F467820
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 274 | 593 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0000923|Ga0501034_0000923_24584_24949 |
| Length | 121 |
| Sequence | MTYGDQAMKGTHLRFYTYENRHTRGVPTYEWLLEQAKKLGIHGGSAFRAIAGYGRHGQLHEQHFFELAGEQPVLVEFIVDEGQAQALFALLRREEQALFYARLPAEFGVSNESDPGRGESA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 2 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 3 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 4 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 5 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 210 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 211 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 212 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 213 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 216 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 264 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.16 |
| Metatranscriptomes | 0 |
| Isolates | 0.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.84 |
| Nodule | 0 |
| Rhizoplane | 1.34 |
| Rhizosphere | 94.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10272390 | 3300005327 | Bacteria | 1440 |
| 2 | Ga0070658_10397193 | 3300005327 | Bacteria | 1184 |
| 3 | Ga0070658_11708990 | 3300005327 | Bacteria | 545 |
| 4 | Ga0070676_10131889 | 3300005328 | Bacteria | 1581 |
| 5 | Ga0070683_100011063 | 3300005329 | Bacteria | 7778 |
| 6 | Ga0070683_101687160 | 3300005329 | Bacteria | 609 |
| 7 | Ga0070690_100115446 | 3300005330 | Bacteria | 1796 |
| 8 | Ga0070690_100138207 | 3300005330 | Bacteria | 1652 |
| 9 | Ga0070670_100904456 | 3300005331 | Bacteria | 800 |
| 10 | Ga0068869_100045770 | 3300005334 | Bacteria | 3152 |
| 11 | Ga0068869_100597922 | 3300005334 | Bacteria | 931 |
| 12 | Ga0068869_100841932 | 3300005334 | Unclassified | 791 |
| 13 | Ga0068869_101534036 | 3300005334 | Bacteria | 592 |
| 14 | Ga0070666_10000636 | 3300005335 | Bacteria | 21149 |
| 15 | Ga0070666_10090072 | 3300005335 | Bacteria | 2106 |
| 16 | Ga0070666_10119052 | 3300005335 | Bacteria | 1830 |
| 17 | Ga0070666_10414349 | 3300005335 | Bacteria | 970 |
| 18 | Ga0070666_10666063 | 3300005335 | Bacteria | 762 |
| 19 | Ga0070666_10897491 | 3300005335 | Unclassified | 655 |
| 20 | Ga0070680_100923196 | 3300005336 | Unclassified | 753 |
| 21 | Ga0070680_101437687 | 3300005336 | Bacteria | 597 |
| 22 | Ga0070682_100129892 | 3300005337 | Bacteria | 1703 |
| 23 | Ga0070682_101698030 | 3300005337 | Bacteria | 548 |
| 24 | Ga0068868_100277032 | 3300005338 | Bacteria | 1419 |
| 25 | Ga0070660_100135060 | 3300005339 | Bacteria | 1976 |
| 26 | Ga0070660_100171177 | 3300005339 | Bacteria | 1754 |
| 27 | Ga0070660_100625648 | 3300005339 | Bacteria | 901 |
| 28 | Ga0070660_101720914 | 3300005339 | Bacteria | 534 |
| 29 | Ga0070689_100278762 | 3300005340 | Bacteria | 1386 |
| 30 | Ga0070687_101121461 | 3300005343 | Unclassified | 576 |
| 31 | Ga0070661_100005961 | 3300005344 | Bacteria | 8388 |
| 32 | Ga0070661_100064236 | 3300005344 | Bacteria | 2698 |
| 33 | Ga0070661_100069182 | 3300005344 | Bacteria | 2595 |
| 34 | Ga0070661_100087023 | 3300005344 | Bacteria | 2311 |
| 35 | Ga0070661_101930491 | 3300005344 | Unclassified | 502 |
| 36 | Ga0070668_100156308 | 3300005347 | Bacteria | 1848 |
| 37 | Ga0070668_100626179 | 3300005347 | Bacteria | 943 |
| 38 | Ga0070669_100023581 | 3300005353 | Bacteria | 4406 |
| 39 | Ga0070669_100285666 | 3300005353 | Bacteria | 1323 |
| 40 | Ga0070675_100045154 | 3300005354 | Bacteria | 3605 |
| 41 | Ga0070675_100127202 | 3300005354 | Bacteria | 2169 |
| 42 | Ga0070671_100009336 | 3300005355 | Bacteria | 7875 |
| 43 | Ga0070671_101163552 | 3300005355 | Bacteria | 678 |
| 44 | Ga0070671_101172613 | 3300005355 | Bacteria | 676 |
| 45 | Ga0070674_100077403 | 3300005356 | Bacteria | 2368 |
| 46 | Ga0070674_100197236 | 3300005356 | Bacteria | 1552 |
| 47 | Ga0070674_100298242 | 3300005356 | Bacteria | 1284 |
| 48 | Ga0070673_100095936 | 3300005364 | Bacteria | 2433 |
| 49 | Ga0070673_100166769 | 3300005364 | Bacteria | 1877 |
| 50 | Ga0070688_101450386 | 3300005365 | Unclassified | 557 |
| 51 | Ga0070659_100017290 | 3300005366 | Bacteria | 5423 |
| 52 | Ga0070659_100126317 | 3300005366 | Bacteria | 2075 |
| 53 | Ga0070659_102044431 | 3300005366 | Bacteria | 515 |
| 54 | Ga0070667_100016460 | 3300005367 | Bacteria | 6118 |
| 55 | Ga0070667_100048576 | 3300005367 | Bacteria | 3572 |
| 56 | Ga0070667_100478705 | 3300005367 | Bacteria | 1139 |
| 57 | Ga0070703_10583580 | 3300005406 | Unclassified | 514 |
| 58 | Ga0070709_10069274 | 3300005434 | Bacteria | 2271 |
| 59 | Ga0070714_100005304 | 3300005435 | Bacteria | 9823 |
| 60 | Ga0070713_100011691 | 3300005436 | Bacteria | 6404 |
| 61 | Ga0070710_10041319 | 3300005437 | Bacteria | 2546 |
| 62 | Ga0070711_100445960 | 3300005439 | Bacteria | 1059 |
| 63 | Ga0070711_101395388 | 3300005439 | Bacteria | 609 |
| 64 | Ga0070705_100103281 | 3300005440 | Bacteria | 1804 |
| 65 | Ga0070705_100195073 | 3300005440 | Unclassified | 1384 |
| 66 | Ga0070694_100455891 | 3300005444 | Unclassified | 1010 |
| 67 | Ga0070708_100134519 | 3300005445 | Bacteria | 2289 |
| 68 | Ga0070708_100139381 | 3300005445 | Bacteria | 2248 |
| 69 | Ga0070708_100444039 | 3300005445 | Unclassified | 1224 |
| 70 | Ga0070708_100920982 | 3300005445 | Bacteria | 820 |
| 71 | Ga0070663_100021261 | 3300005455 | Bacteria | 4313 |
| 72 | Ga0070663_100843328 | 3300005455 | Bacteria | 788 |
| 73 | Ga0070663_101505556 | 3300005455 | Bacteria | 598 |
| 74 | Ga0070678_100022303 | 3300005456 | Bacteria | 4193 |
| 75 | Ga0070678_100856209 | 3300005456 | Unclassified | 829 |
| 76 | Ga0070662_100000154 | 3300005457 | Bacteria | 39615 |
| 77 | Ga0070681_10069911 | 3300005458 | Bacteria | 3476 |
| 78 | Ga0070681_10440107 | 3300005458 | Bacteria | 1215 |
| 79 | Ga0070681_11156033 | 3300005458 | Unclassified | 695 |
| 80 | Ga0068867_100220338 | 3300005459 | Bacteria | 1529 |
| 81 | Ga0070685_10000386 | 3300005466 | Bacteria | 26505 |
| 82 | Ga0070685_11031465 | 3300005466 | Bacteria | 618 |
| 83 | Ga0070706_100002053 | 3300005467 | Bacteria | 20636 |
| 84 | Ga0070706_100028768 | 3300005467 | Bacteria | 5118 |
| 85 | Ga0070706_100047930 | 3300005467 | Bacteria | 3944 |
| 86 | Ga0070706_100209714 | 3300005467 | Bacteria | 1819 |
| 87 | Ga0070707_100028231 | 3300005468 | Bacteria | 5338 |
| 88 | Ga0070707_100061402 | 3300005468 | Bacteria | 3604 |
| 89 | Ga0070707_100147521 | 3300005468 | Bacteria | 2289 |
| 90 | Ga0070707_100379822 | 3300005468 | Unclassified | 1372 |
| 91 | Ga0070707_101218694 | 3300005468 | Unclassified | 719 |
| 92 | Ga0070707_101873536 | 3300005468 | Bacteria | 567 |
| 93 | Ga0070698_100112361 | 3300005471 | Bacteria | 2689 |
| 94 | Ga0070698_100146183 | 3300005471 | Bacteria | 2313 |
| 95 | Ga0070698_100568989 | 3300005471 | Bacteria | 1073 |
| 96 | Ga0070698_100830500 | 3300005471 | Bacteria | 868 |
| 97 | Ga0070698_101495844 | 3300005471 | Unclassified | 626 |
| 98 | Ga0070699_100087009 | 3300005518 | Bacteria | 2728 |
| 99 | Ga0070699_101811505 | 3300005518 | Unclassified | 559 |
| 100 | Ga0070679_100224296 | 3300005530 | Bacteria | 1840 |
| 101 | Ga0070679_100315630 | 3300005530 | Bacteria | 1512 |
| 102 | Ga0070679_100469610 | 3300005530 | Unclassified | 1202 |
| 103 | Ga0070679_100883029 | 3300005530 | Bacteria | 837 |
| 104 | Ga0070679_101150169 | 3300005530 | Bacteria | 721 |
| 105 | Ga0070684_100167390 | 3300005535 | Bacteria | 1995 |
| 106 | Ga0070697_100384743 | 3300005536 | Bacteria | 1215 |
| 107 | Ga0070697_100402652 | 3300005536 | Bacteria | 1188 |
| 108 | Ga0070697_100521067 | 3300005536 | Unclassified | 1041 |
| 109 | Ga0068853_100001874 | 3300005539 | Bacteria | 15481 |
| 110 | Ga0068853_100015663 | 3300005539 | Bacteria | 6228 |
| 111 | Ga0068853_100040081 | 3300005539 | Bacteria | 3995 |
| 112 | Ga0068853_100075241 | 3300005539 | Bacteria | 2947 |
| 113 | Ga0068853_100106557 | 3300005539 | Bacteria | 2484 |
| 114 | Ga0068853_100230148 | 3300005539 | Bacteria | 1695 |
| 115 | Ga0068853_100231778 | 3300005539 | Bacteria | 1689 |
| 116 | Ga0070672_100212236 | 3300005543 | Bacteria | 1621 |
| 117 | Ga0070672_100378111 | 3300005543 | Bacteria | 1211 |
| 118 | Ga0070695_100617066 | 3300005545 | Bacteria | 853 |
| 119 | Ga0070696_100003306 | 3300005546 | Bacteria | 10765 |
| 120 | Ga0070696_100070656 | 3300005546 | Bacteria | 2456 |
| 121 | Ga0070696_100134573 | 3300005546 | Bacteria | 1801 |
| 122 | Ga0070696_101721397 | 3300005546 | Bacteria | 541 |
| 123 | Ga0070693_100187558 | 3300005547 | Bacteria | 1335 |
| 124 | Ga0070693_100247271 | 3300005547 | Bacteria | 1181 |
| 125 | Ga0070693_100665219 | 3300005547 | Bacteria | 759 |
| 126 | Ga0070665_100029190 | 3300005548 | Bacteria | 5551 |
| 127 | Ga0070704_100468253 | 3300005549 | Bacteria | 1088 |
| 128 | Ga0068855_100013724 | 3300005563 | Bacteria | 9767 |
| 129 | Ga0068855_100176616 | 3300005563 | Bacteria | 2416 |
| 130 | Ga0068855_101181093 | 3300005563 | Bacteria | 796 |
| 131 | Ga0068855_102330044 | 3300005563 | Unclassified | 535 |
| 132 | Ga0070664_100001161 | 3300005564 | Bacteria | 20900 |
| 133 | Ga0068857_100101392 | 3300005577 | Bacteria | 2583 |
| 134 | Ga0068857_100723888 | 3300005577 | Bacteria | 946 |
| 135 | Ga0068854_100051915 | 3300005578 | Bacteria | 2939 |
| 136 | Ga0068854_100155344 | 3300005578 | Bacteria | 1767 |
| 137 | Ga0068854_100161259 | 3300005578 | Bacteria | 1737 |
| 138 | Ga0068856_100001030 | 3300005614 | Bacteria | 29686 |
| 139 | Ga0068856_100022479 | 3300005614 | Bacteria | 6131 |
| 140 | Ga0068856_100102646 | 3300005614 | Bacteria | 2853 |
| 141 | Ga0068856_100424535 | 3300005614 | Bacteria | 1349 |
| 142 | Ga0068852_100037199 | 3300005616 | Bacteria | 4078 |
| 143 | Ga0068852_100063380 | 3300005616 | Bacteria | 3219 |
| 144 | Ga0068852_100084085 | 3300005616 | Bacteria | 2831 |
| 145 | Ga0068852_100267619 | 3300005616 | Bacteria | 1643 |
| 146 | Ga0068852_100710113 | 3300005616 | Bacteria | 1016 |
| 147 | Ga0068852_100815085 | 3300005616 | Bacteria | 948 |
| 148 | Ga0068859_100435086 | 3300005617 | Bacteria | 1408 |
| 149 | Ga0068859_101659496 | 3300005617 | Bacteria | 706 |
| 150 | Ga0068864_100046469 | 3300005618 | Bacteria | 3725 |
| 151 | Ga0068861_100531705 | 3300005719 | Bacteria | 1068 |
| 152 | Ga0068851_10022844 | 3300005834 | Bacteria | 3053 |
| 153 | Ga0068851_10117736 | 3300005834 | Bacteria | 1425 |
| 154 | Ga0068870_10041766 | 3300005840 | Bacteria | 2385 |
| 155 | Ga0068863_100000329 | 3300005841 | Bacteria | 48080 |
| 156 | Ga0068863_100337055 | 3300005841 | Bacteria | 1467 |
| 157 | Ga0068863_100733872 | 3300005841 | Bacteria | 983 |
| 158 | Ga0068858_100156266 | 3300005842 | Bacteria | 2146 |
| 159 | Ga0068860_100005962 | 3300005843 | Bacteria | 12260 |
| 160 | Ga0068860_101596453 | 3300005843 | Bacteria | 674 |
| 161 | Ga0075368_10030922 | 3300006042 | Bacteria | 2075 |
| 162 | Ga0075363_100324429 | 3300006048 | Bacteria | 896 |
| 163 | Ga0070716_100141982 | 3300006173 | Bacteria | 1533 |
| 164 | Ga0075367_10042468 | 3300006178 | Bacteria | 2660 |
| 165 | Ga0075366_10016688 | 3300006195 | Bacteria | 4221 |
| 166 | Ga0097621_100090608 | 3300006237 | Bacteria | 2559 |
| 167 | Ga0097621_100181762 | 3300006237 | Bacteria | 1817 |
| 168 | Ga0097621_100892723 | 3300006237 | Bacteria | 827 |
| 169 | Ga0075370_10004816 | 3300006353 | Bacteria | 6609 |
| 170 | Ga0068871_100130524 | 3300006358 | Bacteria | 2130 |
| 171 | Ga0068871_100190250 | 3300006358 | Bacteria | 1768 |
| 172 | Ga0068871_100601522 | 3300006358 | Bacteria | 1000 |
| 173 | Ga0068871_101243385 | 3300006358 | Bacteria | 699 |
| 174 | Ga0068871_101451400 | 3300006358 | Unclassified | 647 |
| 175 | Ga0075434_101017625 | 3300006871 | Unclassified | 842 |
| 176 | Ga0068865_100063178 | 3300006881 | Bacteria | 2602 |
| 177 | Ga0068865_100337990 | 3300006881 | Bacteria | 1216 |
| 178 | Ga0097620_100435122 | 3300006931 | Bacteria | 1408 |
| 179 | Ga0097620_101659403 | 3300006931 | Bacteria | 706 |
| 180 | Ga0105240_10000453 | 3300009093 | Bacteria | 75454 |
| 181 | Ga0105240_10132389 | 3300009093 | Bacteria | 2990 |
| 182 | Ga0105240_10148066 | 3300009093 | Bacteria | 2799 |
| 183 | Ga0105240_11096088 | 3300009093 | Bacteria | 847 |
| 184 | Ga0105245_10140723 | 3300009098 | Unclassified | 2272 |
| 185 | Ga0105245_10253709 | 3300009098 | Bacteria | 1710 |
| 186 | Ga0105247_10553859 | 3300009101 | Bacteria | 846 |
| 187 | Ga0114129_10275039 | 3300009147 | Bacteria | 2252 |
| 188 | Ga0105241_10017869 | 3300009174 | Bacteria | 5216 |
| 189 | Ga0105241_10022409 | 3300009174 | Bacteria | 4679 |
| 190 | Ga0105241_10027430 | 3300009174 | Bacteria | 4241 |
| 191 | Ga0105241_11349916 | 3300009174 | Bacteria | 681 |
| 192 | Ga0105241_12012794 | 3300009174 | Bacteria | 569 |
| 193 | Ga0105242_10032861 | 3300009176 | Bacteria | 4151 |
| 194 | Ga0105242_10596970 | 3300009176 | Bacteria | 1066 |
| 195 | Ga0105242_10912695 | 3300009176 | Unclassified | 879 |
| 196 | Ga0105248_10056463 | 3300009177 | Bacteria | 4405 |
| 197 | Ga0105248_10139127 | 3300009177 | Bacteria | 2738 |
| 198 | Ga0105248_10532460 | 3300009177 | Bacteria | 1325 |
| 199 | Ga0105237_10010967 | 3300009545 | Bacteria | 9616 |
| 200 | Ga0105237_10232300 | 3300009545 | Bacteria | 1845 |
| 201 | Ga0105237_10584177 | 3300009545 | Bacteria | 1124 |
| 202 | Ga0105237_11163351 | 3300009545 | Bacteria | 778 |
| 203 | Ga0105237_11823929 | 3300009545 | Bacteria | 616 |
| 204 | Ga0105238_10013371 | 3300009551 | Bacteria | 8283 |
| 205 | Ga0105238_10014095 | 3300009551 | Bacteria | 8083 |
| 206 | Ga0105238_10078507 | 3300009551 | Bacteria | 3291 |
| 207 | Ga0105249_10834358 | 3300009553 | Bacteria | 987 |
| 208 | Ga0105239_10003753 | 3300010375 | Bacteria | 18491 |
| 209 | Ga0105239_10008231 | 3300010375 | Bacteria | 11895 |
| 210 | Ga0105239_10077290 | 3300010375 | Bacteria | 3663 |
| 211 | Ga0105239_10142163 | 3300010375 | Bacteria | 2675 |
| 212 | Ga0105239_10147889 | 3300010375 | Bacteria | 2621 |
| 213 | Ga0105239_10648722 | 3300010375 | Bacteria | 1206 |
| 214 | Ga0105239_11028667 | 3300010375 | Bacteria | 947 |
| 215 | Ga0105239_12011044 | 3300010375 | Bacteria | 671 |
| 216 | Ga0105239_12393319 | 3300010375 | Bacteria | 615 |
| 217 | Ga0105246_10021624 | 3300011119 | Bacteria | 4141 |
| 218 | Ga0105246_10299250 | 3300011119 | Bacteria | 1298 |
| 219 | Ga0157373_10371493 | 3300013100 | Bacteria | 1022 |
| 220 | Ga0157373_10502838 | 3300013100 | Bacteria | 876 |
| 221 | Ga0157371_10454714 | 3300013102 | Bacteria | 942 |
| 222 | Ga0157371_10537674 | 3300013102 | Bacteria | 865 |
| 223 | Ga0157370_10038747 | 3300013104 | Bacteria | 4609 |
| 224 | Ga0157370_10064504 | 3300013104 | Bacteria | 3468 |
| 225 | Ga0157370_10086784 | 3300013104 | Bacteria | 2939 |
| 226 | Ga0157370_10132893 | 3300013104 | Bacteria | 2321 |
| 227 | Ga0157370_11080222 | 3300013104 | Bacteria | 725 |
| 228 | Ga0157369_10000025 | 3300013105 | Bacteria | 225515 |
| 229 | Ga0157369_10004991 | 3300013105 | Bacteria | 15535 |
| 230 | Ga0157369_10013038 | 3300013105 | Bacteria | 9414 |
| 231 | Ga0157369_10076246 | 3300013105 | Bacteria | 3594 |
| 232 | Ga0157369_10285061 | 3300013105 | Bacteria | 1720 |
| 233 | Ga0157369_10323733 | 3300013105 | Bacteria | 1602 |
| 234 | Ga0157374_10022440 | 3300013296 | Bacteria | 5631 |
| 235 | Ga0157374_10096901 | 3300013296 | Bacteria | 2821 |
| 236 | Ga0157374_10235137 | 3300013296 | Bacteria | 1801 |
| 237 | Ga0157378_10000042 | 3300013297 | Bacteria | 107945 |
| 238 | Ga0157378_10326728 | 3300013297 | Bacteria | 1492 |
| 239 | Ga0157378_11250724 | 3300013297 | Bacteria | 783 |
| 240 | Ga0163162_10014416 | 3300013306 | Bacteria | 7724 |
| 241 | Ga0163162_10344519 | 3300013306 | Bacteria | 1623 |
| 242 | Ga0163162_10431279 | 3300013306 | Bacteria | 1450 |
| 243 | Ga0163162_11327730 | 3300013306 | Bacteria | 817 |
| 244 | Ga0157372_10001339 | 3300013307 | Bacteria | 26641 |
| 245 | Ga0157372_10185107 | 3300013307 | Bacteria | 2412 |
| 246 | Ga0157372_10233679 | 3300013307 | Bacteria | 2132 |
| 247 | Ga0157372_10415002 | 3300013307 | Bacteria | 1569 |
| 248 | Ga0157372_11712346 | 3300013307 | Bacteria | 723 |
| 249 | Ga0157375_10001312 | 3300013308 | Bacteria | 21447 |
| 250 | Ga0157375_10003810 | 3300013308 | Bacteria | 13074 |
| 251 | Ga0157375_10865063 | 3300013308 | Bacteria | 1050 |
| 252 | Ga0157375_10943783 | 3300013308 | Unclassified | 1005 |
| 253 | Ga0163163_10000589 | 3300014325 | Bacteria | 32012 |
| 254 | Ga0163163_10037145 | 3300014325 | Bacteria | 4737 |
| 255 | Ga0163163_10061254 | 3300014325 | Bacteria | 3728 |
| 256 | Ga0163163_11552399 | 3300014325 | Bacteria | 723 |
| 257 | Ga0182008_10687647 | 3300014497 | Bacteria | 583 |
| 258 | Ga0157379_10000908 | 3300014968 | Bacteria | 23906 |
| 259 | Ga0157379_10037939 | 3300014968 | Bacteria | 4298 |
| 260 | Ga0157379_10444677 | 3300014968 | Unclassified | 1196 |
| 261 | Ga0157376_10002712 | 3300014969 | Bacteria | 12060 |
| 262 | Ga0157376_10011163 | 3300014969 | Bacteria | 6609 |
| 263 | Ga0157376_10712493 | 3300014969 | Unclassified | 1010 |
| 264 | Ga0157376_10821108 | 3300014969 | Bacteria | 943 |
| 265 | Ga0157376_11519898 | 3300014969 | Bacteria | 703 |
| 266 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 267 | Ga0207656_10247714 | 3300025321 | Bacteria | 872 |
| 268 | Ga0207653_10166747 | 3300025885 | Unclassified | 818 |
| 269 | Ga0207692_10022970 | 3300025898 | Bacteria | 2878 |
| 270 | Ga0207692_10639495 | 3300025898 | Archaea | 686 |
| 271 | Ga0207692_10892490 | 3300025898 | Unclassified | 584 |
| 272 | Ga0207680_10073742 | 3300025903 | Bacteria | 2123 |
| 273 | Ga0207680_10241176 | 3300025903 | Bacteria | 1246 |
| 274 | Ga0207680_10384178 | 3300025903 | Bacteria | 990 |
| 275 | Ga0207680_10459526 | 3300025903 | Unclassified | 904 |
| 276 | Ga0207699_10041423 | 3300025906 | Bacteria | 2660 |
| 277 | Ga0207699_10053262 | 3300025906 | Bacteria | 2398 |
| 278 | Ga0207699_11024696 | 3300025906 | Unclassified | 610 |
| 279 | Ga0207645_10164774 | 3300025907 | Bacteria | 1451 |
| 280 | Ga0207643_10007592 | 3300025908 | Bacteria | 5823 |
| 281 | Ga0207705_10311711 | 3300025909 | Bacteria | 1208 |
| 282 | Ga0207684_10002473 | 3300025910 | Bacteria | 18611 |
| 283 | Ga0207684_10081385 | 3300025910 | Bacteria | 2756 |
| 284 | Ga0207684_10155359 | 3300025910 | Bacteria | 1969 |
| 285 | Ga0207684_10623371 | 3300025910 | Bacteria | 920 |
| 286 | Ga0207654_10004819 | 3300025911 | Bacteria | 6828 |
| 287 | Ga0207654_10114389 | 3300025911 | Bacteria | 1684 |
| 288 | Ga0207654_10214091 | 3300025911 | Bacteria | 1275 |
| 289 | Ga0207707_10207949 | 3300025912 | Bacteria | 1705 |
| 290 | Ga0207707_10353790 | 3300025912 | Bacteria | 1265 |
| 291 | Ga0207707_11367477 | 3300025912 | Bacteria | 566 |
| 292 | Ga0207707_11433951 | 3300025912 | Unclassified | 550 |
| 293 | Ga0207695_10000172 | 3300025913 | Bacteria | 190573 |
| 294 | Ga0207695_10000295 | 3300025913 | Bacteria | 123533 |
| 295 | Ga0207695_10001580 | 3300025913 | Bacteria | 37116 |
| 296 | Ga0207695_10206121 | 3300025913 | Bacteria | 1879 |
| 297 | Ga0207671_10002240 | 3300025914 | Bacteria | 20934 |
| 298 | Ga0207671_10007489 | 3300025914 | Bacteria | 9468 |
| 299 | Ga0207671_10854415 | 3300025914 | Bacteria | 720 |
| 300 | Ga0207671_11067904 | 3300025914 | Bacteria | 635 |
| 301 | Ga0207671_11377506 | 3300025914 | Bacteria | 547 |
| 302 | Ga0207693_10036438 | 3300025915 | Bacteria | 3878 |
| 303 | Ga0207663_10519965 | 3300025916 | Bacteria | 927 |
| 304 | Ga0207663_10723546 | 3300025916 | Bacteria | 789 |
| 305 | Ga0207660_10284188 | 3300025917 | Unclassified | 1314 |
| 306 | Ga0207660_10836034 | 3300025917 | Bacteria | 751 |
| 307 | Ga0207660_10986309 | 3300025917 | Bacteria | 687 |
| 308 | Ga0207657_10000410 | 3300025919 | Bacteria | 45335 |
| 309 | Ga0207657_10002223 | 3300025919 | Bacteria | 21052 |
| 310 | Ga0207657_11006161 | 3300025919 | Bacteria | 639 |
| 311 | Ga0207649_10002226 | 3300025920 | Bacteria | 10961 |
| 312 | Ga0207649_10028033 | 3300025920 | Bacteria | 3313 |
| 313 | Ga0207646_10029934 | 3300025922 | Bacteria | 4942 |
| 314 | Ga0207646_10490522 | 3300025922 | Bacteria | 1107 |
| 315 | Ga0207646_10556174 | 3300025922 | Bacteria | 1031 |
| 316 | Ga0207646_10612296 | 3300025922 | Unclassified | 977 |
| 317 | Ga0207646_10692131 | 3300025922 | Bacteria | 912 |
| 318 | Ga0207646_11211680 | 3300025922 | Unclassified | 661 |
| 319 | Ga0207646_11326534 | 3300025922 | Bacteria | 628 |
| 320 | Ga0207681_10041657 | 3300025923 | Bacteria | 3063 |
| 321 | Ga0207681_11273904 | 3300025923 | Bacteria | 617 |
| 322 | Ga0207694_10005258 | 3300025924 | Bacteria | 9975 |
| 323 | Ga0207694_10018235 | 3300025924 | Bacteria | 5304 |
| 324 | Ga0207694_10130893 | 3300025924 | Bacteria | 2011 |
| 325 | Ga0207694_11126049 | 3300025924 | Bacteria | 664 |
| 326 | Ga0207650_10261114 | 3300025925 | Bacteria | 1405 |
| 327 | Ga0207650_10639639 | 3300025925 | Bacteria | 896 |
| 328 | Ga0207659_10220803 | 3300025926 | Bacteria | 1524 |
| 329 | Ga0207687_10396617 | 3300025927 | Bacteria | 1134 |
| 330 | Ga0207687_10841326 | 3300025927 | Bacteria | 784 |
| 331 | Ga0207700_10108644 | 3300025928 | Bacteria | 2228 |
| 332 | Ga0207664_10003726 | 3300025929 | Bacteria | 10230 |
| 333 | Ga0207644_10173377 | 3300025931 | Bacteria | 1686 |
| 334 | Ga0207644_11061952 | 3300025931 | Bacteria | 680 |
| 335 | Ga0207690_10011451 | 3300025932 | Bacteria | 5303 |
| 336 | Ga0207690_10730415 | 3300025932 | Bacteria | 815 |
| 337 | Ga0207706_10000508 | 3300025933 | Bacteria | 41431 |
| 338 | Ga0207706_10156147 | 3300025933 | Bacteria | 2006 |
| 339 | Ga0207686_10016819 | 3300025934 | Bacteria | 4109 |
| 340 | Ga0207686_10685019 | 3300025934 | Unclassified | 814 |
| 341 | Ga0207670_10821577 | 3300025936 | Bacteria | 775 |
| 342 | Ga0207669_11492295 | 3300025937 | Bacteria | 576 |
| 343 | Ga0207704_10042757 | 3300025938 | Bacteria | 2670 |
| 344 | Ga0207704_10156433 | 3300025938 | Bacteria | 1616 |
| 345 | Ga0207704_10301915 | 3300025938 | Bacteria | 1227 |
| 346 | Ga0207665_10117859 | 3300025939 | Bacteria | 1873 |
| 347 | Ga0207691_10006401 | 3300025940 | Bacteria | 11374 |
| 348 | Ga0207691_10374699 | 3300025940 | Bacteria | 1215 |
| 349 | Ga0207711_10021731 | 3300025941 | Bacteria | 5360 |
| 350 | Ga0207711_10037051 | 3300025941 | Bacteria | 4141 |
| 351 | Ga0207711_10383507 | 3300025941 | Bacteria | 1304 |
| 352 | Ga0207711_11339957 | 3300025941 | Bacteria | 658 |
| 353 | Ga0207689_10154897 | 3300025942 | Bacteria | 1889 |
| 354 | Ga0207689_10203728 | 3300025942 | Bacteria | 1633 |
| 355 | Ga0207689_10358764 | 3300025942 | Bacteria | 1212 |
| 356 | Ga0207689_11196571 | 3300025942 | Unclassified | 640 |
| 357 | Ga0207661_12166590 | 3300025944 | Bacteria | 502 |
| 358 | Ga0207679_10131629 | 3300025945 | Bacteria | 2008 |
| 359 | Ga0207679_10155612 | 3300025945 | Bacteria | 1866 |
| 360 | Ga0207667_10011351 | 3300025949 | Bacteria | 10360 |
| 361 | Ga0207667_10139451 | 3300025949 | Bacteria | 2496 |
| 362 | Ga0207667_10275932 | 3300025949 | Bacteria | 1718 |
| 363 | Ga0207651_10098854 | 3300025960 | Bacteria | 2159 |
| 364 | Ga0207651_10131940 | 3300025960 | Bacteria | 1914 |
| 365 | Ga0207668_10130335 | 3300025972 | Bacteria | 1919 |
| 366 | Ga0207640_10029596 | 3300025981 | Bacteria | 3363 |
| 367 | Ga0207640_10069773 | 3300025981 | Bacteria | 2361 |
| 368 | Ga0207640_10123740 | 3300025981 | Bacteria | 1858 |
| 369 | Ga0207640_10558153 | 3300025981 | Bacteria | 963 |
| 370 | Ga0207640_10653140 | 3300025981 | Bacteria | 896 |
| 371 | Ga0207640_11525181 | 3300025981 | Unclassified | 601 |
| 372 | Ga0207658_10105428 | 3300025986 | Bacteria | 2217 |
| 373 | Ga0207658_10209934 | 3300025986 | Bacteria | 1631 |
| 374 | Ga0207658_10220671 | 3300025986 | Bacteria | 1595 |
| 375 | Ga0207677_10922458 | 3300026023 | Bacteria | 788 |
| 376 | Ga0207703_10196724 | 3300026035 | Bacteria | 1789 |
| 377 | Ga0207703_10200804 | 3300026035 | Bacteria | 1772 |
| 378 | Ga0207703_12256660 | 3300026035 | Bacteria | 520 |
| 379 | Ga0207639_10000677 | 3300026041 | Bacteria | 23536 |
| 380 | Ga0207639_10011910 | 3300026041 | Bacteria | 6050 |
| 381 | Ga0207639_10076822 | 3300026041 | Bacteria | 2631 |
| 382 | Ga0207639_10108899 | 3300026041 | Bacteria | 2253 |
| 383 | Ga0207639_10157830 | 3300026041 | Bacteria | 1908 |
| 384 | Ga0207639_10504227 | 3300026041 | Bacteria | 1106 |
| 385 | Ga0207639_12158632 | 3300026041 | Bacteria | 518 |
| 386 | Ga0207678_10008780 | 3300026067 | Bacteria | 8890 |
| 387 | Ga0207678_10800936 | 3300026067 | Bacteria | 832 |
| 388 | Ga0207702_10038458 | 3300026078 | Bacteria | 4007 |
| 389 | Ga0207702_10107187 | 3300026078 | Bacteria | 2477 |
| 390 | Ga0207702_10187556 | 3300026078 | Bacteria | 1908 |
| 391 | Ga0207702_11016008 | 3300026078 | Bacteria | 823 |
| 392 | Ga0207702_11057381 | 3300026078 | Bacteria | 805 |
| 393 | Ga0207641_10201357 | 3300026088 | Bacteria | 1836 |
| 394 | Ga0207641_10717756 | 3300026088 | Bacteria | 985 |
| 395 | Ga0207648_10052227 | 3300026089 | Bacteria | 3574 |
| 396 | Ga0207676_10005851 | 3300026095 | Bacteria | 8685 |
| 397 | Ga0207674_10001063 | 3300026116 | Bacteria | 35707 |
| 398 | Ga0207675_100610960 | 3300026118 | Bacteria | 1094 |
| 399 | Ga0207683_10010399 | 3300026121 | Bacteria | 7937 |
| 400 | Ga0207683_10086731 | 3300026121 | Bacteria | 2783 |
| 401 | Ga0207698_10032088 | 3300026142 | Bacteria | 3801 |
| 402 | Ga0207698_10035662 | 3300026142 | Bacteria | 3642 |
| 403 | Ga0207698_10111151 | 3300026142 | Bacteria | 2297 |
| 404 | Ga0207698_10343236 | 3300026142 | Bacteria | 1407 |
| 405 | Ga0207698_10609518 | 3300026142 | Bacteria | 1077 |
| 406 | Ga0207698_11232645 | 3300026142 | Bacteria | 762 |
| 407 | Ga0268266_10878478 | 3300028379 | Unclassified | 867 |
| 408 | Ga0268266_11724295 | 3300028379 | Bacteria | 601 |
| 409 | Ga0268265_11166214 | 3300028380 | Bacteria | 767 |
| 410 | Ga0268264_10005817 | 3300028381 | Bacteria | 10454 |
| 411 | Ga0268264_10251770 | 3300028381 | Bacteria | 1641 |
| 412 | Ga0268264_10907459 | 3300028381 | Bacteria | 884 |
| 413 | Ga0265319_1015822 | 3300028563 | Bacteria | 2909 |
| 414 | Ga0265334_10000382 | 3300028573 | Bacteria | 23721 |
| 415 | Ga0265318_10001274 | 3300028577 | Bacteria | 15181 |
| 416 | Ga0265338_10007834 | 3300028800 | Bacteria | 13126 |
| 417 | Ga0265330_10009713 | 3300031235 | Bacteria | 4558 |
| 418 | Ga0265332_10005222 | 3300031238 | Bacteria | 6009 |
| 419 | Ga0265328_10075222 | 3300031239 | Bacteria | 1242 |
| 420 | Ga0265320_10024409 | 3300031240 | Unclassified | 3197 |
| 421 | Ga0265325_10015537 | 3300031241 | Plasmid | 4278 |
| 422 | Ga0265329_10003497 | 3300031242 | Bacteria | 6819 |
| 423 | Ga0265340_10027094 | 3300031247 | Bacteria | 2891 |
| 424 | Ga0265340_10074088 | 3300031247 | Bacteria | 1610 |
| 425 | Ga0265339_10038858 | 3300031249 | Bacteria | 2652 |
| 426 | Ga0265331_10022059 | 3300031250 | Bacteria | 3251 |
| 427 | Ga0265316_10025765 | 3300031344 | Bacteria | 4902 |
| 428 | Ga0265313_10001323 | 3300031595 | Bacteria | 23327 |
| 429 | Ga0307508_10431975 | 3300031616 | Bacteria | 909 |
| 430 | Ga0265314_10001700 | 3300031711 | Bacteria | 23913 |
| 431 | Ga0265342_10074396 | 3300031712 | Bacteria | 1973 |
| 432 | Ga0307516_10022332 | 3300031730 | Bacteria | 6499 |
| 433 | Ga0307516_10121219 | 3300031730 | Bacteria | 2405 |
| 434 | Ga0307405_10085482 | 3300031731 | Unclassified | 2074 |
| 435 | Ga0307409_102296735 | 3300031995 | Unclassified | 569 |
| 436 | Ga0307416_100791770 | 3300032002 | Unclassified | 1043 |
| 437 | Ga0307414_11577044 | 3300032004 | Bacteria | 612 |
| 438 | Ga0373944_0017219 | 3300035089 | Bacteria | 2049 |
| 439 | Ga0373951_0289890 | 3300035091 | Bacteria | 502 |
| 440 | Ga0373939_0345818 | 3300035114 | Bacteria | 604 |
| 441 | Ga0373955_0728616 | 3300035172 | Bacteria | 609 |
| 442 | Ga0373962_0341069 | 3300035242 | Unclassified | 540 |
| 443 | Ga0373927_0026714 | 3300035695 | Bacteria | 3773 |
| 444 | Ga0373933_0213179 | 3300035724 | Bacteria | 1238 |
| 445 | Ga0373933_1143229 | 3300035724 | Bacteria | 513 |
| 446 | Ga0373937_0060919 | 3300036401 | Bacteria | 3469 |
| 447 | Ga0373937_0827364 | 3300036401 | Bacteria | 874 |
| 448 | Ga0373937_2112024 | 3300036401 | Bacteria | 509 |
| 449 | Ga0373925_0114439 | 3300037068 | Bacteria | 2088 |
| 450 | Ga0395900_0723081 | 3300037418 | Bacteria | 928 |
| 451 | Ga0395898_0921850 | 3300037466 | Bacteria | 811 |
| 452 | Ga0395905_0039348 | 3300037471 | Bacteria | 4436 |
| 453 | Ga0395905_0282659 | 3300037471 | Bacteria | 1545 |
| 454 | Ga0439436_0143599 | 3300041404 | Bacteria | 672 |
| 455 | Ga0439461_0026411 | 3300041410 | Bacteria | 1184 |
| 456 | Ga0451789_1207264 | 3300041443 | Unclassified | 631 |
| 457 | Ga0451789_1245254 | 3300041443 | Bacteria | 1311 |
| 458 | Ga0451791_1900911 | 3300041451 | Bacteria | 653 |
| 459 | Ga0451793_1068317 | 3300041452 | Bacteria | 1824 |
| 460 | Ga0451802_1126562 | 3300041460 | Bacteria | 1281 |
| 461 | Ga0451835_0424047 | 3300041492 | Bacteria | 597 |
| 462 | Ga0451853_3002975 | 3300041512 | Unclassified | 878 |
| 463 | Ga0439432_056911 | 3300042006 | Bacteria | 1211 |
| 464 | Ga0450892_017602 | 3300042130 | Bacteria | 680 |
| 465 | Ga0439446_0001691 | 3300042156 | Bacteria | 5114 |
| 466 | Ga0439434_0011963 | 3300042435 | Bacteria | 2564 |
| 467 | Ga0439435_0065019 | 3300042436 | Bacteria | 1069 |
| 468 | Ga0439464_0008079 | 3300042439 | Bacteria | 2759 |
| 469 | Ga0451576_0716956 | 3300045051 | Bacteria | 1051 |
| 470 | Ga0495592_0453828 | 3300046454 | Bacteria | 803 |
| 471 | Ga0495580_0203665 | 3300046472 | Bacteria | 1363 |
| 472 | Ga0495580_0328574 | 3300046472 | Bacteria | 1039 |
| 473 | Ga0495582_0039275 | 3300046473 | Bacteria | 2606 |
| 474 | Ga0495664_0030767 | 3300046477 | Bacteria | 3145 |
| 475 | Ga0495628_0117503 | 3300046516 | Bacteria | 2042 |
| 476 | Ga0495586_0065544 | 3300046535 | Bacteria | 1980 |
| 477 | Ga0495586_0177840 | 3300046535 | Unclassified | 1203 |
| 478 | Ga0495645_0030665 | 3300046543 | Bacteria | 3917 |
| 479 | Ga0495647_0438914 | 3300046681 | Bacteria | 603 |
| 480 | Ga0495658_0007304 | 3300046683 | Bacteria | 5460 |
| 481 | Ga0495674_0318176 | 3300047319 | Bacteria | 1268 |
| 482 | Ga0495676_0609252 | 3300047321 | Bacteria | 711 |
| 483 | Ga0495684_0759877 | 3300047471 | Bacteria | 637 |
| 484 | Ga0496104_0000016 | 3300048907 | Bacteria | 335025 |
| 485 | Ga0496105_0000010 | 3300048908 | Bacteria | 309880 |
| 486 | Ga0496106_0332564 | 3300048909 | Bacteria | 1220 |
| 487 | Ga0496117_0106840 | 3300048920 | Bacteria | 1755 |
| 488 | Ga0496118_0006022 | 3300048921 | Bacteria | 13511 |
| 489 | Ga0496126_0780083 | 3300048929 | Bacteria | 735 |
| 490 | Ga0501031_0001252 | 3300049568 | Bacteria | 15563 |
| 491 | Ga0501031_0140612 | 3300049568 | Bacteria | 1578 |
| 492 | Ga0501032_0006457 | 3300049569 | Bacteria | 8623 |
| 493 | Ga0501032_0007845 | 3300049569 | Bacteria | 7776 |
| 494 | Ga0501032_0099742 | 3300049569 | Bacteria | 1924 |
| 495 | Ga0501033_0204340 | 3300049570 | Bacteria | 1410 |
| 496 | Ga0501033_0229226 | 3300049570 | Bacteria | 1320 |
| 497 | Ga0501034_0000923 | 3300049571 | Bacteria | 42924 |
| 498 | Ga0501034_0001491 | 3300049571 | Bacteria | 30825 |
| 499 | Ga0501034_0002559 | 3300049571 | Bacteria | 21676 |
| 500 | Ga0501034_0003599 | 3300049571 | Bacteria | 17586 |
| 501 | Ga0501034_0010554 | 3300049571 | Bacteria | 9615 |
| 502 | Ga0501034_0504307 | 3300049571 | Bacteria | 1124 |
| 503 | Ga0501036_0014087 | 3300049572 | Bacteria | 6646 |
| 504 | Ga0501036_0028103 | 3300049572 | Bacteria | 4755 |
| 505 | Ga0501037_0006310 | 3300049573 | Bacteria | 8673 |
| 506 | Ga0501037_0083577 | 3300049573 | Bacteria | 2313 |
| 507 | Ga0501037_0189290 | 3300049573 | Bacteria | 1457 |
| 508 | Ga0501037_0467309 | 3300049573 | Bacteria | 859 |
| 509 | Ga0501038_0001341 | 3300049574 | Bacteria | 22396 |
| 510 | Ga0501038_0003381 | 3300049574 | Bacteria | 14873 |
| 511 | Ga0501038_0242783 | 3300049574 | Bacteria | 1429 |
| 512 | Ga0501038_0300176 | 3300049574 | Bacteria | 1261 |
| 513 | Ga0501039_0017771 | 3300049575 | Bacteria | 5455 |
| 514 | Ga0501042_0228635 | 3300049578 | Bacteria | 1342 |
| 515 | Ga0501042_0733834 | 3300049578 | Bacteria | 718 |
| 516 | Ga0501043_0006766 | 3300049579 | Bacteria | 9154 |
| 517 | Ga0501043_0071732 | 3300049579 | Bacteria | 2720 |
| 518 | Ga0501043_0083343 | 3300049579 | Bacteria | 2514 |
| 519 | Ga0501043_0181532 | 3300049579 | Bacteria | 1639 |
| 520 | Ga0501043_0943949 | 3300049579 | Bacteria | 616 |
| 521 | Ga0501046_0183151 | 3300049580 | Bacteria | 1565 |
| 522 | Ga0501046_0191909 | 3300049580 | Bacteria | 1523 |
| 523 | Ga0501046_1134160 | 3300049580 | Bacteria | 539 |
| 524 | Ga0501047_0000595 | 3300049581 | Bacteria | 38475 |
| 525 | Ga0501047_0003974 | 3300049581 | Bacteria | 13903 |
| 526 | Ga0501047_0013119 | 3300049581 | Bacteria | 7848 |
| 527 | Ga0501047_0064445 | 3300049581 | Bacteria | 3534 |
| 528 | Ga0501047_0082590 | 3300049581 | Bacteria | 3088 |
| 529 | Ga0501047_0329993 | 3300049581 | Bacteria | 1364 |
| 530 | Ga0501067_0000144 | 3300049583 | Bacteria | 39618 |
| 531 | Ga0501067_0373704 | 3300049583 | Bacteria | 795 |
| 532 | Ga0501068_0001199 | 3300049584 | Bacteria | 13793 |
| 533 | Ga0501068_0227222 | 3300049584 | Bacteria | 1186 |
| 534 | Ga0501068_0415538 | 3300049584 | Bacteria | 868 |
| 535 | Ga0501069_0006012 | 3300049585 | Bacteria | 6334 |
| 536 | Ga0501069_0308199 | 3300049585 | Bacteria | 929 |
| 537 | Ga0501070_0001010 | 3300049586 | Bacteria | 25228 |
| 538 | Ga0501070_0003066 | 3300049586 | Bacteria | 14548 |
| 539 | Ga0501070_0015472 | 3300049586 | Bacteria | 6417 |
| 540 | Ga0501070_0247823 | 3300049586 | Bacteria | 1457 |
| 541 | Ga0501070_1123612 | 3300049586 | Unclassified | 605 |
| 542 | Ga0501071_0172013 | 3300049587 | Bacteria | 1621 |
| 543 | Ga0501072_0001429 | 3300049588 | Bacteria | 17889 |
| 544 | Ga0501073_0009880 | 3300049589 | Bacteria | 7022 |
| 545 | Ga0501073_0018135 | 3300049589 | Bacteria | 5087 |
| 546 | Ga0501073_0044855 | 3300049589 | Bacteria | 3116 |
| 547 | Ga0501073_0443259 | 3300049589 | Bacteria | 897 |
| 548 | Ga0501074_0001889 | 3300049590 | Bacteria | 14390 |
| 549 | Ga0501074_0029954 | 3300049590 | Bacteria | 3944 |
| 550 | Ga0501074_0058025 | 3300049590 | Bacteria | 2788 |
| 551 | Ga0501074_0157097 | 3300049590 | Bacteria | 1624 |
| 552 | Ga0501076_1393938 | 3300049592 | Bacteria | 576 |
| 553 | Ga0501079_0014655 | 3300049741 | Bacteria | 5978 |
| 554 | Ga0501079_0068466 | 3300049741 | Bacteria | 2740 |
| 555 | Ga0501079_0434614 | 3300049741 | Bacteria | 1030 |
| 556 | Ga0501080_0000287 | 3300049742 | Bacteria | 38182 |
| 557 | Ga0501080_0006631 | 3300049742 | Bacteria | 10412 |
| 558 | Ga0501080_0018114 | 3300049742 | Bacteria | 6520 |
| 559 | Ga0501080_0042144 | 3300049742 | Bacteria | 4252 |
| 560 | Ga0501080_0081702 | 3300049742 | Bacteria | 3001 |
| 561 | Ga0501080_0104707 | 3300049742 | Bacteria | 2624 |
| 562 | Ga0501080_0253910 | 3300049742 | Bacteria | 1603 |
| 563 | Ga0501080_0574573 | 3300049742 | Bacteria | 1002 |
| 564 | Ga0501080_0642476 | 3300049742 | Bacteria | 939 |
| 565 | Ga0501083_0000432 | 3300049744 | Bacteria | 26907 |
| 566 | Ga0501083_0352072 | 3300049744 | Bacteria | 957 |
| 567 | Ga0501035_0003375 | 3300049822 | Bacteria | 15277 |
| 568 | Ga0501035_0117579 | 3300049822 | Bacteria | 2326 |
| 569 | Ga0501035_0363117 | 3300049822 | Bacteria | 1210 |
| 570 | Ga0501035_0453675 | 3300049822 | Bacteria | 1060 |
| 571 | Ga0501035_0849303 | 3300049822 | Bacteria | 726 |
| 572 | Ga0501044_0003724 | 3300049823 | Bacteria | 17136 |
| 573 | Ga0501044_0012519 | 3300049823 | Bacteria | 9187 |
| 574 | Ga0501044_0048721 | 3300049823 | Bacteria | 4375 |
| 575 | Ga0501044_0050777 | 3300049823 | Bacteria | 4278 |
| 576 | Ga0501044_0809958 | 3300049823 | Bacteria | 815 |
| 577 | Ga0501044_1309717 | 3300049823 | Bacteria | 591 |
| 578 | Ga0501045_0129400 | 3300049824 | Bacteria | 1876 |
| 579 | Ga0501045_0421562 | 3300049824 | Bacteria | 993 |
| 580 | Ga0501045_0936655 | 3300049824 | Bacteria | 636 |
| 581 | nmdc:mga0k408_39917_c1 | 3300050493 | Bacteria | 2699 |
| 582 | nmdc:mga06z11_194346_c1 | 3300050494 | Bacteria | 1176 |
| 583 | nmdc:mga04h51_19027_c1 | 3300050495 | Bacteria | 2031 |
| 584 | nmdc:mga07m45_66517_c1 | 3300050496 | Bacteria | 2048 |
| 585 | nmdc:mga0n895_937279_c1 | 3300050512 | Unclassified | 850 |
| 586 | nmdc:mga0rr50_362065_c1 | 3300050513 | Bacteria | 1221 |
| 587 | nmdc:mga08x19_12435_c1 | 3300050514 | Bacteria | 5128 |
| 588 | nmdc:mga0sz30_127518_c1 | 3300050516 | Bacteria | 1120 |
| 589 | Ga0495601_0442072 | 3300053077 | Bacteria | 841 |
| 590 | Ga0500566_0355859 | 3300053094 | Unclassified | 669 |
| 591 | Ga0501084_1674920 | 3300054114 | Unclassified | 531 |
| 592 | Ga0501082_0003807 | 3300060353 | Bacteria | 13196 |
| 593 | Ga0501082_1078460 | 3300060353 | Bacteria | 702 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_362065_c1 | nmdc:mga0rr50_362065_c1_903_1199 | 98 |
| 2 | 3300028563 | Ga0265319_1015822 | Ga0265319_10158223 | 101 |
| 3 | 3300028573 | Ga0265334_10000382 | Ga0265334_1000038219 | 101 |
| 4 | 3300028577 | Ga0265318_10001274 | Ga0265318_100012749 | 101 |
| 5 | 3300028800 | Ga0265338_10007834 | Ga0265338_100078349 | 101 |
| 6 | 3300031238 | Ga0265332_10005222 | Ga0265332_100052223 | 101 |
| 7 | 3300031242 | Ga0265329_10003497 | Ga0265329_100034975 | 101 |
| 8 | 3300031249 | Ga0265339_10038858 | Ga0265339_100388583 | 101 |
| 9 | 3300031250 | Ga0265331_10022059 | Ga0265331_100220594 | 101 |
| 10 | 3300031344 | Ga0265316_10025765 | Ga0265316_100257655 | 101 |
| 11 | 3300031595 | Ga0265313_10001323 | Ga0265313_1000132319 | 101 |
| 12 | 3300031712 | Ga0265342_10074396 | Ga0265342_100743963 | 101 |
| 13 | 3300049587 | Ga0501071_0172013 | Ga0501071_0172013_15_332 | 101 |
| 14 | iso_pu_bacteria | 2643221559 | 2643816416 | 101 |
| 15 | iso_pu_bacteria | 2643221586 | 2643938902 | 101 |
| 16 | iso_pu_bacteria | 2643221612 | 2644077355 | 101 |
| 17 | iso_pu_bacteria | 2643221727 | 2644694335 | 101 |
| 18 | iso_pu_bacteria | 2687453130 | 2687583947 | 101 |
| 19 | 3300005329 | Ga0070683_101687160 | Ga0070683_1016871601 | 103 |
| 20 | 3300005339 | Ga0070660_101720914 | Ga0070660_1017209141 | 103 |
| 21 | 3300005344 | Ga0070661_100005961 | Ga0070661_10000596111 | 103 |
| 22 | 3300005539 | Ga0068853_100040081 | Ga0068853_1000400813 | 103 |
| 23 | 3300005563 | Ga0068855_100176616 | Ga0068855_1001766162 | 103 |
| 24 | 3300005578 | Ga0068854_100155344 | Ga0068854_1001553443 | 103 |
| 25 | 3300005614 | Ga0068856_100022479 | Ga0068856_1000224796 | 103 |
| 26 | 3300005616 | Ga0068852_100037199 | Ga0068852_1000371994 | 103 |
| 27 | 3300009093 | Ga0105240_10148066 | Ga0105240_101480663 | 103 |
| 28 | 3300009174 | Ga0105241_10027430 | Ga0105241_100274303 | 103 |
| 29 | 3300009177 | Ga0105248_10056463 | Ga0105248_100564633 | 103 |
| 30 | 3300009545 | Ga0105237_10010967 | Ga0105237_100109679 | 103 |
| 31 | 3300009545 | Ga0105237_10232300 | Ga0105237_102323001 | 103 |
| 32 | 3300009551 | Ga0105238_10014095 | Ga0105238_1001409510 | 103 |
| 33 | 3300009553 | Ga0105249_10834358 | Ga0105249_108343581 | 103 |
| 34 | 3300010375 | Ga0105239_10003753 | Ga0105239_100037534 | 103 |
| 35 | 3300010375 | Ga0105239_10142163 | Ga0105239_101421634 | 103 |
| 36 | 3300013100 | Ga0157373_10371493 | Ga0157373_103714932 | 103 |
| 37 | 3300013104 | Ga0157370_10038747 | Ga0157370_100387474 | 103 |
| 38 | 3300013105 | Ga0157369_10004991 | Ga0157369_100049919 | 103 |
| 39 | 3300013105 | Ga0157369_10285061 | Ga0157369_102850612 | 103 |
| 40 | 3300013296 | Ga0157374_10022440 | Ga0157374_100224403 | 103 |
| 41 | 3300013297 | Ga0157378_11250724 | Ga0157378_112507242 | 103 |
| 42 | 3300013307 | Ga0157372_10001339 | Ga0157372_1000133914 | 103 |
| 43 | 3300013308 | Ga0157375_10003810 | Ga0157375_100038105 | 103 |
| 44 | 3300025911 | Ga0207654_10114389 | Ga0207654_101143891 | 103 |
| 45 | 3300025913 | Ga0207695_10000295 | Ga0207695_1000029523 | 103 |
| 46 | 3300025914 | Ga0207671_10007489 | Ga0207671_100074892 | 103 |
| 47 | 3300025919 | Ga0207657_11006161 | Ga0207657_110061611 | 103 |
| 48 | 3300025920 | Ga0207649_10002226 | Ga0207649_100022263 | 103 |
| 49 | 3300025924 | Ga0207694_11126049 | Ga0207694_111260491 | 103 |
| 50 | 3300025941 | Ga0207711_10037051 | Ga0207711_100370513 | 103 |
| 51 | 3300025942 | Ga0207689_10154897 | Ga0207689_101548971 | 103 |
| 52 | 3300025944 | Ga0207661_12166590 | Ga0207661_121665902 | 103 |
| 53 | 3300025949 | Ga0207667_10139451 | Ga0207667_101394512 | 103 |
| 54 | 3300025981 | Ga0207640_10069773 | Ga0207640_100697732 | 103 |
| 55 | 3300026041 | Ga0207639_10000677 | Ga0207639_1000067723 | 103 |
| 56 | 3300026078 | Ga0207702_10187556 | Ga0207702_101875563 | 103 |
| 57 | 3300026078 | Ga0207702_11016008 | Ga0207702_110160082 | 103 |
| 58 | 3300026142 | Ga0207698_11232645 | Ga0207698_112326452 | 103 |
| 59 | 3300036401 | Ga0373937_0827364 | Ga0373937_0827364_231_545 | 103 |
| 60 | 3300041410 | Ga0439461_0026411 | Ga0439461_0026411_748_1059 | 103 |
| 61 | 3300042156 | Ga0439446_0001691 | Ga0439446_0001691_2230_2541 | 103 |
| 62 | 3300042435 | Ga0439434_0011963 | Ga0439434_0011963_579_890 | 103 |
| 63 | 3300042436 | Ga0439435_0065019 | Ga0439435_0065019_360_671 | 103 |
| 64 | 3300005327 | Ga0070658_11708990 | Ga0070658_117089902 | 104 |
| 65 | 3300005329 | Ga0070683_100011063 | Ga0070683_1000110636 | 104 |
| 66 | 3300005330 | Ga0070690_100138207 | Ga0070690_1001382072 | 104 |
| 67 | 3300005334 | Ga0068869_100045770 | Ga0068869_1000457703 | 104 |
| 68 | 3300005336 | Ga0070680_101437687 | Ga0070680_1014376872 | 104 |
| 69 | 3300005337 | Ga0070682_101698030 | Ga0070682_1016980301 | 104 |
| 70 | 3300005339 | Ga0070660_100171177 | Ga0070660_1001711773 | 104 |
| 71 | 3300005344 | Ga0070661_100064236 | Ga0070661_1000642362 | 104 |
| 72 | 3300005355 | Ga0070671_101172613 | Ga0070671_1011726132 | 104 |
| 73 | 3300005366 | Ga0070659_102044431 | Ga0070659_1020444311 | 104 |
| 74 | 3300005367 | Ga0070667_100016460 | Ga0070667_1000164602 | 104 |
| 75 | 3300005458 | Ga0070681_10440107 | Ga0070681_104401073 | 104 |
| 76 | 3300005530 | Ga0070679_100315630 | Ga0070679_1003156303 | 104 |
| 77 | 3300005535 | Ga0070684_100167390 | Ga0070684_1001673902 | 104 |
| 78 | 3300005539 | Ga0068853_100231778 | Ga0068853_1002317782 | 104 |
| 79 | 3300005547 | Ga0070693_100665219 | Ga0070693_1006652191 | 104 |
| 80 | 3300005563 | Ga0068855_101181093 | Ga0068855_1011810932 | 104 |
| 81 | 3300005577 | Ga0068857_100101392 | Ga0068857_1001013922 | 104 |
| 82 | 3300005578 | Ga0068854_100161259 | Ga0068854_1001612593 | 104 |
| 83 | 3300005614 | Ga0068856_100424535 | Ga0068856_1004245352 | 104 |
| 84 | 3300005616 | Ga0068852_100267619 | Ga0068852_1002676192 | 104 |
| 85 | 3300005617 | Ga0068859_101659496 | Ga0068859_1016594962 | 104 |
| 86 | 3300005834 | Ga0068851_10117736 | Ga0068851_101177362 | 104 |
| 87 | 3300006881 | Ga0068865_100337990 | Ga0068865_1003379902 | 104 |
| 88 | 3300006931 | Ga0097620_101659403 | Ga0097620_1016594031 | 104 |
| 89 | 3300009093 | Ga0105240_10132389 | Ga0105240_101323893 | 104 |
| 90 | 3300009098 | Ga0105245_10253709 | Ga0105245_102537092 | 104 |
| 91 | 3300009174 | Ga0105241_10022409 | Ga0105241_100224098 | 104 |
| 92 | 3300009545 | Ga0105237_10584177 | Ga0105237_105841772 | 104 |
| 93 | 3300009551 | Ga0105238_10078507 | Ga0105238_100785072 | 104 |
| 94 | 3300010375 | Ga0105239_11028667 | Ga0105239_110286672 | 104 |
| 95 | 3300011119 | Ga0105246_10021624 | Ga0105246_100216247 | 104 |
| 96 | 3300013100 | Ga0157373_10502838 | Ga0157373_105028382 | 104 |
| 97 | 3300013102 | Ga0157371_10454714 | Ga0157371_104547142 | 104 |
| 98 | 3300013104 | Ga0157370_10086784 | Ga0157370_100867842 | 104 |
| 99 | 3300013105 | Ga0157369_10076246 | Ga0157369_100762464 | 104 |
| 100 | 3300013296 | Ga0157374_10235137 | Ga0157374_102351372 | 104 |
| 101 | 3300013307 | Ga0157372_10233679 | Ga0157372_102336792 | 104 |
| 102 | 3300014325 | Ga0163163_11552399 | Ga0163163_115523992 | 104 |
| 103 | 3300014497 | Ga0182008_10687647 | Ga0182008_106876471 | 104 |
| 104 | 3300014969 | Ga0157376_10821108 | Ga0157376_108211081 | 104 |
| 105 | 3300025321 | Ga0207656_10247714 | Ga0207656_102477142 | 104 |
| 106 | 3300025912 | Ga0207707_10207949 | Ga0207707_102079492 | 104 |
| 107 | 3300025913 | Ga0207695_10206121 | Ga0207695_102061212 | 104 |
| 108 | 3300025917 | Ga0207660_10836034 | Ga0207660_108360342 | 104 |
| 109 | 3300025919 | Ga0207657_10002223 | Ga0207657_1000222319 | 104 |
| 110 | 3300025920 | Ga0207649_10028033 | Ga0207649_100280333 | 104 |
| 111 | 3300025924 | Ga0207694_10130893 | Ga0207694_101308932 | 104 |
| 112 | 3300025927 | Ga0207687_10396617 | Ga0207687_103966173 | 104 |
| 113 | 3300025932 | Ga0207690_10730415 | Ga0207690_107304152 | 104 |
| 114 | 3300025933 | Ga0207706_10156147 | Ga0207706_101561472 | 104 |
| 115 | 3300025938 | Ga0207704_10301915 | Ga0207704_103019152 | 104 |
| 116 | 3300025942 | Ga0207689_10203728 | Ga0207689_102037282 | 104 |
| 117 | 3300025945 | Ga0207679_10131629 | Ga0207679_101316293 | 104 |
| 118 | 3300025949 | Ga0207667_10275932 | Ga0207667_102759322 | 104 |
| 119 | 3300025981 | Ga0207640_10123740 | Ga0207640_101237402 | 104 |
| 120 | 3300026023 | Ga0207677_10922458 | Ga0207677_109224582 | 104 |
| 121 | 3300026035 | Ga0207703_12256660 | Ga0207703_122566602 | 104 |
| 122 | 3300026041 | Ga0207639_12158632 | Ga0207639_121586321 | 104 |
| 123 | 3300026078 | Ga0207702_11057381 | Ga0207702_110573812 | 104 |
| 124 | 3300026116 | Ga0207674_10001063 | Ga0207674_100010634 | 104 |
| 125 | 3300026142 | Ga0207698_10343236 | Ga0207698_103432362 | 104 |
| 126 | 3300028380 | Ga0268265_11166214 | Ga0268265_111662142 | 104 |
| 127 | 3300049569 | Ga0501032_0006457 | Ga0501032_0006457_6288_6605 | 104 |
| 128 | 3300049570 | Ga0501033_0204340 | Ga0501033_0204340_444_761 | 104 |
| 129 | 3300049571 | Ga0501034_0002559 | Ga0501034_0002559_9189_9506 | 104 |
| 130 | 3300049571 | Ga0501034_0003599 | Ga0501034_0003599_6670_6996 | 104 |
| 131 | 3300049572 | Ga0501036_0028103 | Ga0501036_0028103_3605_3922 | 104 |
| 132 | 3300049573 | Ga0501037_0083577 | Ga0501037_0083577_762_1079 | 104 |
| 133 | 3300049574 | Ga0501038_0003381 | Ga0501038_0003381_943_1260 | 104 |
| 134 | 3300049579 | Ga0501043_0083343 | Ga0501043_0083343_830_1147 | 104 |
| 135 | 3300049581 | Ga0501047_0000595 | Ga0501047_0000595_25278_25595 | 104 |
| 136 | 3300049581 | Ga0501047_0329993 | Ga0501047_0329993_253_579 | 104 |
| 137 | 3300049583 | Ga0501067_0000144 | Ga0501067_0000144_25009_25326 | 104 |
| 138 | 3300049584 | Ga0501068_0001199 | Ga0501068_0001199_6372_6689 | 104 |
| 139 | 3300049585 | Ga0501069_0006012 | Ga0501069_0006012_5709_6026 | 104 |
| 140 | 3300049586 | Ga0501070_0001010 | Ga0501070_0001010_14451_14768 | 104 |
| 141 | 3300049588 | Ga0501072_0001429 | Ga0501072_0001429_11486_11803 | 104 |
| 142 | 3300049589 | Ga0501073_0009880 | Ga0501073_0009880_6372_6689 | 104 |
| 143 | 3300049590 | Ga0501074_0001889 | Ga0501074_0001889_5389_5706 | 104 |
| 144 | 3300049741 | Ga0501079_0014655 | Ga0501079_0014655_324_641 | 104 |
| 145 | 3300049742 | Ga0501080_0000287 | Ga0501080_0000287_27277_27594 | 104 |
| 146 | 3300049744 | Ga0501083_0000432 | Ga0501083_0000432_19175_19492 | 104 |
| 147 | 3300049822 | Ga0501035_0363117 | Ga0501035_0363117_851_1168 | 104 |
| 148 | 3300049823 | Ga0501044_0012519 | Ga0501044_0012519_6240_6557 | 104 |
| 149 | 3300049824 | Ga0501045_0936655 | Ga0501045_0936655_294_611 | 104 |
| 150 | 3300054114 | Ga0501084_1674920 | Ga0501084_1674920_42_359 | 104 |
| 151 | 3300060353 | Ga0501082_0003807 | Ga0501082_0003807_339_656 | 104 |
| 152 | 3300005439 | Ga0070711_101395388 | Ga0070711_1013953882 | 105 |
| 153 | 3300005539 | Ga0068853_100230148 | Ga0068853_1002301481 | 105 |
| 154 | 3300005546 | Ga0070696_100134573 | Ga0070696_1001345732 | 105 |
| 155 | 3300005547 | Ga0070693_100247271 | Ga0070693_1002472711 | 105 |
| 156 | 3300005614 | Ga0068856_100102646 | Ga0068856_1001026463 | 105 |
| 157 | 3300005616 | Ga0068852_100815085 | Ga0068852_1008150851 | 105 |
| 158 | 3300006358 | Ga0068871_101451400 | Ga0068871_1014514001 | 105 |
| 159 | 3300009174 | Ga0105241_11349916 | Ga0105241_113499161 | 105 |
| 160 | 3300009177 | Ga0105248_10532460 | Ga0105248_105324603 | 105 |
| 161 | 3300009545 | Ga0105237_11823929 | Ga0105237_118239292 | 105 |
| 162 | 3300010375 | Ga0105239_10648722 | Ga0105239_106487222 | 105 |
| 163 | 3300013104 | Ga0157370_11080222 | Ga0157370_110802221 | 105 |
| 164 | 3300015685 | Ga0183369_1007 | Ga0183369_1007238 | 105 |
| 165 | 3300025941 | Ga0207711_10383507 | Ga0207711_103835072 | 105 |
| 166 | 3300026041 | Ga0207639_10504227 | Ga0207639_105042271 | 105 |
| 167 | 3300026078 | Ga0207702_10038458 | Ga0207702_100384584 | 105 |
| 168 | 3300031235 | Ga0265330_10009713 | Ga0265330_100097134 | 105 |
| 169 | 3300031239 | Ga0265328_10075222 | Ga0265328_100752222 | 105 |
| 170 | 3300031240 | Ga0265320_10024409 | Ga0265320_100244092 | 105 |
| 171 | 3300031241 | Ga0265325_10015537 | Ga0265325_100155376 | 105 |
| 172 | 3300031247 | Ga0265340_10074088 | Ga0265340_100740882 | 105 |
| 173 | 3300031711 | Ga0265314_10001700 | Ga0265314_100017009 | 105 |
| 174 | 3300049586 | Ga0501070_1123612 | Ga0501070_1123612_145_489 | 105 |
| 175 | 3300049742 | Ga0501080_0253910 | Ga0501080_0253910_1169_1513 | 105 |
| 176 | 3300049822 | Ga0501035_0117579 | Ga0501035_0117579_794_1138 | 105 |
| 177 | 3300049823 | Ga0501044_0809958 | Ga0501044_0809958_96_440 | 105 |
| 178 | 3300049823 | Ga0501044_1309717 | Ga0501044_1309717_190_534 | 105 |
| 179 | 3300005330 | Ga0070690_100115446 | Ga0070690_1001154462 | 106 |
| 180 | 3300006237 | Ga0097621_100090608 | Ga0097621_1000906083 | 106 |
| 181 | 3300006358 | Ga0068871_100190250 | Ga0068871_1001902502 | 106 |
| 182 | 3300009098 | Ga0105245_10140723 | Ga0105245_101407233 | 106 |
| 183 | 3300009174 | Ga0105241_10017869 | Ga0105241_100178695 | 106 |
| 184 | 3300010375 | Ga0105239_10077290 | Ga0105239_100772903 | 106 |
| 185 | 3300013105 | Ga0157369_10000025 | Ga0157369_10000025202 | 106 |
| 186 | 3300025911 | Ga0207654_10004819 | Ga0207654_100048193 | 106 |
| 187 | 3300025913 | Ga0207695_10001580 | Ga0207695_1000158031 | 106 |
| 188 | 3300025914 | Ga0207671_10002240 | Ga0207671_1000224012 | 106 |
| 189 | 3300025924 | Ga0207694_10018235 | Ga0207694_100182354 | 106 |
| 190 | 3300026041 | Ga0207639_10157830 | Ga0207639_101578302 | 106 |
| 191 | 3300037466 | Ga0395898_0921850 | Ga0395898_0921850_144_467 | 106 |
| 192 | 3300037471 | Ga0395905_0039348 | Ga0395905_0039348_898_1221 | 106 |
| 193 | 3300037471 | Ga0395905_0282659 | Ga0395905_0282659_1053_1376 | 106 |
| 194 | 3300042130 | Ga0450892_017602 | Ga0450892_017602_35_358 | 106 |
| 195 | 3300042439 | Ga0439464_0008079 | Ga0439464_0008079_1462_1785 | 106 |
| 196 | 3300045051 | Ga0451576_0716956 | Ga0451576_0716956_411_731 | 106 |
| 197 | 3300049568 | Ga0501031_0001252 | Ga0501031_0001252_10939_11271 | 106 |
| 198 | 3300049569 | Ga0501032_0007845 | Ga0501032_0007845_3949_4281 | 106 |
| 199 | 3300049570 | Ga0501033_0229226 | Ga0501033_0229226_931_1263 | 106 |
| 200 | 3300049571 | Ga0501034_0010554 | Ga0501034_0010554_2240_2572 | 106 |
| 201 | 3300049572 | Ga0501036_0014087 | Ga0501036_0014087_3514_3846 | 106 |
| 202 | 3300049573 | Ga0501037_0006310 | Ga0501037_0006310_4186_4518 | 106 |
| 203 | 3300049574 | Ga0501038_0001341 | Ga0501038_0001341_16889_17221 | 106 |
| 204 | 3300049575 | Ga0501039_0017771 | Ga0501039_0017771_3794_4126 | 106 |
| 205 | 3300049579 | Ga0501043_0006766 | Ga0501043_0006766_4430_4762 | 106 |
| 206 | 3300049580 | Ga0501046_1134160 | Ga0501046_1134160_157_489 | 106 |
| 207 | 3300049581 | Ga0501047_0064445 | Ga0501047_0064445_565_897 | 106 |
| 208 | 3300049584 | Ga0501068_0415538 | Ga0501068_0415538_159_491 | 106 |
| 209 | 3300049589 | Ga0501073_0018135 | Ga0501073_0018135_290_622 | 106 |
| 210 | 3300049742 | Ga0501080_0018114 | Ga0501080_0018114_4382_4714 | 106 |
| 211 | 3300049822 | Ga0501035_0003375 | Ga0501035_0003375_4613_4945 | 106 |
| 212 | 3300049823 | Ga0501044_0003724 | Ga0501044_0003724_7649_7981 | 106 |
| 213 | 3300005327 | Ga0070658_10272390 | Ga0070658_102723902 | 107 |
| 214 | 3300005327 | Ga0070658_10397193 | Ga0070658_103971931 | 107 |
| 215 | 3300005328 | Ga0070676_10131889 | Ga0070676_101318893 | 107 |
| 216 | 3300005331 | Ga0070670_100904456 | Ga0070670_1009044561 | 107 |
| 217 | 3300005334 | Ga0068869_100597922 | Ga0068869_1005979222 | 107 |
| 218 | 3300005334 | Ga0068869_100841932 | Ga0068869_1008419322 | 107 |
| 219 | 3300005334 | Ga0068869_101534036 | Ga0068869_1015340361 | 107 |
| 220 | 3300005335 | Ga0070666_10000636 | Ga0070666_100006365 | 107 |
| 221 | 3300005335 | Ga0070666_10090072 | Ga0070666_100900722 | 107 |
| 222 | 3300005335 | Ga0070666_10119052 | Ga0070666_101190521 | 107 |
| 223 | 3300005335 | Ga0070666_10414349 | Ga0070666_104143492 | 107 |
| 224 | 3300005335 | Ga0070666_10666063 | Ga0070666_106660631 | 107 |
| 225 | 3300005335 | Ga0070666_10897491 | Ga0070666_108974911 | 107 |
| 226 | 3300005336 | Ga0070680_100923196 | Ga0070680_1009231962 | 107 |
| 227 | 3300005337 | Ga0070682_100129892 | Ga0070682_1001298923 | 107 |
| 228 | 3300005338 | Ga0068868_100277032 | Ga0068868_1002770321 | 107 |
| 229 | 3300005339 | Ga0070660_100135060 | Ga0070660_1001350602 | 107 |
| 230 | 3300005339 | Ga0070660_100625648 | Ga0070660_1006256481 | 107 |
| 231 | 3300005340 | Ga0070689_100278762 | Ga0070689_1002787621 | 107 |
| 232 | 3300005343 | Ga0070687_101121461 | Ga0070687_1011214611 | 107 |
| 233 | 3300005344 | Ga0070661_100069182 | Ga0070661_1000691823 | 107 |
| 234 | 3300005344 | Ga0070661_100087023 | Ga0070661_1000870233 | 107 |
| 235 | 3300005344 | Ga0070661_101930491 | Ga0070661_1019304911 | 107 |
| 236 | 3300005347 | Ga0070668_100156308 | Ga0070668_1001563081 | 107 |
| 237 | 3300005347 | Ga0070668_100626179 | Ga0070668_1006261792 | 107 |
| 238 | 3300005353 | Ga0070669_100023581 | Ga0070669_1000235811 | 107 |
| 239 | 3300005353 | Ga0070669_100285666 | Ga0070669_1002856663 | 107 |
| 240 | 3300005354 | Ga0070675_100045154 | Ga0070675_1000451542 | 107 |
| 241 | 3300005354 | Ga0070675_100127202 | Ga0070675_1001272022 | 107 |
| 242 | 3300005355 | Ga0070671_100009336 | Ga0070671_1000093365 | 107 |
| 243 | 3300005355 | Ga0070671_101163552 | Ga0070671_1011635521 | 107 |
| 244 | 3300005356 | Ga0070674_100077403 | Ga0070674_1000774032 | 107 |
| 245 | 3300005356 | Ga0070674_100197236 | Ga0070674_1001972362 | 107 |
| 246 | 3300005356 | Ga0070674_100298242 | Ga0070674_1002982421 | 107 |
| 247 | 3300005364 | Ga0070673_100095936 | Ga0070673_1000959363 | 107 |
| 248 | 3300005364 | Ga0070673_100166769 | Ga0070673_1001667693 | 107 |
| 249 | 3300005365 | Ga0070688_101450386 | Ga0070688_1014503861 | 107 |
| 250 | 3300005366 | Ga0070659_100017290 | Ga0070659_1000172902 | 107 |
| 251 | 3300005366 | Ga0070659_100126317 | Ga0070659_1001263173 | 107 |
| 252 | 3300005367 | Ga0070667_100048576 | Ga0070667_1000485763 | 107 |
| 253 | 3300005367 | Ga0070667_100478705 | Ga0070667_1004787052 | 107 |
| 254 | 3300005406 | Ga0070703_10583580 | Ga0070703_105835801 | 107 |
| 255 | 3300005434 | Ga0070709_10069274 | Ga0070709_100692744 | 107 |
| 256 | 3300005435 | Ga0070714_100005304 | Ga0070714_1000053043 | 107 |
| 257 | 3300005436 | Ga0070713_100011691 | Ga0070713_1000116917 | 107 |
| 258 | 3300005437 | Ga0070710_10041319 | Ga0070710_100413192 | 107 |
| 259 | 3300005439 | Ga0070711_100445960 | Ga0070711_1004459602 | 107 |
| 260 | 3300005440 | Ga0070705_100103281 | Ga0070705_1001032811 | 107 |
| 261 | 3300005440 | Ga0070705_100195073 | Ga0070705_1001950733 | 107 |
| 262 | 3300005444 | Ga0070694_100455891 | Ga0070694_1004558912 | 107 |
| 263 | 3300005445 | Ga0070708_100134519 | Ga0070708_1001345193 | 107 |
| 264 | 3300005445 | Ga0070708_100139381 | Ga0070708_1001393815 | 107 |
| 265 | 3300005445 | Ga0070708_100444039 | Ga0070708_1004440392 | 107 |
| 266 | 3300005445 | Ga0070708_100920982 | Ga0070708_1009209822 | 107 |
| 267 | 3300005455 | Ga0070663_100021261 | Ga0070663_1000212614 | 107 |
| 268 | 3300005455 | Ga0070663_100843328 | Ga0070663_1008433282 | 107 |
| 269 | 3300005455 | Ga0070663_101505556 | Ga0070663_1015055561 | 107 |
| 270 | 3300005456 | Ga0070678_100022303 | Ga0070678_1000223033 | 107 |
| 271 | 3300005456 | Ga0070678_100856209 | Ga0070678_1008562092 | 107 |
| 272 | 3300005457 | Ga0070662_100000154 | Ga0070662_10000015435 | 107 |
| 273 | 3300005458 | Ga0070681_10069911 | Ga0070681_100699113 | 107 |
| 274 | 3300005458 | Ga0070681_11156033 | Ga0070681_111560331 | 107 |
| 275 | 3300005459 | Ga0068867_100220338 | Ga0068867_1002203382 | 107 |
| 276 | 3300005466 | Ga0070685_10000386 | Ga0070685_1000038617 | 107 |
| 277 | 3300005466 | Ga0070685_11031465 | Ga0070685_110314651 | 107 |
| 278 | 3300005467 | Ga0070706_100002053 | Ga0070706_10000205311 | 107 |
| 279 | 3300005467 | Ga0070706_100028768 | Ga0070706_1000287689 | 107 |
| 280 | 3300005467 | Ga0070706_100047930 | Ga0070706_1000479305 | 107 |
| 281 | 3300005467 | Ga0070706_100209714 | Ga0070706_1002097142 | 107 |
| 282 | 3300005468 | Ga0070707_100028231 | Ga0070707_1000282313 | 107 |
| 283 | 3300005468 | Ga0070707_100061402 | Ga0070707_1000614025 | 107 |
| 284 | 3300005468 | Ga0070707_100147521 | Ga0070707_1001475213 | 107 |
| 285 | 3300005468 | Ga0070707_100379822 | Ga0070707_1003798222 | 107 |
| 286 | 3300005468 | Ga0070707_101218694 | Ga0070707_1012186941 | 107 |
| 287 | 3300005468 | Ga0070707_101873536 | Ga0070707_1018735361 | 107 |
| 288 | 3300005471 | Ga0070698_100112361 | Ga0070698_1001123612 | 107 |
| 289 | 3300005471 | Ga0070698_100146183 | Ga0070698_1001461833 | 107 |
| 290 | 3300005471 | Ga0070698_100568989 | Ga0070698_1005689892 | 107 |
| 291 | 3300005471 | Ga0070698_100830500 | Ga0070698_1008305002 | 107 |
| 292 | 3300005471 | Ga0070698_101495844 | Ga0070698_1014958442 | 107 |
| 293 | 3300005518 | Ga0070699_100087009 | Ga0070699_1000870092 | 107 |
| 294 | 3300005518 | Ga0070699_101811505 | Ga0070699_1018115051 | 107 |
| 295 | 3300005530 | Ga0070679_100224296 | Ga0070679_1002242964 | 107 |
| 296 | 3300005530 | Ga0070679_100469610 | Ga0070679_1004696102 | 107 |
| 297 | 3300005530 | Ga0070679_100883029 | Ga0070679_1008830291 | 107 |
| 298 | 3300005530 | Ga0070679_101150169 | Ga0070679_1011501692 | 107 |
| 299 | 3300005536 | Ga0070697_100384743 | Ga0070697_1003847433 | 107 |
| 300 | 3300005536 | Ga0070697_100402652 | Ga0070697_1004026521 | 107 |
| 301 | 3300005536 | Ga0070697_100521067 | Ga0070697_1005210672 | 107 |
| 302 | 3300005539 | Ga0068853_100001874 | Ga0068853_10000187412 | 107 |
| 303 | 3300005539 | Ga0068853_100015663 | Ga0068853_1000156633 | 107 |
| 304 | 3300005539 | Ga0068853_100075241 | Ga0068853_1000752416 | 107 |
| 305 | 3300005539 | Ga0068853_100106557 | Ga0068853_1001065573 | 107 |
| 306 | 3300005543 | Ga0070672_100212236 | Ga0070672_1002122363 | 107 |
| 307 | 3300005543 | Ga0070672_100378111 | Ga0070672_1003781112 | 107 |
| 308 | 3300005545 | Ga0070695_100617066 | Ga0070695_1006170661 | 107 |
| 309 | 3300005546 | Ga0070696_100003306 | Ga0070696_1000033064 | 107 |
| 310 | 3300005546 | Ga0070696_100070656 | Ga0070696_1000706562 | 107 |
| 311 | 3300005546 | Ga0070696_101721397 | Ga0070696_1017213972 | 107 |
| 312 | 3300005547 | Ga0070693_100187558 | Ga0070693_1001875582 | 107 |
| 313 | 3300005548 | Ga0070665_100029190 | Ga0070665_1000291903 | 107 |
| 314 | 3300005549 | Ga0070704_100468253 | Ga0070704_1004682532 | 107 |
| 315 | 3300005563 | Ga0068855_100013724 | Ga0068855_1000137247 | 107 |
| 316 | 3300005563 | Ga0068855_102330044 | Ga0068855_1023300441 | 107 |
| 317 | 3300005564 | Ga0070664_100001161 | Ga0070664_1000011612 | 107 |
| 318 | 3300005577 | Ga0068857_100723888 | Ga0068857_1007238882 | 107 |
| 319 | 3300005578 | Ga0068854_100051915 | Ga0068854_1000519153 | 107 |
| 320 | 3300005614 | Ga0068856_100001030 | Ga0068856_1000010307 | 107 |
| 321 | 3300005616 | Ga0068852_100063380 | Ga0068852_1000633803 | 107 |
| 322 | 3300005616 | Ga0068852_100084085 | Ga0068852_1000840853 | 107 |
| 323 | 3300005616 | Ga0068852_100710113 | Ga0068852_1007101132 | 107 |
| 324 | 3300005617 | Ga0068859_100435086 | Ga0068859_1004350863 | 107 |
| 325 | 3300005618 | Ga0068864_100046469 | Ga0068864_1000464697 | 107 |
| 326 | 3300005719 | Ga0068861_100531705 | Ga0068861_1005317052 | 107 |
| 327 | 3300005834 | Ga0068851_10022844 | Ga0068851_100228443 | 107 |
| 328 | 3300005840 | Ga0068870_10041766 | Ga0068870_100417661 | 107 |
| 329 | 3300005841 | Ga0068863_100000329 | Ga0068863_1000003296 | 107 |
| 330 | 3300005841 | Ga0068863_100337055 | Ga0068863_1003370553 | 107 |
| 331 | 3300005841 | Ga0068863_100733872 | Ga0068863_1007338722 | 107 |
| 332 | 3300005842 | Ga0068858_100156266 | Ga0068858_1001562662 | 107 |
| 333 | 3300005843 | Ga0068860_100005962 | Ga0068860_10000596210 | 107 |
| 334 | 3300005843 | Ga0068860_101596453 | Ga0068860_1015964532 | 107 |
| 335 | 3300006042 | Ga0075368_10030922 | Ga0075368_100309223 | 107 |
| 336 | 3300006048 | Ga0075363_100324429 | Ga0075363_1003244292 | 107 |
| 337 | 3300006173 | Ga0070716_100141982 | Ga0070716_1001419821 | 107 |
| 338 | 3300006178 | Ga0075367_10042468 | Ga0075367_100424682 | 107 |
| 339 | 3300006195 | Ga0075366_10016688 | Ga0075366_100166884 | 107 |
| 340 | 3300006237 | Ga0097621_100181762 | Ga0097621_1001817622 | 107 |
| 341 | 3300006237 | Ga0097621_100892723 | Ga0097621_1008927233 | 107 |
| 342 | 3300006353 | Ga0075370_10004816 | Ga0075370_100048165 | 107 |
| 343 | 3300006358 | Ga0068871_100130524 | Ga0068871_1001305242 | 107 |
| 344 | 3300006358 | Ga0068871_100601522 | Ga0068871_1006015221 | 107 |
| 345 | 3300006358 | Ga0068871_101243385 | Ga0068871_1012433852 | 107 |
| 346 | 3300006871 | Ga0075434_101017625 | Ga0075434_1010176251 | 107 |
| 347 | 3300006881 | Ga0068865_100063178 | Ga0068865_1000631781 | 107 |
| 348 | 3300006931 | Ga0097620_100435122 | Ga0097620_1004351223 | 107 |
| 349 | 3300009093 | Ga0105240_10000453 | Ga0105240_1000045326 | 107 |
| 350 | 3300009093 | Ga0105240_11096088 | Ga0105240_110960882 | 107 |
| 351 | 3300009101 | Ga0105247_10553859 | Ga0105247_105538592 | 107 |
| 352 | 3300009147 | Ga0114129_10275039 | Ga0114129_102750395 | 107 |
| 353 | 3300009174 | Ga0105241_12012794 | Ga0105241_120127941 | 107 |
| 354 | 3300009176 | Ga0105242_10032861 | Ga0105242_100328613 | 107 |
| 355 | 3300009176 | Ga0105242_10596970 | Ga0105242_105969702 | 107 |
| 356 | 3300009176 | Ga0105242_10912695 | Ga0105242_109126952 | 107 |
| 357 | 3300009177 | Ga0105248_10139127 | Ga0105248_101391272 | 107 |
| 358 | 3300009545 | Ga0105237_11163351 | Ga0105237_111633512 | 107 |
| 359 | 3300009551 | Ga0105238_10013371 | Ga0105238_100133716 | 107 |
| 360 | 3300010375 | Ga0105239_10008231 | Ga0105239_100082315 | 107 |
| 361 | 3300010375 | Ga0105239_10147889 | Ga0105239_101478892 | 107 |
| 362 | 3300010375 | Ga0105239_12011044 | Ga0105239_120110441 | 107 |
| 363 | 3300010375 | Ga0105239_12393319 | Ga0105239_123933191 | 107 |
| 364 | 3300011119 | Ga0105246_10299250 | Ga0105246_102992502 | 107 |
| 365 | 3300013102 | Ga0157371_10537674 | Ga0157371_105376742 | 107 |
| 366 | 3300013104 | Ga0157370_10064504 | Ga0157370_100645043 | 107 |
| 367 | 3300013104 | Ga0157370_10132893 | Ga0157370_101328932 | 107 |
| 368 | 3300013105 | Ga0157369_10013038 | Ga0157369_100130388 | 107 |
| 369 | 3300013105 | Ga0157369_10323733 | Ga0157369_103237332 | 107 |
| 370 | 3300013296 | Ga0157374_10096901 | Ga0157374_100969014 | 107 |
| 371 | 3300013297 | Ga0157378_10000042 | Ga0157378_1000004287 | 107 |
| 372 | 3300013297 | Ga0157378_10326728 | Ga0157378_103267282 | 107 |
| 373 | 3300013306 | Ga0163162_10014416 | Ga0163162_100144164 | 107 |
| 374 | 3300013306 | Ga0163162_10344519 | Ga0163162_103445192 | 107 |
| 375 | 3300013306 | Ga0163162_10431279 | Ga0163162_104312792 | 107 |
| 376 | 3300013306 | Ga0163162_11327730 | Ga0163162_113277302 | 107 |
| 377 | 3300013307 | Ga0157372_10185107 | Ga0157372_101851072 | 107 |
| 378 | 3300013307 | Ga0157372_10415002 | Ga0157372_104150022 | 107 |
| 379 | 3300013307 | Ga0157372_11712346 | Ga0157372_117123461 | 107 |
| 380 | 3300013308 | Ga0157375_10001312 | Ga0157375_100013128 | 107 |
| 381 | 3300013308 | Ga0157375_10865063 | Ga0157375_108650632 | 107 |
| 382 | 3300013308 | Ga0157375_10943783 | Ga0157375_109437833 | 107 |
| 383 | 3300014325 | Ga0163163_10000589 | Ga0163163_100005892 | 107 |
| 384 | 3300014325 | Ga0163163_10037145 | Ga0163163_100371453 | 107 |
| 385 | 3300014325 | Ga0163163_10061254 | Ga0163163_100612545 | 107 |
| 386 | 3300014968 | Ga0157379_10000908 | Ga0157379_1000090822 | 107 |
| 387 | 3300014968 | Ga0157379_10037939 | Ga0157379_100379395 | 107 |
| 388 | 3300014968 | Ga0157379_10444677 | Ga0157379_104446772 | 107 |
| 389 | 3300014969 | Ga0157376_10002712 | Ga0157376_100027127 | 107 |
| 390 | 3300014969 | Ga0157376_10011163 | Ga0157376_100111634 | 107 |
| 391 | 3300014969 | Ga0157376_10712493 | Ga0157376_107124932 | 107 |
| 392 | 3300014969 | Ga0157376_11519898 | Ga0157376_115198982 | 107 |
| 393 | 3300025885 | Ga0207653_10166747 | Ga0207653_101667472 | 107 |
| 394 | 3300025898 | Ga0207692_10022970 | Ga0207692_100229704 | 107 |
| 395 | 3300025898 | Ga0207692_10639495 | Ga0207692_106394952 | 107 |
| 396 | 3300025898 | Ga0207692_10892490 | Ga0207692_108924901 | 107 |
| 397 | 3300025903 | Ga0207680_10073742 | Ga0207680_100737422 | 107 |
| 398 | 3300025903 | Ga0207680_10241176 | Ga0207680_102411762 | 107 |
| 399 | 3300025903 | Ga0207680_10384178 | Ga0207680_103841782 | 107 |
| 400 | 3300025903 | Ga0207680_10459526 | Ga0207680_104595262 | 107 |
| 401 | 3300025906 | Ga0207699_10041423 | Ga0207699_100414232 | 107 |
| 402 | 3300025906 | Ga0207699_10053262 | Ga0207699_100532623 | 107 |
| 403 | 3300025906 | Ga0207699_11024696 | Ga0207699_110246961 | 107 |
| 404 | 3300025907 | Ga0207645_10164774 | Ga0207645_101647742 | 107 |
| 405 | 3300025908 | Ga0207643_10007592 | Ga0207643_100075924 | 107 |
| 406 | 3300025909 | Ga0207705_10311711 | Ga0207705_103117112 | 107 |
| 407 | 3300025910 | Ga0207684_10002473 | Ga0207684_100024739 | 107 |
| 408 | 3300025910 | Ga0207684_10081385 | Ga0207684_100813851 | 107 |
| 409 | 3300025910 | Ga0207684_10155359 | Ga0207684_101553592 | 107 |
| 410 | 3300025910 | Ga0207684_10623371 | Ga0207684_106233712 | 107 |
| 411 | 3300025911 | Ga0207654_10214091 | Ga0207654_102140912 | 107 |
| 412 | 3300025912 | Ga0207707_10353790 | Ga0207707_103537901 | 107 |
| 413 | 3300025912 | Ga0207707_11367477 | Ga0207707_113674771 | 107 |
| 414 | 3300025912 | Ga0207707_11433951 | Ga0207707_114339511 | 107 |
| 415 | 3300025913 | Ga0207695_10000172 | Ga0207695_10000172141 | 107 |
| 416 | 3300025914 | Ga0207671_10854415 | Ga0207671_108544152 | 107 |
| 417 | 3300025914 | Ga0207671_11067904 | Ga0207671_110679041 | 107 |
| 418 | 3300025914 | Ga0207671_11377506 | Ga0207671_113775062 | 107 |
| 419 | 3300025915 | Ga0207693_10036438 | Ga0207693_100364383 | 107 |
| 420 | 3300025916 | Ga0207663_10519965 | Ga0207663_105199651 | 107 |
| 421 | 3300025916 | Ga0207663_10723546 | Ga0207663_107235462 | 107 |
| 422 | 3300025917 | Ga0207660_10284188 | Ga0207660_102841882 | 107 |
| 423 | 3300025917 | Ga0207660_10986309 | Ga0207660_109863092 | 107 |
| 424 | 3300025919 | Ga0207657_10000410 | Ga0207657_1000041027 | 107 |
| 425 | 3300025922 | Ga0207646_10029934 | Ga0207646_100299343 | 107 |
| 426 | 3300025922 | Ga0207646_10490522 | Ga0207646_104905222 | 107 |
| 427 | 3300025922 | Ga0207646_10556174 | Ga0207646_105561742 | 107 |
| 428 | 3300025922 | Ga0207646_10612296 | Ga0207646_106122962 | 107 |
| 429 | 3300025922 | Ga0207646_10692131 | Ga0207646_106921312 | 107 |
| 430 | 3300025922 | Ga0207646_11211680 | Ga0207646_112116802 | 107 |
| 431 | 3300025922 | Ga0207646_11326534 | Ga0207646_113265342 | 107 |
| 432 | 3300025923 | Ga0207681_10041657 | Ga0207681_100416571 | 107 |
| 433 | 3300025923 | Ga0207681_11273904 | Ga0207681_112739041 | 107 |
| 434 | 3300025924 | Ga0207694_10005258 | Ga0207694_100052588 | 107 |
| 435 | 3300025925 | Ga0207650_10261114 | Ga0207650_102611142 | 107 |
| 436 | 3300025925 | Ga0207650_10639639 | Ga0207650_106396391 | 107 |
| 437 | 3300025926 | Ga0207659_10220803 | Ga0207659_102208032 | 107 |
| 438 | 3300025927 | Ga0207687_10841326 | Ga0207687_108413261 | 107 |
| 439 | 3300025928 | Ga0207700_10108644 | Ga0207700_101086443 | 107 |
| 440 | 3300025929 | Ga0207664_10003726 | Ga0207664_100037262 | 107 |
| 441 | 3300025931 | Ga0207644_10173377 | Ga0207644_101733773 | 107 |
| 442 | 3300025931 | Ga0207644_11061952 | Ga0207644_110619521 | 107 |
| 443 | 3300025932 | Ga0207690_10011451 | Ga0207690_100114513 | 107 |
| 444 | 3300025933 | Ga0207706_10000508 | Ga0207706_100005084 | 107 |
| 445 | 3300025934 | Ga0207686_10016819 | Ga0207686_100168192 | 107 |
| 446 | 3300025934 | Ga0207686_10685019 | Ga0207686_106850192 | 107 |
| 447 | 3300025936 | Ga0207670_10821577 | Ga0207670_108215771 | 107 |
| 448 | 3300025937 | Ga0207669_11492295 | Ga0207669_114922951 | 107 |
| 449 | 3300025938 | Ga0207704_10042757 | Ga0207704_100427571 | 107 |
| 450 | 3300025938 | Ga0207704_10156433 | Ga0207704_101564332 | 107 |
| 451 | 3300025939 | Ga0207665_10117859 | Ga0207665_101178593 | 107 |
| 452 | 3300025940 | Ga0207691_10006401 | Ga0207691_100064015 | 107 |
| 453 | 3300025940 | Ga0207691_10374699 | Ga0207691_103746993 | 107 |
| 454 | 3300025941 | Ga0207711_10021731 | Ga0207711_100217313 | 107 |
| 455 | 3300025941 | Ga0207711_11339957 | Ga0207711_113399572 | 107 |
| 456 | 3300025942 | Ga0207689_10358764 | Ga0207689_103587642 | 107 |
| 457 | 3300025942 | Ga0207689_11196571 | Ga0207689_111965712 | 107 |
| 458 | 3300025945 | Ga0207679_10155612 | Ga0207679_101556122 | 107 |
| 459 | 3300025949 | Ga0207667_10011351 | Ga0207667_100113513 | 107 |
| 460 | 3300025960 | Ga0207651_10098854 | Ga0207651_100988542 | 107 |
| 461 | 3300025960 | Ga0207651_10131940 | Ga0207651_101319402 | 107 |
| 462 | 3300025972 | Ga0207668_10130335 | Ga0207668_101303352 | 107 |
| 463 | 3300025981 | Ga0207640_10029596 | Ga0207640_100295963 | 107 |
| 464 | 3300025981 | Ga0207640_10558153 | Ga0207640_105581531 | 107 |
| 465 | 3300025981 | Ga0207640_10653140 | Ga0207640_106531402 | 107 |
| 466 | 3300025981 | Ga0207640_11525181 | Ga0207640_115251812 | 107 |
| 467 | 3300025986 | Ga0207658_10105428 | Ga0207658_101054283 | 107 |
| 468 | 3300025986 | Ga0207658_10209934 | Ga0207658_102099342 | 107 |
| 469 | 3300025986 | Ga0207658_10220671 | Ga0207658_102206712 | 107 |
| 470 | 3300026035 | Ga0207703_10196724 | Ga0207703_101967243 | 107 |
| 471 | 3300026035 | Ga0207703_10200804 | Ga0207703_102008043 | 107 |
| 472 | 3300026041 | Ga0207639_10011910 | Ga0207639_100119106 | 107 |
| 473 | 3300026041 | Ga0207639_10076822 | Ga0207639_100768223 | 107 |
| 474 | 3300026041 | Ga0207639_10108899 | Ga0207639_101088991 | 107 |
| 475 | 3300026067 | Ga0207678_10008780 | Ga0207678_100087808 | 107 |
| 476 | 3300026067 | Ga0207678_10800936 | Ga0207678_108009362 | 107 |
| 477 | 3300026078 | Ga0207702_10107187 | Ga0207702_101071872 | 107 |
| 478 | 3300026088 | Ga0207641_10201357 | Ga0207641_102013572 | 107 |
| 479 | 3300026088 | Ga0207641_10717756 | Ga0207641_107177562 | 107 |
| 480 | 3300026089 | Ga0207648_10052227 | Ga0207648_100522273 | 107 |
| 481 | 3300026095 | Ga0207676_10005851 | Ga0207676_1000585110 | 107 |
| 482 | 3300026118 | Ga0207675_100610960 | Ga0207675_1006109601 | 107 |
| 483 | 3300026121 | Ga0207683_10010399 | Ga0207683_100103995 | 107 |
| 484 | 3300026121 | Ga0207683_10086731 | Ga0207683_100867312 | 107 |
| 485 | 3300026142 | Ga0207698_10032088 | Ga0207698_100320882 | 107 |
| 486 | 3300026142 | Ga0207698_10035662 | Ga0207698_100356623 | 107 |
| 487 | 3300026142 | Ga0207698_10111151 | Ga0207698_101111512 | 107 |
| 488 | 3300026142 | Ga0207698_10609518 | Ga0207698_106095181 | 107 |
| 489 | 3300028379 | Ga0268266_10878478 | Ga0268266_108784782 | 107 |
| 490 | 3300028379 | Ga0268266_11724295 | Ga0268266_117242951 | 107 |
| 491 | 3300028381 | Ga0268264_10005817 | Ga0268264_1000581714 | 107 |
| 492 | 3300028381 | Ga0268264_10251770 | Ga0268264_102517702 | 107 |
| 493 | 3300028381 | Ga0268264_10907459 | Ga0268264_109074592 | 107 |
| 494 | 3300031247 | Ga0265340_10027094 | Ga0265340_100270944 | 107 |
| 495 | 3300031616 | Ga0307508_10431975 | Ga0307508_104319752 | 107 |
| 496 | 3300031730 | Ga0307516_10022332 | Ga0307516_100223324 | 107 |
| 497 | 3300031730 | Ga0307516_10121219 | Ga0307516_101212193 | 107 |
| 498 | 3300031731 | Ga0307405_10085482 | Ga0307405_100854822 | 107 |
| 499 | 3300031995 | Ga0307409_102296735 | Ga0307409_1022967351 | 107 |
| 500 | 3300032002 | Ga0307416_100791770 | Ga0307416_1007917701 | 107 |
| 501 | 3300032004 | Ga0307414_11577044 | Ga0307414_115770442 | 107 |
| 502 | 3300035089 | Ga0373944_0017219 | Ga0373944_0017219_526_855 | 107 |
| 503 | 3300035091 | Ga0373951_0289890 | Ga0373951_0289890_20_343 | 107 |
| 504 | 3300035114 | Ga0373939_0345818 | Ga0373939_0345818_250_588 | 107 |
| 505 | 3300035172 | Ga0373955_0728616 | Ga0373955_0728616_162_488 | 107 |
| 506 | 3300035242 | Ga0373962_0341069 | Ga0373962_0341069_50_388 | 107 |
| 507 | 3300035695 | Ga0373927_0026714 | Ga0373927_0026714_740_1063 | 107 |
| 508 | 3300035724 | Ga0373933_0213179 | Ga0373933_0213179_403_732 | 107 |
| 509 | 3300035724 | Ga0373933_1143229 | Ga0373933_1143229_171_494 | 107 |
| 510 | 3300036401 | Ga0373937_0060919 | Ga0373937_0060919_2140_2466 | 107 |
| 511 | 3300036401 | Ga0373937_2112024 | Ga0373937_2112024_158_481 | 107 |
| 512 | 3300037068 | Ga0373925_0114439 | Ga0373925_0114439_719_1042 | 107 |
| 513 | 3300037418 | Ga0395900_0723081 | Ga0395900_0723081_248_586 | 107 |
| 514 | 3300041404 | Ga0439436_0143599 | Ga0439436_0143599_251_595 | 107 |
| 515 | 3300041443 | Ga0451789_1207264 | Ga0451789_1207264_149_472 | 107 |
| 516 | 3300041443 | Ga0451789_1245254 | Ga0451789_1245254_304_630 | 107 |
| 517 | 3300041451 | Ga0451791_1900911 | Ga0451791_1900911_91_417 | 107 |
| 518 | 3300041452 | Ga0451793_1068317 | Ga0451793_1068317_750_1076 | 107 |
| 519 | 3300041460 | Ga0451802_1126562 | Ga0451802_1126562_644_970 | 107 |
| 520 | 3300041492 | Ga0451835_0424047 | Ga0451835_0424047_14_343 | 107 |
| 521 | 3300041512 | Ga0451853_3002975 | Ga0451853_3002975_304_633 | 107 |
| 522 | 3300042006 | Ga0439432_056911 | Ga0439432_056911_211_552 | 107 |
| 523 | 3300046454 | Ga0495592_0453828 | Ga0495592_0453828_94_423 | 107 |
| 524 | 3300046472 | Ga0495580_0203665 | Ga0495580_0203665_941_1270 | 107 |
| 525 | 3300046472 | Ga0495580_0328574 | Ga0495580_0328574_634_957 | 107 |
| 526 | 3300046473 | Ga0495582_0039275 | Ga0495582_0039275_826_1155 | 107 |
| 527 | 3300046477 | Ga0495664_0030767 | Ga0495664_0030767_2767_3090 | 107 |
| 528 | 3300046516 | Ga0495628_0117503 | Ga0495628_0117503_1370_1693 | 107 |
| 529 | 3300046535 | Ga0495586_0065544 | Ga0495586_0065544_931_1254 | 107 |
| 530 | 3300046535 | Ga0495586_0177840 | Ga0495586_0177840_468_797 | 107 |
| 531 | 3300046543 | Ga0495645_0030665 | Ga0495645_0030665_3527_3850 | 107 |
| 532 | 3300046681 | Ga0495647_0438914 | Ga0495647_0438914_179_508 | 107 |
| 533 | 3300046683 | Ga0495658_0007304 | Ga0495658_0007304_1602_1931 | 107 |
| 534 | 3300047319 | Ga0495674_0318176 | Ga0495674_0318176_852_1181 | 107 |
| 535 | 3300047321 | Ga0495676_0609252 | Ga0495676_0609252_366_695 | 107 |
| 536 | 3300047471 | Ga0495684_0759877 | Ga0495684_0759877_224_553 | 107 |
| 537 | 3300048907 | Ga0496104_0000016 | Ga0496104_0000016_102798_103127 | 107 |
| 538 | 3300048908 | Ga0496105_0000010 | Ga0496105_0000010_108502_108831 | 107 |
| 539 | 3300048909 | Ga0496106_0332564 | Ga0496106_0332564_326_649 | 107 |
| 540 | 3300048920 | Ga0496117_0106840 | Ga0496117_0106840_988_1314 | 107 |
| 541 | 3300048921 | Ga0496118_0006022 | Ga0496118_0006022_12064_12390 | 107 |
| 542 | 3300048929 | Ga0496126_0780083 | Ga0496126_0780083_121_447 | 107 |
| 543 | 3300049568 | Ga0501031_0140612 | Ga0501031_0140612_714_1040 | 107 |
| 544 | 3300049569 | Ga0501032_0099742 | Ga0501032_0099742_181_507 | 107 |
| 545 | 3300049571 | Ga0501034_0000923 | Ga0501034_0000923_24584_24949 | 107 |
| 546 | 3300049571 | Ga0501034_0001491 | Ga0501034_0001491_13692_14018 | 107 |
| 547 | 3300049571 | Ga0501034_0504307 | Ga0501034_0504307_746_1084 | 107 |
| 548 | 3300049573 | Ga0501037_0189290 | Ga0501037_0189290_375_722 | 107 |
| 549 | 3300049573 | Ga0501037_0467309 | Ga0501037_0467309_212_538 | 107 |
| 550 | 3300049574 | Ga0501038_0242783 | Ga0501038_0242783_736_1083 | 107 |
| 551 | 3300049574 | Ga0501038_0300176 | Ga0501038_0300176_69_395 | 107 |
| 552 | 3300049578 | Ga0501042_0228635 | Ga0501042_0228635_207_557 | 107 |
| 553 | 3300049578 | Ga0501042_0733834 | Ga0501042_0733834_257_604 | 107 |
| 554 | 3300049579 | Ga0501043_0071732 | Ga0501043_0071732_919_1245 | 107 |
| 555 | 3300049579 | Ga0501043_0181532 | Ga0501043_0181532_753_1100 | 107 |
| 556 | 3300049579 | Ga0501043_0943949 | Ga0501043_0943949_149_475 | 107 |
| 557 | 3300049580 | Ga0501046_0183151 | Ga0501046_0183151_1195_1545 | 107 |
| 558 | 3300049580 | Ga0501046_0191909 | Ga0501046_0191909_1051_1377 | 107 |
| 559 | 3300049581 | Ga0501047_0003974 | Ga0501047_0003974_8398_8724 | 107 |
| 560 | 3300049581 | Ga0501047_0013119 | Ga0501047_0013119_3205_3555 | 107 |
| 561 | 3300049581 | Ga0501047_0082590 | Ga0501047_0082590_2437_2763 | 107 |
| 562 | 3300049583 | Ga0501067_0373704 | Ga0501067_0373704_253_603 | 107 |
| 563 | 3300049584 | Ga0501068_0227222 | Ga0501068_0227222_175_522 | 107 |
| 564 | 3300049585 | Ga0501069_0308199 | Ga0501069_0308199_75_401 | 107 |
| 565 | 3300049586 | Ga0501070_0003066 | Ga0501070_0003066_8400_8726 | 107 |
| 566 | 3300049586 | Ga0501070_0015472 | Ga0501070_0015472_1449_1775 | 107 |
| 567 | 3300049586 | Ga0501070_0247823 | Ga0501070_0247823_375_722 | 107 |
| 568 | 3300049589 | Ga0501073_0044855 | Ga0501073_0044855_1227_1553 | 107 |
| 569 | 3300049589 | Ga0501073_0443259 | Ga0501073_0443259_375_722 | 107 |
| 570 | 3300049590 | Ga0501074_0029954 | Ga0501074_0029954_445_792 | 107 |
| 571 | 3300049590 | Ga0501074_0058025 | Ga0501074_0058025_918_1244 | 107 |
| 572 | 3300049590 | Ga0501074_0157097 | Ga0501074_0157097_564_890 | 107 |
| 573 | 3300049592 | Ga0501076_1393938 | Ga0501076_1393938_33_383 | 107 |
| 574 | 3300049741 | Ga0501079_0068466 | Ga0501079_0068466_1048_1374 | 107 |
| 575 | 3300049741 | Ga0501079_0434614 | Ga0501079_0434614_612_959 | 107 |
| 576 | 3300049742 | Ga0501080_0006631 | Ga0501080_0006631_8398_8724 | 107 |
| 577 | 3300049742 | Ga0501080_0042144 | Ga0501080_0042144_2492_2842 | 107 |
| 578 | 3300049742 | Ga0501080_0081702 | Ga0501080_0081702_1351_1677 | 107 |
| 579 | 3300049742 | Ga0501080_0104707 | Ga0501080_0104707_719_1057 | 107 |
| 580 | 3300049742 | Ga0501080_0574573 | Ga0501080_0574573_471_818 | 107 |
| 581 | 3300049742 | Ga0501080_0642476 | Ga0501080_0642476_233_583 | 107 |
| 582 | 3300049744 | Ga0501083_0352072 | Ga0501083_0352072_453_800 | 107 |
| 583 | 3300049822 | Ga0501035_0453675 | Ga0501035_0453675_379_729 | 107 |
| 584 | 3300049822 | Ga0501035_0849303 | Ga0501035_0849303_79_405 | 107 |
| 585 | 3300049823 | Ga0501044_0048721 | Ga0501044_0048721_3925_4275 | 107 |
| 586 | 3300049823 | Ga0501044_0050777 | Ga0501044_0050777_2756_3082 | 107 |
| 587 | 3300049824 | Ga0501045_0129400 | Ga0501045_0129400_99_446 | 107 |
| 588 | 3300049824 | Ga0501045_0421562 | Ga0501045_0421562_183_509 | 107 |
| 589 | 3300050493 | nmdc:mga0k408_39917_c1 | nmdc:mga0k408_39917_c1_897_1238 | 107 |
| 590 | 3300050494 | nmdc:mga06z11_194346_c1 | nmdc:mga06z11_194346_c1_569_910 | 107 |
| 591 | 3300050495 | nmdc:mga04h51_19027_c1 | nmdc:mga04h51_19027_c1_1513_1854 | 107 |
| 592 | 3300050496 | nmdc:mga07m45_66517_c1 | nmdc:mga07m45_66517_c1_193_534 | 107 |
| 593 | 3300050512 | nmdc:mga0n895_937279_c1 | nmdc:mga0n895_937279_c1_452_775 | 107 |
| 594 | 3300050514 | nmdc:mga08x19_12435_c1 | nmdc:mga08x19_12435_c1_1993_2316 | 107 |
| 595 | 3300050516 | nmdc:mga0sz30_127518_c1 | nmdc:mga0sz30_127518_c1_31_372 | 107 |
| 596 | 3300053077 | Ga0495601_0442072 | Ga0495601_0442072_286_609 | 107 |
| 597 | 3300053094 | Ga0500566_0355859 | Ga0500566_0355859_14_343 | 107 |
| 598 | 3300060353 | Ga0501082_1078460 | Ga0501082_1078460_357_683 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.8711 | 1 | 102 |
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.8621 | 1 | 102 |
| 2dcl-assembly1.cif.gz_B-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8555 | 4 | 98 |
| 2dcl-assembly1.cif.gz_C-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.852 | 1 | 98 |
| 2dcl-assembly1.cif.gz_A-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8112 | 4 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8712 | 1 | 102 | 3.30.70.120 |
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8619 | 1 | 102 | 3.30.70.120 |
| 2dclC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.852 | 1 | 98 | 3.30.70.120 |
| 2dclC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7786 | 1 | 98 | 3.30.70.120 |
| af_P95087_243_367_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7754 | 2 | 103 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522N5V7-F1-model_v4 | DUF190 domain-containing protein | 0.8867 | 1 | 107 |
|
| AF-A0A522N5V7-F1-model_v4 | DUF190 domain-containing protein | 0.879 | 1 | 107 |
|
| AF-A0A317MWU0-F1-model_v4 | PII-like signaling protein | 0.8753 | 1 | 105 |
|
| AF-A0A6H9Y6R3-F1-model_v4 | DUF190 domain-containing protein | 0.8663 | 1 | 104 |
|
| AF-A0A1G0BWK5-F1-model_v4 | Uncharacterized protein | 0.864 | 4 | 103 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar