207694_10130893 Ga0207694_101308932 104
112 3300025927 Ga0207687_10396617 Ga0207687_103966173 104
113 3300025932 Ga0207690_10730415 Ga0207690_107304152 104
114 3300025933 Ga0207706_10156147 Ga0207706_101561472 104
115 3300025938 Ga0207704_10301915 Ga0207704_103019152 104
116 3300025942 Ga0207689_10203728 Ga0207689_102037282 104
117 3300025945 Ga0207679_10131629 Ga0207679_101316293 104
118 3300025949 Ga0207667_10275932 Ga0207667_102759322 104
119 3300025981 Ga0207640_10123740 Ga0207640_101237402 104
120 3300026023 Ga0207677_10922458 Ga0207677_109224582 104
121 3300026035 Ga0207703_12256660 Ga0207703_122566602 104
122 3300026041 Ga0207639_12158632 Ga0207639_121586321 104
123 3300026078 Ga0207702_11057381 Ga0207702_110573812 104
124 3300026116 Ga0207674_10001063 Ga0207674_100010634 104
125 3300026142 Ga0207698_10343236 Ga0207698_103432362 104
126 3300028380 Ga0268265_11166214 Ga0268265_111662142 104
127 3300049569 Ga0501032_0006457 Ga0501032_0006457_6288_6605 104
128 3300049570 Ga0501033_0204340 Ga0501033_0204340_444_761 104
129 3300049571 Ga0501034_0002559 Ga0501034_0002559_9189_9506 104
130 3300049571 Ga0501034_0003599 Ga0501034_0003599_6670_6996 104
131 3300049572 Ga0501036_0028103 Ga0501036_0028103_3605_3922 104
132 3300049573 Ga0501037_0083577 Ga0501037_0083577_762_1079 104
133 3300049574 Ga0501038_0003381 Ga0501038_0003381_943_1260 104
134 3300049579 Ga0501043_0083343 Ga0501043_0083343_830_1147 104
135 3300049581 Ga0501047_0000595 Ga0501047_0000595_25278_25595 104
136 3300049581 Ga0501047_0329993 Ga0501047_0329993_253_579 104
137 3300049583 Ga0501067_0000144 Ga0501067_0000144_25009_25326 104
138 3300049584 Ga0501068_0001199 Ga0501068_0001199_6372_6689 104
139 3300049585 Ga0501069_0006012 Ga0501069_0006012_5709_6026 104
140 3300049586 Ga0501070_0001010 Ga0501070_0001010_14451_14768 104
141 3300049588 Ga0501072_0001429 Ga0501072_0001429_11486_11803 104
142 3300049589 Ga0501073_0009880 Ga0501073_0009880_6372_6689 104
143 3300049590 Ga0501074_0001889 Ga0501074_0001889_5389_5706 104
144 3300049741 Ga0501079_0014655 Ga0501079_0014655_324_641 104
145 3300049742 Ga0501080_0000287 Ga0501080_0000287_27277_27594 104
146 3300049744 Ga0501083_0000432 Ga0501083_0000432_19175_19492 104
147 3300049822 Ga0501035_0363117 Ga0501035_0363117_851_1168 104
148 3300049823 Ga0501044_0012519 Ga0501044_0012519_6240_6557 104
149 3300049824 Ga0501045_0936655 Ga0501045_0936655_294_611 104
150 3300054114 Ga0501084_1674920 Ga0501084_1674920_42_359 104
151 3300060353 Ga0501082_0003807 Ga0501082_0003807_339_656 104
152 3300005439 Ga0070711_101395388 Ga0070711_1013953882 105
153 3300005539 Ga0068853_100230148 Ga0068853_1002301481 105
154 3300005546 Ga0070696_100134573 Ga0070696_1001345732 105
155 3300005547 Ga0070693_100247271 Ga0070693_1002472711 105
156 3300005614 Ga0068856_100102646 Ga0068856_1001026463 105
157 3300005616 Ga0068852_100815085 Ga0068852_1008150851 105
158 3300006358 Ga0068871_101451400 Ga0068871_1014514001 105
159 3300009174 Ga0105241_11349916 Ga0105241_113499161 105
160 3300009177 Ga0105248_10532460 Ga0105248_105324603 105
161 3300009545 Ga0105237_11823929 Ga0105237_118239292 105
162 3300010375 Ga0105239_10648722 Ga0105239_106487222 105
163 3300013104 Ga0157370_11080222 Ga0157370_110802221 105
164 3300015685 Ga0183369_1007 Ga0183369_1007238 105
165 3300025941 Ga0207711_10383507 Ga0207711_103835072 105
166 3300026041 Ga0207639_10504227 Ga0207639_105042271 105
167 3300026078 Ga0207702_10038458 Ga0207702_100384584 105
168 3300031235 Ga0265330_10009713 Ga0265330_100097134 105
169 3300031239 Ga0265328_10075222 Ga0265328_100752222 105
170 3300031240 Ga0265320_10024409 Ga0265320_100244092 105
171 3300031241 Ga0265325_10015537 Ga0265325_100155376 105
172 3300031247 Ga0265340_10074088 Ga0265340_100740882 105
173 3300031711 Ga0265314_10001700 Ga0265314_100017009 105
174 3300049586 Ga0501070_1123612 Ga0501070_1123612_145_489 105
175 3300049742 Ga0501080_0253910 Ga0501080_0253910_1169_1513 105
176 3300049822 Ga0501035_0117579 Ga0501035_0117579_794_1138 105
177 3300049823 Ga0501044_0809958 Ga0501044_0809958_96_440 105
178 3300049823 Ga0501044_1309717 Ga0501044_1309717_190_534 105
179 3300005330 Ga0070690_100115446 Ga0070690_1001154462 106
180 3300006237 Ga0097621_100090608 Ga0097621_1000906083 106
181 3300006358 Ga0068871_100190250 Ga0068871_1001902502 106
182 3300009098 Ga0105245_10140723 Ga0105245_101407233 106
183 3300009174 Ga0105241_10017869 Ga0105241_100178695 106
184 3300010375 Ga0105239_10077290 Ga0105239_100772903 106
185 3300013105 Ga0157369_10000025 Ga0157369_10000025202 106
186 3300025911 Ga0207654_10004819 Ga0207654_100048193 106
187 3300025913 Ga0207695_10001580 Ga0207695_1000158031 106
188 3300025914 Ga0207671_10002240 Ga0207671_1000224012 106
189 3300025924 Ga0207694_10018235 Ga0207694_100182354 106
190 3300026041 Ga0207639_10157830 Ga0207639_101578302 106
191 3300037466 Ga0395898_0921850 Ga0395898_0921850_144_467 106
192 3300037471 Ga0395905_0039348 Ga0395905_0039348_898_1221 106
193 3300037471 Ga0395905_0282659 Ga0395905_0282659_1053_1376 106
194 3300042130 Ga0450892_017602 Ga0450892_017602_35_358 106
195 3300042439 Ga0439464_0008079 Ga0439464_0008079_1462_1785 106
196 3300045051 Ga0451576_0716956 Ga0451576_0716956_411_731 106
197 3300049568 Ga0501031_0001252 Ga0501031_0001252_10939_11271 106
198 3300049569 Ga0501032_0007845 Ga0501032_0007845_3949_4281 106
199 3300049570 Ga0501033_0229226 Ga0501033_0229226_931_1263 106
200 3300049571 Ga0501034_0010554 Ga0501034_0010554_2240_2572 106
201 3300049572 Ga0501036_0014087 Ga0501036_0014087_3514_3846 106
202 3300049573 Ga0501037_0006310 Ga0501037_0006310_4186_4518 106
203 3300049574 Ga0501038_0001341 Ga0501038_0001341_16889_17221 106
204 3300049575 Ga0501039_0017771 Ga0501039_0017771_3794_4126 106
205 3300049579 Ga0501043_0006766 Ga0501043_0006766_4430_4762 106
206 3300049580 Ga0501046_1134160 Ga0501046_1134160_157_489 106
207 3300049581 Ga0501047_0064445 Ga0501047_0064445_565_897 106
208 3300049584 Ga0501068_0415538 Ga0501068_0415538_159_491 106
209 3300049589 Ga0501073_0018135 Ga0501073_0018135_290_622 106
210 3300049742 Ga0501080_0018114 Ga0501080_0018114_4382_4714 106
211 3300049822 Ga0501035_0003375 Ga0501035_0003375_4613_4945 106
212 3300049823 Ga0501044_0003724 Ga0501044_0003724_7649_7981 106
213 3300005327 Ga0070658_10272390 Ga0070658_102723902 107
214 3300005327 Ga0070658_10397193 Ga0070658_103971931 107
215 3300005328 Ga0070676_10131889 Ga0070676_101318893 107
216 3300005331 Ga0070670_100904456 Ga0070670_1009044561 107
217 3300005334 Ga0068869_100597922 Ga0068869_1005979222 107
218 3300005334 Ga0068869_100841932 Ga0068869_1008419322 107
219 3300005334 Ga0068869_101534036 Ga0068869_1015340361 107
220 3300005335 Ga0070666_10000636 Ga0070666_100006365 107
221 3300005335 Ga0070666_10090072 Ga0070666_100900722 107
222 3300005335 Ga0070666_10119052 Ga0070666_101190521 107
223 3300005335 Ga0070666_10414349 Ga0070666_104143492 107
224 3300005335 Ga0070666_10666063 Ga0070666_106660631 107
225 3300005335 Ga0070666_10897491 Ga0070666_108974911 107
226 3300005336 Ga0070680_100923196 Ga0070680_1009231962 107
227 3300005337 Ga0070682_100129892 Ga0070682_1001298923 107
228 3300005338 Ga0068868_100277032 Ga0068868_1002770321 107
229 3300005339 Ga0070660_100135060 Ga0070660_1001350602 107
230 3300005339 Ga0070660_100625648 Ga0070660_1006256481 107
231 3300005340 Ga0070689_100278762 Ga0070689_1002787621 107
232 3300005343 Ga0070687_101121461 Ga0070687_1011214611 107
233 3300005344 Ga0070661_100069182 Ga0070661_1000691823 107
234 3300005344 Ga0070661_100087023 Ga0070661_1000870233 107
235 3300005344 Ga0070661_101930491 Ga0070661_1019304911 107
236 3300005347 Ga0070668_100156308 Ga0070668_1001563081 107
237 3300005347 Ga0070668_100626179 Ga0070668_1006261792 107
238 3300005353 Ga0070669_100023581 Ga0070669_1000235811 107
239 3300005353 Ga0070669_100285666 Ga0070669_1002856663 107
240 3300005354 Ga0070675_100045154 Ga0070675_1000451542 107
241 3300005354 Ga0070675_100127202 Ga0070675_1001272022 107
242 3300005355 Ga0070671_100009336 Ga0070671_1000093365 107
243 3300005355 Ga0070671_101163552 Ga0070671_1011635521 107
244 3300005356 Ga0070674_100077403 Ga0070674_1000774032 107
245 3300005356 Ga0070674_100197236 Ga0070674_1001972362 107
246 3300005356 Ga0070674_100298242 Ga0070674_1002982421 107
247 3300005364 Ga0070673_100095936 Ga0070673_1000959363 107
248 3300005364 Ga0070673_100166769 Ga0070673_1001667693 107
249 3300005365 Ga0070688_101450386 Ga0070688_1014503861 107
250 3300005366 Ga0070659_100017290 Ga0070659_1000172902 107
251 3300005366 Ga0070659_100126317 Ga0070659_1001263173 107
252 3300005367 Ga0070667_100048576 Ga0070667_1000485763 107
253 3300005367 Ga0070667_100478705 Ga0070667_1004787052 107
254 3300005406 Ga0070703_10583580 Ga0070703_105835801 107
255 3300005434 Ga0070709_10069274 Ga0070709_100692744 107
256 3300005435 Ga0070714_100005304 Ga0070714_1000053043 107
257 3300005436 Ga0070713_100011691 Ga0070713_1000116917 107
258 3300005437 Ga0070710_10041319 Ga0070710_100413192 107
259 3300005439 Ga0070711_100445960 Ga0070711_1004459602 107
260 3300005440 Ga0070705_100103281 Ga0070705_1001032811 107
261 3300005440 Ga0070705_100195073 Ga0070705_1001950733 107
262 3300005444 Ga0070694_100455891 Ga0070694_1004558912 107
263 3300005445 Ga0070708_100134519 Ga0070708_1001345193 107
264 3300005445 Ga0070708_100139381 Ga0070708_1001393815 107
265 3300005445 Ga0070708_100444039 Ga0070708_1004440392 107
266 3300005445 Ga0070708_100920982 Ga0070708_1009209822 107
267 3300005455 Ga0070663_100021261 Ga0070663_1000212614 107
268 3300005455 Ga0070663_100843328 Ga0070663_1008433282 107
269 3300005455 Ga0070663_101505556 Ga0070663_1015055561 107
270 3300005456 Ga0070678_100022303 Ga0070678_1000223033 107
271 3300005456 Ga0070678_100856209 Ga0070678_1008562092 107
272 3300005457 Ga0070662_100000154 Ga0070662_10000015435 107
273 3300005458 Ga0070681_10069911 Ga0070681_100699113 107
274 3300005458 Ga0070681_11156033 Ga0070681_111560331 107
275 3300005459 Ga0068867_100220338 Ga0068867_1002203382 107
276 3300005466 Ga0070685_10000386 Ga0070685_1000038617 107
277 3300005466 Ga0070685_11031465 Ga0070685_110314651 107
278 3300005467 Ga0070706_100002053 Ga0070706_10000205311 107
279 3300005467 Ga0070706_100028768 Ga0070706_1000287689 107
280 3300005467 Ga0070706_100047930 Ga0070706_1000479305 107
281 3300005467 Ga0070706_100209714 Ga0070706_1002097142 107
282 3300005468 Ga0070707_100028231 Ga0070707_1000282313 107
283 3300005468 Ga0070707_100061402 Ga0070707_1000614025 107
284 3300005468 Ga0070707_100147521 Ga0070707_1001475213 107
285 3300005468 Ga0070707_100379822 Ga0070707_1003798222 107
286 3300005468 Ga0070707_101218694 Ga0070707_1012186941 107
287 3300005468 Ga0070707_101873536 Ga0070707_1018735361 107
288 3300005471 Ga0070698_100112361 Ga0070698_1001123612 107
289 3300005471 Ga0070698_100146183 Ga0070698_1001461833 107
290 3300005471 Ga0070698_100568989 Ga0070698_1005689892 107
291 3300005471 Ga0070698_100830500 Ga0070698_1008305002 107
292 3300005471 Ga0070698_101495844 Ga0070698_1014958442 107
293 3300005518 Ga0070699_100087009 Ga0070699_1000870092 107
294 3300005518 Ga0070699_101811505 Ga0070699_1018115051 107
295 3300005530 Ga0070679_100224296 Ga0070679_1002242964 107
296 3300005530 Ga0070679_100469610 Ga0070679_1004696102 107
297 3300005530 Ga0070679_100883029 Ga0070679_1008830291 107
298 3300005530 Ga0070679_101150169 Ga0070679_1011501692 107
299 3300005536 Ga0070697_100384743 Ga0070697_1003847433 107
300 3300005536 Ga0070697_100402652 Ga0070697_1004026521 107
301 3300005536 Ga0070697_100521067 Ga0070697_1005210672 107
302 3300005539 Ga0068853_100001874 Ga0068853_10000187412 107
303 3300005539 Ga0068853_100015663 Ga0068853_1000156633 107
304 3300005539 Ga0068853_100075241 Ga0068853_1000752416 107
305 3300005539 Ga0068853_100106557 Ga0068853_1001065573 107
306 3300005543 Ga0070672_100212236 Ga0070672_1002122363 107
307 3300005543 Ga0070672_100378111 Ga0070672_1003781112 107
308 3300005545 Ga0070695_100617066 Ga0070695_1006170661 107
309 3300005546 Ga0070696_100003306 Ga0070696_1000033064 107
310 3300005546 Ga0070696_100070656 Ga0070696_1000706562 107
311 3300005546 Ga0070696_101721397 Ga0070696_1017213972 107
312 3300005547 Ga0070693_100187558 Ga0070693_1001875582 107
313 3300005548 Ga0070665_100029190 Ga0070665_1000291903 107
314 3300005549 Ga0070704_100468253 Ga0070704_1004682532 107
315 3300005563 Ga0068855_100013724 Ga0068855_1000137247 107
316 3300005563 Ga0068855_102330044 Ga0068855_1023300441 107
317 3300005564 Ga0070664_100001161 Ga0070664_1000011612 107
318 3300005577 Ga0068857_100723888 Ga0068857_1007238882 107
319 3300005578 Ga0068854_100051915 Ga0068854_1000519153 107
320 3300005614 Ga0068856_100001030 Ga0068856_1000010307 107
321 3300005616 Ga0068852_100063380 Ga0068852_1000633803 107
322 3300005616 Ga0068852_100084085 Ga0068852_1000840853 107
323 3300005616 Ga0068852_100710113 Ga0068852_1007101132 107
324 3300005617 Ga0068859_100435086 Ga0068859_1004350863 107
325 3300005618 Ga0068864_100046469 Ga0068864_1000464697 107
326 3300005719 Ga0068861_100531705 Ga0068861_1005317052 107
327 3300005834 Ga0068851_10022844 Ga0068851_100228443 107
328 3300005840 Ga0068870_10041766 Ga0068870_100417661 107
329 3300005841 Ga0068863_100000329 Ga0068863_1000003296 107
330 3300005841 Ga0068863_100337055 Ga0068863_1003370553 107
331 3300005841 Ga0068863_100733872 Ga0068863_1007338722 107
332 3300005842 Ga0068858_100156266 Ga0068858_1001562662 107
333 3300005843 Ga0068860_100005962 Ga0068860_10000596210 107
334 3300005843 Ga0068860_101596453 Ga0068860_1015964532 107
335 3300006042 Ga0075368_10030922 Ga0075368_100309223 107
336 3300006048 Ga0075363_100324429 Ga0075363_1003244292 107
337 3300006173 Ga0070716_100141982 Ga0070716_1001419821 107
338 3300006178 Ga0075367_10042468 Ga0075367_100424682 107
339 3300006195 Ga0075366_10016688 Ga0075366_100166884 107
340 3300006237 Ga0097621_100181762 Ga0097621_1001817622 107
341 3300006237 Ga0097621_100892723 Ga0097621_1008927233 107
342 3300006353 Ga0075370_10004816 Ga0075370_100048165 107
343 3300006358 Ga0068871_100130524 Ga0068871_1001305242 107
344 3300006358 Ga0068871_100601522 Ga0068871_1006015221 107
345 3300006358 Ga0068871_101243385 Ga0068871_1012433852 107
346 3300006871 Ga0075434_101017625 Ga0075434_1010176251 107
347 3300006881 Ga0068865_100063178 Ga0068865_1000631781 107
348 3300006931 Ga0097620_100435122 Ga0097620_1004351223 107
349 3300009093 Ga0105240_10000453 Ga0105240_1000045326 107
350 3300009093 Ga0105240_11096088 Ga0105240_110960882 107
351 3300009101 Ga0105247_10553859 Ga0105247_105538592 107
352 3300009147 Ga0114129_10275039 Ga0114129_102750395 107
353 3300009174 Ga0105241_12012794 Ga0105241_120127941 107
354 3300009176 Ga0105242_10032861 Ga0105242_100328613 107
355 3300009176 Ga0105242_10596970 Ga0105242_105969702 107
356 3300009176 Ga0105242_10912695 Ga0105242_109126952 107
357 3300009177 Ga0105248_10139127 Ga0105248_101391272 107
358 3300009545 Ga0105237_11163351 Ga0105237_111633512 107
359 3300009551 Ga0105238_10013371 Ga0105238_100133716 107
360 3300010375 Ga0105239_10008231 Ga0105239_100082315 107
361 3300010375 Ga0105239_10147889 Ga0105239_101478892 107
362 3300010375 Ga0105239_12011044 Ga0105239_120110441 107
363 3300010375 Ga0105239_12393319 Ga0105239_123933191 107
364 3300011119 Ga0105246_10299250 Ga0105246_102992502 107
365 3300013102 Ga0157371_10537674 Ga0157371_105376742 107
366 3300013104 Ga0157370_10064504 Ga0157370_100645043 107
367 3300013104 Ga0157370_10132893 Ga0157370_101328932 107
368 3300013105 Ga0157369_10013038 Ga0157369_100130388 107
369 3300013105 Ga0157369_10323733 Ga0157369_103237332 107
370 3300013296 Ga0157374_10096901 Ga0157374_100969014 107
371 3300013297 Ga0157378_10000042 Ga0157378_1000004287 107
372 3300013297 Ga0157378_10326728 Ga0157378_103267282 107
373 3300013306 Ga0163162_10014416 Ga0163162_100144164 107
374 3300013306 Ga0163162_10344519 Ga0163162_103445192 107
375 3300013306 Ga0163162_10431279 Ga0163162_104312792 107
376 3300013306 Ga0163162_11327730 Ga0163162_113277302 107
377 3300013307 Ga0157372_10185107 Ga0157372_101851072 107
378 3300013307 Ga0157372_10415002 Ga0157372_104150022 107
379 3300013307 Ga0157372_11712346 Ga0157372_117123461 107
380 3300013308 Ga0157375_10001312 Ga0157375_100013128 107
381 3300013308 Ga0157375_10865063 Ga0157375_108650632 107
382 3300013308 Ga0157375_10943783 Ga0157375_109437833 107
383 3300014325 Ga0163163_10000589 Ga0163163_100005892 107
384 3300014325 Ga0163163_10037145 Ga0163163_100371453 107
385 3300014325 Ga0163163_10061254 Ga0163163_100612545 107
386 3300014968 Ga0157379_10000908 Ga0157379_1000090822 107
387 3300014968 Ga0157379_10037939 Ga0157379_100379395 107
388 3300014968 Ga0157379_10444677 Ga0157379_104446772 107
389 3300014969 Ga0157376_10002712 Ga0157376_100027127 107
390 3300014969 Ga0157376_10011163 Ga0157376_100111634 107
391 3300014969 Ga0157376_10712493 Ga0157376_107124932 107
392 3300014969 Ga0157376_11519898 Ga0157376_115198982 107
393 3300025885 Ga0207653_10166747 Ga0207653_101667472 107
394 3300025898 Ga0207692_10022970 Ga0207692_100229704 107
395 3300025898 Ga0207692_10639495 Ga0207692_106394952 107
396 3300025898 Ga0207692_10892490 Ga0207692_108924901 107
397 3300025903 Ga0207680_10073742 Ga0207680_100737422 107
398 3300025903 Ga0207680_10241176 Ga0207680_102411762 107
399 3300025903 Ga0207680_10384178 Ga0207680_103841782 107
400 3300025903 Ga0207680_10459526 Ga0207680_104595262 107
401 3300025906 Ga0207699_10041423 Ga0207699_100414232 107
402 3300025906 Ga0207699_10053262 Ga0207699_100532623 107
403 3300025906 Ga0207699_11024696 Ga0207699_110246961 107
404 3300025907 Ga0207645_10164774 Ga0207645_101647742 107
405 3300025908 Ga0207643_10007592 Ga0207643_100075924 107
406 3300025909 Ga0207705_10311711 Ga0207705_103117112 107
407 3300025910 Ga0207684_10002473 Ga0207684_100024739 107
408 3300025910 Ga0207684_10081385 Ga0207684_100813851 107
409 3300025910 Ga0207684_10155359 Ga0207684_101553592 107
410 3300025910 Ga0207684_10623371 Ga0207684_106233712 107
411 3300025911 Ga0207654_10214091 Ga0207654_102140912 107
412 3300025912 Ga0207707_10353790 Ga0207707_103537901 107
413 3300025912 Ga0207707_11367477 Ga0207707_113674771 107
414 3300025912 Ga0207707_11433951 Ga0207707_114339511 107
415 3300025913 Ga0207695_10000172 Ga0207695_10000172141 107
416 3300025914 Ga0207671_10854415 Ga0207671_108544152 107
417 3300025914 Ga0207671_11067904 Ga0207671_110679041 107
418 3300025914 Ga0207671_11377506 Ga0207671_113775062 107
419 3300025915 Ga0207693_10036438 Ga0207693_100364383 107
420 3300025916 Ga0207663_10519965 Ga0207663_105199651 107
421 3300025916 Ga0207663_10723546 Ga0207663_107235462 107
422 3300025917 Ga0207660_10284188 Ga0207660_102841882 107
423 3300025917 Ga0207660_10986309 Ga0207660_109863092 107
424 3300025919 Ga0207657_10000410 Ga0207657_1000041027 107
425 3300025922 Ga0207646_10029934 Ga0207646_100299343 107
426 3300025922 Ga0207646_10490522 Ga0207646_104905222 107
427 3300025922 Ga0207646_10556174 Ga0207646_105561742 107
428 3300025922 Ga0207646_10612296 Ga0207646_106122962 107
429 3300025922 Ga0207646_10692131 Ga0207646_106921312 107
430 3300025922 Ga0207646_11211680 Ga0207646_112116802 107
431 3300025922 Ga0207646_11326534 Ga0207646_113265342 107
432 3300025923 Ga0207681_10041657 Ga0207681_100416571 107
433 3300025923 Ga0207681_11273904 Ga0207681_112739041 107
434 3300025924 Ga0207694_10005258 Ga0207694_100052588 107
435 3300025925 Ga0207650_10261114 Ga0207650_102611142 107
436 3300025925 Ga0207650_10639639 Ga0207650_106396391 107
437 3300025926 Ga0207659_10220803 Ga0207659_102208032 107
438 3300025927 Ga0207687_10841326 Ga0207687_108413261 107
439 3300025928 Ga0207700_10108644 Ga0207700_101086443 107
440 3300025929 Ga0207664_10003726 Ga0207664_100037262 107
441 3300025931 Ga0207644_10173377 Ga0207644_101733773 107
442 3300025931 Ga0207644_11061952 Ga0207644_110619521 107
443 3300025932 Ga0207690_10011451 Ga0207690_100114513 107
444 3300025933 Ga0207706_10000508 Ga0207706_100005084 107
445 3300025934 Ga0207686_10016819 Ga0207686_100168192 107
446 3300025934 Ga0207686_10685019 Ga0207686_106850192 107
447 3300025936 Ga0207670_10821577 Ga0207670_108215771 107
448 3300025937 Ga0207669_11492295 Ga0207669_114922951 107
449 3300025938 Ga0207704_10042757 Ga0207704_100427571 107
450 3300025938 Ga0207704_10156433 Ga0207704_101564332 107
451 3300025939 Ga0207665_10117859 Ga0207665_101178593 107
452 3300025940 Ga0207691_10006401 Ga0207691_100064015 107
453 3300025940 Ga0207691_10374699 Ga0207691_103746993 107
454 3300025941 Ga0207711_10021731 Ga0207711_100217313 107
455 3300025941 Ga0207711_11339957 Ga0207711_113399572 107
456 3300025942 Ga0207689_10358764 Ga0207689_103587642 107
457 3300025942 Ga0207689_11196571 Ga0207689_111965712 107
458 3300025945 Ga0207679_10155612 Ga0207679_101556122 107
459 3300025949 Ga0207667_10011351 Ga0207667_100113513 107
460 3300025960 Ga0207651_10098854 Ga0207651_100988542 107
461 3300025960 Ga0207651_10131940 Ga0207651_101319402 107
462 3300025972 Ga0207668_10130335 Ga0207668_101303352 107
463 3300025981 Ga0207640_10029596 Ga0207640_100295963 107
464 3300025981 Ga0207640_10558153 Ga0207640_105581531 107
465 3300025981 Ga0207640_10653140 Ga0207640_106531402 107
466 3300025981 Ga0207640_11525181 Ga0207640_115251812 107
467 3300025986 Ga0207658_10105428 Ga0207658_101054283 107
468 3300025986 Ga0207658_10209934 Ga0207658_102099342 107
469 3300025986 Ga0207658_10220671 Ga0207658_102206712 107
470 3300026035 Ga0207703_10196724 Ga0207703_101967243 107
471 3300026035 Ga0207703_10200804 Ga0207703_102008043 107
472 3300026041 Ga0207639_10011910 Ga0207639_100119106 107
473 3300026041 Ga0207639_10076822 Ga0207639_100768223 107
474 3300026041 Ga0207639_10108899 Ga0207639_101088991 107
475 3300026067 Ga0207678_10008780 Ga0207678_100087808 107
476 3300026067 Ga0207678_10800936 Ga0207678_108009362 107
477 3300026078 Ga0207702_10107187 Ga0207702_101071872 107
478 3300026088 Ga0207641_10201357 Ga0207641_102013572 107
479 3300026088 Ga0207641_10717756 Ga0207641_107177562 107
480 3300026089 Ga0207648_10052227 Ga0207648_100522273 107
481 3300026095 Ga0207676_10005851 Ga0207676_1000585110 107
482 3300026118 Ga0207675_100610960 Ga0207675_1006109601 107
483 3300026121 Ga0207683_10010399 Ga0207683_100103995 107
484 3300026121 Ga0207683_10086731 Ga0207683_100867312 107
485 3300026142 Ga0207698_10032088 Ga0207698_100320882 107
486 3300026142 Ga0207698_10035662 Ga0207698_100356623 107
487 3300026142 Ga0207698_10111151 Ga0207698_101111512 107
488 3300026142 Ga0207698_10609518 Ga0207698_106095181 107
489 3300028379 Ga0268266_10878478 Ga0268266_108784782 107
490 3300028379 Ga0268266_11724295 Ga0268266_117242951 107
491 3300028381 Ga0268264_10005817 Ga0268264_1000581714 107
492 3300028381 Ga0268264_10251770 Ga0268264_102517702 107
493 3300028381 Ga0268264_10907459 Ga0268264_109074592 107
494 3300031247 Ga0265340_10027094 Ga0265340_100270944 107
495 3300031616 Ga0307508_10431975 Ga0307508_104319752 107
496 3300031730 Ga0307516_10022332 Ga0307516_100223324 107
497 3300031730 Ga0307516_10121219 Ga0307516_101212193 107
498 3300031731 Ga0307405_10085482 Ga0307405_100854822 107
499 3300031995 Ga0307409_102296735 Ga0307409_1022967351 107
500 3300032002 Ga0307416_100791770 Ga0307416_1007917701 107
501 3300032004 Ga0307414_11577044 Ga0307414_115770442 107
502 3300035089 Ga0373944_0017219 Ga0373944_0017219_526_855 107
503 3300035091 Ga0373951_0289890 Ga0373951_0289890_20_343 107
504 3300035114 Ga0373939_0345818 Ga0373939_0345818_250_588 107
505 3300035172 Ga0373955_0728616 Ga0373955_0728616_162_488 107
506 3300035242 Ga0373962_0341069 Ga0373962_0341069_50_388 107
507 3300035695 Ga0373927_0026714 Ga0373927_0026714_740_1063 107
508 3300035724 Ga0373933_0213179 Ga0373933_0213179_403_732 107
509 3300035724 Ga0373933_1143229 Ga0373933_1143229_171_494 107
510 3300036401 Ga0373937_0060919 Ga0373937_0060919_2140_2466 107
511 3300036401 Ga0373937_2112024 Ga0373937_2112024_158_481 107
512 3300037068 Ga0373925_0114439 Ga0373925_0114439_719_1042 107
513 3300037418 Ga0395900_0723081 Ga0395900_0723081_248_586 107
514 3300041404 Ga0439436_0143599 Ga0439436_0143599_251_595 107
515 3300041443 Ga0451789_1207264 Ga0451789_1207264_149_472 107
516 3300041443 Ga0451789_1245254 Ga0451789_1245254_304_630 107
517 3300041451 Ga0451791_1900911 Ga0451791_1900911_91_417 107
518 3300041452 Ga0451793_1068317 Ga0451793_1068317_750_1076 107
519 3300041460 Ga0451802_1126562 Ga0451802_1126562_644_970 107
520 3300041492 Ga0451835_0424047 Ga0451835_0424047_14_343 107
521 3300041512 Ga0451853_3002975 Ga0451853_3002975_304_633 107
522 3300042006 Ga0439432_056911 Ga0439432_056911_211_552 107
523 3300046454 Ga0495592_0453828 Ga0495592_0453828_94_423 107
524 3300046472 Ga0495580_0203665 Ga0495580_0203665_941_1270 107
525 3300046472 Ga0495580_0328574 Ga0495580_0328574_634_957 107
526 3300046473 Ga0495582_0039275 Ga0495582_0039275_826_1155 107
527 3300046477 Ga0495664_0030767 Ga0495664_0030767_2767_3090 107
528 3300046516 Ga0495628_0117503 Ga0495628_0117503_1370_1693 107
529 3300046535 Ga0495586_0065544 Ga0495586_0065544_931_1254 107
530 3300046535 Ga0495586_0177840 Ga0495586_0177840_468_797 107
531 3300046543 Ga0495645_0030665 Ga0495645_0030665_3527_3850 107
532 3300046681 Ga0495647_0438914 Ga0495647_0438914_179_508 107
533 3300046683 Ga0495658_0007304 Ga0495658_0007304_1602_1931 107
534 3300047319 Ga0495674_0318176 Ga0495674_0318176_852_1181 107
535 3300047321 Ga0495676_0609252 Ga0495676_0609252_366_695 107
536 3300047471 Ga0495684_0759877 Ga0495684_0759877_224_553 107
537 3300048907 Ga0496104_0000016 Ga0496104_0000016_102798_103127 107
538 3300048908 Ga0496105_0000010 Ga0496105_0000010_108502_108831 107
539 3300048909 Ga0496106_0332564 Ga0496106_0332564_326_649 107
540 3300048920 Ga0496117_0106840 Ga0496117_0106840_988_1314 107
541 3300048921 Ga0496118_0006022 Ga0496118_0006022_12064_12390 107
542 3300048929 Ga0496126_0780083 Ga0496126_0780083_121_447 107
543 3300049568 Ga0501031_0140612 Ga0501031_0140612_714_1040 107
544 3300049569 Ga0501032_0099742 Ga0501032_0099742_181_507 107
545 3300049571 Ga0501034_0000923 Ga0501034_0000923_24584_24949 107
546 3300049571 Ga0501034_0001491 Ga0501034_0001491_13692_14018 107
547 3300049571 Ga0501034_0504307 Ga0501034_0504307_746_1084 107
548 3300049573 Ga0501037_0189290 Ga0501037_0189290_375_722 107
549 3300049573 Ga0501037_0467309 Ga0501037_0467309_212_538 107
550 3300049574 Ga0501038_0242783 Ga0501038_0242783_736_1083 107
551 3300049574 Ga0501038_0300176 Ga0501038_0300176_69_395 107
552 3300049578 Ga0501042_0228635 Ga0501042_0228635_207_557 107
553 3300049578 Ga0501042_0733834 Ga0501042_0733834_257_604 107
554 3300049579 Ga0501043_0071732 Ga0501043_0071732_919_1245 107
555 3300049579 Ga0501043_0181532 Ga0501043_0181532_753_1100 107
556 3300049579 Ga0501043_0943949 Ga0501043_0943949_149_475 107
557 3300049580 Ga0501046_0183151 Ga0501046_0183151_1195_1545 107
558 3300049580 Ga0501046_0191909 Ga0501046_0191909_1051_1377 107
559 3300049581 Ga0501047_0003974 Ga0501047_0003974_8398_8724 107
560 3300049581 Ga0501047_0013119 Ga0501047_0013119_3205_3555 107
561 3300049581 Ga0501047_0082590 Ga0501047_0082590_2437_2763 107
562 3300049583 Ga0501067_0373704 Ga0501067_0373704_253_603 107
563 3300049584 Ga0501068_0227222 Ga0501068_0227222_175_522 107
564 3300049585 Ga0501069_0308199 Ga0501069_0308199_75_401 107
565 3300049586 Ga0501070_0003066 Ga0501070_0003066_8400_8726 107
566 3300049586 Ga0501070_0015472 Ga0501070_0015472_1449_1775 107
567 3300049586 Ga0501070_0247823 Ga0501070_0247823_375_722 107
568 3300049589 Ga0501073_0044855 Ga0501073_0044855_1227_1553 107
569 3300049589 Ga0501073_0443259 Ga0501073_0443259_375_722 107
570 3300049590 Ga0501074_0029954 Ga0501074_0029954_445_792 107
571 3300049590 Ga0501074_0058025 Ga0501074_0058025_918_1244 107
572 3300049590 Ga0501074_0157097 Ga0501074_0157097_564_890 107
573 3300049592 Ga0501076_1393938 Ga0501076_1393938_33_383 107
574 3300049741 Ga0501079_0068466 Ga0501079_0068466_1048_1374 107
575 3300049741 Ga0501079_0434614 Ga0501079_0434614_612_959 107
576 3300049742 Ga0501080_0006631 Ga0501080_0006631_8398_8724 107
577 3300049742 Ga0501080_0042144 Ga0501080_0042144_2492_2842 107
578 3300049742 Ga0501080_0081702 Ga0501080_0081702_1351_1677 107
579 3300049742 Ga0501080_0104707 Ga0501080_0104707_719_1057 107
580 3300049742 Ga0501080_0574573 Ga0501080_0574573_471_818 107
581 3300049742 Ga0501080_0642476 Ga0501080_0642476_233_583 107
582 3300049744 Ga0501083_0352072 Ga0501083_0352072_453_800 107
583 3300049822 Ga0501035_0453675 Ga0501035_0453675_379_729 107
584 3300049822 Ga0501035_0849303 Ga0501035_0849303_79_405 107
585 3300049823 Ga0501044_0048721 Ga0501044_0048721_3925_4275 107
586 3300049823 Ga0501044_0050777 Ga0501044_0050777_2756_3082 107
587 3300049824 Ga0501045_0129400 Ga0501045_0129400_99_446 107
588 3300049824 Ga0501045_0421562 Ga0501045_0421562_183_509 107
589 3300050493 nmdc:mga0k408_39917_c1 nmdc:mga0k408_39917_c1_897_1238 107
590 3300050494 nmdc:mga06z11_194346_c1 nmdc:mga06z11_194346_c1_569_910 107
591 3300050495 nmdc:mga04h51_19027_c1 nmdc:mga04h51_19027_c1_1513_1854 107
592 3300050496 nmdc:mga07m45_66517_c1 nmdc:mga07m45_66517_c1_193_534 107
593 3300050512 nmdc:mga0n895_937279_c1 nmdc:mga0n895_937279_c1_452_775 107
594 3300050514 nmdc:mga08x19_12435_c1 nmdc:mga08x19_12435_c1_1993_2316 107
595 3300050516 nmdc:mga0sz30_127518_c1 nmdc:mga0sz30_127518_c1_31_372 107
596 3300053077 Ga0495601_0442072 Ga0495601_0442072_286_609 107
597 3300053094 Ga0500566_0355859 Ga0500566_0355859_14_343 107
598 3300060353 Ga0501082_1078460 Ga0501082_1078460_357_683 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02641

DUF190

Uncharacterized ACR, COG1993

11

97

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.8711 1 102
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.8621 1 102
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8555 4 98
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.852 1 98
2dcl-assembly1.cif.gz_A-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8112 4 105
ID Description Score Start End Superfamily
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8712 1 102 3.30.70.120
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8619 1 102 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.852 1 98 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7786 1 98 3.30.70.120
af_P95087_243_367_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7754 2 103 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A522N5V7-F1-model_v4 DUF190 domain-containing protein 0.8867 1 107
AF-A0A522N5V7-F1-model_v4 DUF190 domain-containing protein 0.879 1 107
AF-A0A317MWU0-F1-model_v4 PII-like signaling protein 0.8753 1 105
AF-A0A6H9Y6R3-F1-model_v4 DUF190 domain-containing protein 0.8663 1 104
AF-A0A1G0BWK5-F1-model_v4 Uncharacterized protein 0.864 4 103

Feature Viewer

pLDDT pTM Quality
85.46 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map