F467795
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 257 | 579 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300025986|Ga0207658_10211175|Ga0207658_102111753 |
| Length | 256 |
| Sequence | MLCKVAARIGLHFSIRPDCTLFNIPSFLYICRSNPCMKIHKEGFKIIVITAILFALINLVSFYFVSFHYPIISWLIFIVTMGLLLFIISFFRQPARELTSGENLVICPADGKVVVIEEMFDTEYFNSKRLQVSIFMSPANVHVNRNPISGQVVYNKYHKGKYLVAWNPKSSTENERHSVVIRHSTSDILVKQIAGALAKRIKNYLEVGQQVQQNNELGFIRFGSRVDVLLPVGTTVNVQLNQVVKGGVTVLATLKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 4 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 5 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 6 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 7 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 8 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 9 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 10 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 11 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 12 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 13 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 14 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 15 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 16 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 17 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 18 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 27 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 177 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 195 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 198 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 199 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 200 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 201 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 227 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 228 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 233 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 239 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 240 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 241 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 242 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 243 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 244 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 245 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 246 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 247 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 248 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 249 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 250 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 251 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 252 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 253 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 254 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 255 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 256 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 257 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.82 |
| Metatranscriptomes | 0 |
| Isolates | 3.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.03 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 82.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007320 | 3300001979 | Bacteria | 4497 |
| 2 | JGI24739J22299_10000030 | 3300001989 | Bacteria | 39896 |
| 3 | JGI24739J22299_10108048 | 3300001989 | Unclassified | 836 |
| 4 | JGI25158J39367_1014901 | 3300002739 | Bacteria | 1000 |
| 5 | JGI25153J46596_10011676 | 3300003215 | Bacteria | 3861 |
| 6 | JGI25153J46596_10017765 | 3300003215 | Bacteria | 2789 |
| 7 | rootH2_10001429 | 3300003320 | Bacteria | 14331 |
| 8 | rootH2_10035434 | 3300003320 | Bacteria | 17210 |
| 9 | rootH2_10064945 | 3300003320 | Bacteria | 3949 |
| 10 | rootH2_10093065 | 3300003320 | Bacteria | 1394 |
| 11 | rootL2_10008865 | 3300003322 | Bacteria | 21299 |
| 12 | rootL2_10026021 | 3300003322 | Bacteria | 20401 |
| 13 | rootL2_10129454 | 3300003322 | Bacteria | 5168 |
| 14 | rootH1_10007189 | 3300003323 | Bacteria | 65578 |
| 15 | rootH1_10052389 | 3300003323 | Bacteria | 2098 |
| 16 | rootH1_10093904 | 3300003323 | Bacteria | 2880 |
| 17 | JGI25160J50197_1001552 | 3300003354 | Bacteria | 11373 |
| 18 | JGI25160J50197_1011107 | 3300003354 | Bacteria | 3212 |
| 19 | Ga0055535_1008804 | 3300003761 | Bacteria | 1786 |
| 20 | Ga0055526_1022488 | 3300003771 | Bacteria | 2141 |
| 21 | Ga0055528_1001162 | 3300003790 | Bacteria | 17034 |
| 22 | Ga0055530_10000185 | 3300003791 | Bacteria | 55895 |
| 23 | Ga0055531_10000080 | 3300003794 | Bacteria | 103922 |
| 24 | Ga0065165_1000658 | 3300005262 | Bacteria | 49852 |
| 25 | Ga0065704_10091350 | 3300005289 | Bacteria | 2723 |
| 26 | Ga0070658_10006533 | 3300005327 | Bacteria | 9462 |
| 27 | Ga0070658_10201064 | 3300005327 | Unclassified | 1681 |
| 28 | Ga0070658_10376000 | 3300005327 | Bacteria | 1218 |
| 29 | Ga0070683_100038010 | 3300005329 | Bacteria | 4410 |
| 30 | Ga0070683_101047810 | 3300005329 | Unclassified | 783 |
| 31 | Ga0070670_100125782 | 3300005331 | Bacteria | 2212 |
| 32 | Ga0070670_100237683 | 3300005331 | Bacteria | 1586 |
| 33 | Ga0070677_10224743 | 3300005333 | Bacteria | 919 |
| 34 | Ga0068869_100028528 | 3300005334 | Bacteria | 3901 |
| 35 | Ga0068869_100109804 | 3300005334 | Bacteria | 2097 |
| 36 | Ga0068869_100474676 | 3300005334 | Bacteria | 1040 |
| 37 | Ga0070666_10000072 | 3300005335 | Bacteria | 75356 |
| 38 | Ga0070666_10056940 | 3300005335 | Bacteria | 2641 |
| 39 | Ga0070680_100024400 | 3300005336 | Bacteria | 4831 |
| 40 | Ga0070680_100066154 | 3300005336 | Bacteria | 2963 |
| 41 | Ga0070682_100000019 | 3300005337 | Bacteria | 220844 |
| 42 | Ga0070682_100002600 | 3300005337 | Bacteria | 9974 |
| 43 | Ga0070682_100018150 | 3300005337 | Bacteria | 4108 |
| 44 | Ga0070682_100031170 | 3300005337 | Bacteria | 3224 |
| 45 | Ga0070682_100128072 | 3300005337 | Bacteria | 1714 |
| 46 | Ga0068868_100023873 | 3300005338 | Bacteria | 4633 |
| 47 | Ga0068868_100146592 | 3300005338 | Bacteria | 1941 |
| 48 | Ga0068868_100410296 | 3300005338 | Bacteria | 1171 |
| 49 | Ga0070660_100000519 | 3300005339 | Bacteria | 25704 |
| 50 | Ga0070660_100010460 | 3300005339 | Bacteria | 6558 |
| 51 | Ga0070660_100025572 | 3300005339 | Bacteria | 4389 |
| 52 | Ga0070660_100066256 | 3300005339 | Bacteria | 2811 |
| 53 | Ga0070689_100372195 | 3300005340 | Bacteria | 1202 |
| 54 | Ga0070661_100010699 | 3300005344 | Bacteria | 6383 |
| 55 | Ga0070692_10483593 | 3300005345 | Bacteria | 799 |
| 56 | Ga0070668_100255139 | 3300005347 | Unclassified | 1457 |
| 57 | Ga0070668_100268781 | 3300005347 | Bacteria | 1421 |
| 58 | Ga0070669_100012698 | 3300005353 | Bacteria | 5979 |
| 59 | Ga0070675_100542255 | 3300005354 | Bacteria | 1051 |
| 60 | Ga0070671_100024703 | 3300005355 | Bacteria | 4922 |
| 61 | Ga0070671_100291109 | 3300005355 | Bacteria | 1390 |
| 62 | Ga0070671_100645420 | 3300005355 | Bacteria | 916 |
| 63 | Ga0070673_100012881 | 3300005364 | Bacteria | 5760 |
| 64 | Ga0070673_100017881 | 3300005364 | Bacteria | 5052 |
| 65 | Ga0070673_100055827 | 3300005364 | Unclassified | 3113 |
| 66 | Ga0070688_100033880 | 3300005365 | Bacteria | 3089 |
| 67 | Ga0070659_100008369 | 3300005366 | Bacteria | 7555 |
| 68 | Ga0070659_100074540 | 3300005366 | Unclassified | 2703 |
| 69 | Ga0070659_100082560 | 3300005366 | Bacteria | 2567 |
| 70 | Ga0070659_100092926 | 3300005366 | Bacteria | 2420 |
| 71 | Ga0070659_100252371 | 3300005366 | Bacteria | 1462 |
| 72 | Ga0070659_100787528 | 3300005366 | Bacteria | 826 |
| 73 | Ga0070667_100007874 | 3300005367 | Bacteria | 8840 |
| 74 | Ga0070667_100012570 | 3300005367 | Bacteria | 7001 |
| 75 | Ga0070663_100125519 | 3300005455 | Bacteria | 1944 |
| 76 | Ga0070662_100017715 | 3300005457 | Bacteria | 4805 |
| 77 | Ga0070662_100527477 | 3300005457 | Bacteria | 987 |
| 78 | Ga0070681_10046803 | 3300005458 | Bacteria | 4324 |
| 79 | Ga0070681_10128947 | 3300005458 | Unclassified | 2462 |
| 80 | Ga0070681_10156507 | 3300005458 | Bacteria | 2203 |
| 81 | Ga0068867_100085178 | 3300005459 | Bacteria | 2389 |
| 82 | Ga0068867_100198407 | 3300005459 | Bacteria | 1605 |
| 83 | Ga0068867_100283194 | 3300005459 | Unclassified | 1360 |
| 84 | Ga0068867_100520203 | 3300005459 | Bacteria | 1026 |
| 85 | Ga0068867_100570857 | 3300005459 | Bacteria | 982 |
| 86 | Ga0070685_10042112 | 3300005466 | Bacteria | 2604 |
| 87 | Ga0070679_100006985 | 3300005530 | Bacteria | 10536 |
| 88 | Ga0070679_100022824 | 3300005530 | Bacteria | 6120 |
| 89 | Ga0070679_100038514 | 3300005530 | Bacteria | 4754 |
| 90 | Ga0070679_100040283 | 3300005530 | Bacteria | 4648 |
| 91 | Ga0070679_100060254 | 3300005530 | Unclassified | 3782 |
| 92 | Ga0070679_100136411 | 3300005530 | Bacteria | 2434 |
| 93 | Ga0070684_100044026 | 3300005535 | Bacteria | 3859 |
| 94 | Ga0070684_100137687 | 3300005535 | Unclassified | 2206 |
| 95 | Ga0070684_100174326 | 3300005535 | Unclassified | 1954 |
| 96 | Ga0068853_100009686 | 3300005539 | Bacteria | 7769 |
| 97 | Ga0068853_100013295 | 3300005539 | Bacteria | 6721 |
| 98 | Ga0068853_100016635 | 3300005539 | Bacteria | 6056 |
| 99 | Ga0068853_100110454 | 3300005539 | Bacteria | 2442 |
| 100 | Ga0068853_100405807 | 3300005539 | Bacteria | 1276 |
| 101 | Ga0068853_100884841 | 3300005539 | Unclassified | 857 |
| 102 | Ga0070672_100137911 | 3300005543 | Bacteria | 2010 |
| 103 | Ga0070672_100186938 | 3300005543 | Bacteria | 1728 |
| 104 | Ga0070665_100265127 | 3300005548 | Bacteria | 1719 |
| 105 | Ga0068855_100001027 | 3300005563 | Bacteria | 34809 |
| 106 | Ga0068855_100029906 | 3300005563 | Bacteria | 6514 |
| 107 | Ga0068855_100081073 | 3300005563 | Bacteria | 3762 |
| 108 | Ga0068855_100090491 | 3300005563 | Bacteria | 3532 |
| 109 | Ga0068855_100098048 | 3300005563 | Bacteria | 3376 |
| 110 | Ga0068855_100106522 | 3300005563 | Unclassified | 3222 |
| 111 | Ga0068855_100239595 | 3300005563 | Unclassified | 2028 |
| 112 | Ga0070664_100018535 | 3300005564 | Bacteria | 5720 |
| 113 | Ga0068857_100049368 | 3300005577 | Bacteria | 3733 |
| 114 | Ga0068857_100073176 | 3300005577 | Bacteria | 3053 |
| 115 | Ga0068857_100213809 | 3300005577 | Bacteria | 1760 |
| 116 | Ga0068854_100035141 | 3300005578 | Bacteria | 3506 |
| 117 | Ga0068854_100089154 | 3300005578 | Bacteria | 2292 |
| 118 | Ga0068854_100882581 | 3300005578 | Bacteria | 785 |
| 119 | Ga0068856_100008593 | 3300005614 | Bacteria | 9930 |
| 120 | Ga0068856_100013882 | 3300005614 | Bacteria | 7790 |
| 121 | Ga0068856_100065752 | 3300005614 | Bacteria | 3584 |
| 122 | Ga0068856_100341168 | 3300005614 | Bacteria | 1516 |
| 123 | Ga0068852_100004838 | 3300005616 | Bacteria | 9569 |
| 124 | Ga0068852_100005736 | 3300005616 | Bacteria | 8906 |
| 125 | Ga0068852_100013163 | 3300005616 | Bacteria | 6323 |
| 126 | Ga0068852_100023890 | 3300005616 | Bacteria | 4930 |
| 127 | Ga0068852_100110708 | 3300005616 | Bacteria | 2496 |
| 128 | Ga0068852_100137175 | 3300005616 | Bacteria | 2259 |
| 129 | Ga0068852_100149265 | 3300005616 | Unclassified | 2172 |
| 130 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 131 | Ga0068859_100001537 | 3300005617 | Bacteria | 23548 |
| 132 | Ga0068859_100031496 | 3300005617 | Bacteria | 5326 |
| 133 | Ga0068859_100036292 | 3300005617 | Bacteria | 4948 |
| 134 | Ga0068864_100023261 | 3300005618 | Bacteria | 5202 |
| 135 | Ga0068864_100029084 | 3300005618 | Bacteria | 4676 |
| 136 | Ga0068864_100101185 | 3300005618 | Bacteria | 2556 |
| 137 | Ga0068864_100273309 | 3300005618 | Bacteria | 1575 |
| 138 | Ga0068864_100321400 | 3300005618 | Bacteria | 1454 |
| 139 | Ga0068864_100363186 | 3300005618 | Bacteria | 1369 |
| 140 | Ga0068851_10013185 | 3300005834 | Bacteria | 3910 |
| 141 | Ga0068851_10022420 | 3300005834 | Bacteria | 3076 |
| 142 | Ga0068851_10193295 | 3300005834 | Bacteria | 1132 |
| 143 | Ga0068851_10204155 | 3300005834 | Bacteria | 1104 |
| 144 | Ga0068863_100037396 | 3300005841 | Bacteria | 4622 |
| 145 | Ga0068863_100083792 | 3300005841 | Bacteria | 3022 |
| 146 | Ga0068863_100127428 | 3300005841 | Bacteria | 2429 |
| 147 | Ga0068863_100224853 | 3300005841 | Bacteria | 1809 |
| 148 | Ga0068863_100794219 | 3300005841 | Bacteria | 944 |
| 149 | Ga0068858_100031261 | 3300005842 | Bacteria | 4943 |
| 150 | Ga0068860_100001096 | 3300005843 | Bacteria | 29818 |
| 151 | Ga0068860_100001650 | 3300005843 | Bacteria | 23869 |
| 152 | Ga0068860_100127997 | 3300005843 | Bacteria | 2435 |
| 153 | Ga0068862_100016480 | 3300005844 | Bacteria | 6151 |
| 154 | Ga0075366_10015481 | 3300006195 | Bacteria | 4372 |
| 155 | Ga0097621_100002080 | 3300006237 | Bacteria | 13697 |
| 156 | Ga0097621_100023211 | 3300006237 | Bacteria | 4826 |
| 157 | Ga0097621_100224077 | 3300006237 | Unclassified | 1639 |
| 158 | Ga0068871_100005800 | 3300006358 | Bacteria | 8678 |
| 159 | Ga0068871_100145417 | 3300006358 | Bacteria | 2018 |
| 160 | Ga0068865_100016555 | 3300006881 | Bacteria | 4720 |
| 161 | Ga0068865_100680424 | 3300006881 | Bacteria | 877 |
| 162 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 163 | Ga0097620_100001537 | 3300006931 | Bacteria | 23548 |
| 164 | Ga0097620_100031496 | 3300006931 | Bacteria | 5326 |
| 165 | Ga0097620_100036292 | 3300006931 | Bacteria | 4948 |
| 166 | Ga0097620_101087988 | 3300006931 | Bacteria | 879 |
| 167 | Ga0105240_10000800 | 3300009093 | Bacteria | 56989 |
| 168 | Ga0105240_10006347 | 3300009093 | Bacteria | 17410 |
| 169 | Ga0105240_10034582 | 3300009093 | Bacteria | 6517 |
| 170 | Ga0105240_10053991 | 3300009093 | Bacteria | 5039 |
| 171 | Ga0105245_10120940 | 3300009098 | Bacteria | 2446 |
| 172 | Ga0105247_10027735 | 3300009101 | Bacteria | 3424 |
| 173 | Ga0105243_10000003 | 3300009148 | Bacteria | 712931 |
| 174 | Ga0105241_10001839 | 3300009174 | Bacteria | 16088 |
| 175 | Ga0105241_10007179 | 3300009174 | Bacteria | 8200 |
| 176 | Ga0105241_10008379 | 3300009174 | Bacteria | 7613 |
| 177 | Ga0105241_10019304 | 3300009174 | Bacteria | 5027 |
| 178 | Ga0105242_10163926 | 3300009176 | Bacteria | 1948 |
| 179 | Ga0105248_10045663 | 3300009177 | Bacteria | 4912 |
| 180 | Ga0105237_10007301 | 3300009545 | Bacteria | 12120 |
| 181 | Ga0105237_10013605 | 3300009545 | Bacteria | 8525 |
| 182 | Ga0105237_10037287 | 3300009545 | Bacteria | 4915 |
| 183 | Ga0105237_10086440 | 3300009545 | Bacteria | 3125 |
| 184 | Ga0105238_10000592 | 3300009551 | Bacteria | 38095 |
| 185 | Ga0105238_10029073 | 3300009551 | Bacteria | 5631 |
| 186 | Ga0105249_10003608 | 3300009553 | Bacteria | 13384 |
| 187 | Ga0105249_10010749 | 3300009553 | Bacteria | 8042 |
| 188 | Ga0105249_10211544 | 3300009553 | Bacteria | 1903 |
| 189 | Ga0105249_10490878 | 3300009553 | Bacteria | 1272 |
| 190 | Ga0105239_10039800 | 3300010375 | Bacteria | 5150 |
| 191 | Ga0105239_10045372 | 3300010375 | Bacteria | 4817 |
| 192 | Ga0105239_10080298 | 3300010375 | Bacteria | 3589 |
| 193 | Ga0105239_10086193 | 3300010375 | Bacteria | 3461 |
| 194 | Ga0105239_10179023 | 3300010375 | Bacteria | 2372 |
| 195 | Ga0157373_10000927 | 3300013100 | Bacteria | 22674 |
| 196 | Ga0157373_10008645 | 3300013100 | Bacteria | 7555 |
| 197 | Ga0157373_10010363 | 3300013100 | Bacteria | 6861 |
| 198 | Ga0157373_10010705 | 3300013100 | Bacteria | 6747 |
| 199 | Ga0157371_10000218 | 3300013102 | Bacteria | 83919 |
| 200 | Ga0157371_10001629 | 3300013102 | Bacteria | 22978 |
| 201 | Ga0157371_10005354 | 3300013102 | Bacteria | 10845 |
| 202 | Ga0157371_10005551 | 3300013102 | Bacteria | 10609 |
| 203 | Ga0157371_10005559 | 3300013102 | Bacteria | 10598 |
| 204 | Ga0157371_10014434 | 3300013102 | Bacteria | 5960 |
| 205 | Ga0157371_10021485 | 3300013102 | Bacteria | 4737 |
| 206 | Ga0157371_10025438 | 3300013102 | Bacteria | 4314 |
| 207 | Ga0157371_10477489 | 3300013102 | Unclassified | 919 |
| 208 | Ga0157371_10600811 | 3300013102 | Bacteria | 818 |
| 209 | Ga0157370_10001029 | 3300013104 | Bacteria | 35080 |
| 210 | Ga0157370_10008275 | 3300013104 | Bacteria | 11231 |
| 211 | Ga0157370_10018211 | 3300013104 | Bacteria | 7067 |
| 212 | Ga0157370_10093810 | 3300013104 | Unclassified | 2817 |
| 213 | Ga0157370_10118506 | 3300013104 | Bacteria | 2472 |
| 214 | Ga0157370_10140073 | 3300013104 | Bacteria | 2254 |
| 215 | Ga0157370_10241688 | 3300013104 | Bacteria | 1670 |
| 216 | Ga0157369_10008996 | 3300013105 | Bacteria | 11440 |
| 217 | Ga0157369_10052097 | 3300013105 | Bacteria | 4429 |
| 218 | Ga0157369_10117048 | 3300013105 | Bacteria | 2829 |
| 219 | Ga0157369_10288024 | 3300013105 | Unclassified | 1710 |
| 220 | Ga0157369_10893333 | 3300013105 | Unclassified | 911 |
| 221 | Ga0157374_10043806 | 3300013296 | Bacteria | 4135 |
| 222 | Ga0157374_10092122 | 3300013296 | Bacteria | 2891 |
| 223 | Ga0157374_10194339 | 3300013296 | Bacteria | 1985 |
| 224 | Ga0157378_10006154 | 3300013297 | Bacteria | 10506 |
| 225 | Ga0157378_10006592 | 3300013297 | Bacteria | 10141 |
| 226 | Ga0157378_10019626 | 3300013297 | Bacteria | 5941 |
| 227 | Ga0157378_10038046 | 3300013297 | Bacteria | 4263 |
| 228 | Ga0157378_10091740 | 3300013297 | Unclassified | 2762 |
| 229 | Ga0157378_10711139 | 3300013297 | Bacteria | 1025 |
| 230 | Ga0163162_10002714 | 3300013306 | Bacteria | 16800 |
| 231 | Ga0163162_10002780 | 3300013306 | Bacteria | 16628 |
| 232 | Ga0163162_10008817 | 3300013306 | Bacteria | 9807 |
| 233 | Ga0163162_10190554 | 3300013306 | Bacteria | 2178 |
| 234 | Ga0163162_10213644 | 3300013306 | Bacteria | 2059 |
| 235 | Ga0163162_10395764 | 3300013306 | Bacteria | 1514 |
| 236 | Ga0163162_10459939 | 3300013306 | Bacteria | 1404 |
| 237 | Ga0163162_10543390 | 3300013306 | Bacteria | 1290 |
| 238 | Ga0157372_10003581 | 3300013307 | Bacteria | 16712 |
| 239 | Ga0157372_10013617 | 3300013307 | Bacteria | 8694 |
| 240 | Ga0157372_10038889 | 3300013307 | Bacteria | 5250 |
| 241 | Ga0157372_10050819 | 3300013307 | Bacteria | 4611 |
| 242 | Ga0157372_10051028 | 3300013307 | Bacteria | 4603 |
| 243 | Ga0157372_10069814 | 3300013307 | Bacteria | 3952 |
| 244 | Ga0157372_10117263 | 3300013307 | Unclassified | 3053 |
| 245 | Ga0157372_10123969 | 3300013307 | Bacteria | 2970 |
| 246 | Ga0157372_10124972 | 3300013307 | Bacteria | 2958 |
| 247 | Ga0157372_10133131 | 3300013307 | Bacteria | 2862 |
| 248 | Ga0157372_10270314 | 3300013307 | Bacteria | 1975 |
| 249 | Ga0157372_10295952 | 3300013307 | Bacteria | 1882 |
| 250 | Ga0157372_10528380 | 3300013307 | Unclassified | 1375 |
| 251 | Ga0157372_10581221 | 3300013307 | Bacteria | 1306 |
| 252 | Ga0157375_10000534 | 3300013308 | Bacteria | 34107 |
| 253 | Ga0157375_10059325 | 3300013308 | Bacteria | 3790 |
| 254 | Ga0157375_10148157 | 3300013308 | Bacteria | 2480 |
| 255 | Ga0157375_10412093 | 3300013308 | Bacteria | 1518 |
| 256 | Ga0157375_11199110 | 3300013308 | Bacteria | 890 |
| 257 | Ga0163163_10000682 | 3300014325 | Bacteria | 28889 |
| 258 | Ga0163163_10719211 | 3300014325 | Bacteria | 1062 |
| 259 | Ga0157380_10586256 | 3300014326 | Bacteria | 1100 |
| 260 | Ga0157379_10018347 | 3300014968 | Bacteria | 6168 |
| 261 | Ga0157379_10020819 | 3300014968 | Bacteria | 5805 |
| 262 | Ga0157379_10098047 | 3300014968 | Bacteria | 2631 |
| 263 | Ga0157376_10000426 | 3300014969 | Bacteria | 27278 |
| 264 | Ga0157376_10047734 | 3300014969 | Bacteria | 3537 |
| 265 | Ga0157376_10064757 | 3300014969 | Bacteria | 3084 |
| 266 | Ga0157376_10086989 | 3300014969 | Bacteria | 2695 |
| 267 | Ga0157376_10147724 | 3300014969 | Bacteria | 2116 |
| 268 | Ga0157376_10189974 | 3300014969 | Bacteria | 1883 |
| 269 | Ga0157376_10660252 | 3300014969 | Bacteria | 1047 |
| 270 | Ga0182005_1000347 | 3300015265 | Bacteria | 26332 |
| 271 | Ga0163161_10300704 | 3300017792 | Bacteria | 1263 |
| 272 | Ga0209436_101020 | 3300025208 | Bacteria | 10729 |
| 273 | Ga0209436_103416 | 3300025208 | Bacteria | 4233 |
| 274 | Ga0209258_100116 | 3300025242 | Bacteria | 190317 |
| 275 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 276 | Ga0209026_1000136 | 3300025250 | Bacteria | 116507 |
| 277 | Ga0209148_1000175 | 3300025254 | Bacteria | 129536 |
| 278 | Ga0209673_1000519 | 3300025273 | Bacteria | 63063 |
| 279 | Ga0209673_1025779 | 3300025273 | Bacteria | 1947 |
| 280 | Ga0209673_1072792 | 3300025273 | Bacteria | 812 |
| 281 | Ga0209130_1010836 | 3300025284 | Bacteria | 2482 |
| 282 | Ga0209564_1010972 | 3300025295 | Bacteria | 4112 |
| 283 | Ga0209564_1011998 | 3300025295 | Bacteria | 3821 |
| 284 | Ga0209564_1031420 | 3300025295 | Bacteria | 1622 |
| 285 | Ga0209758_1019870 | 3300025297 | Bacteria | 3211 |
| 286 | Ga0209758_1023231 | 3300025297 | Bacteria | 2811 |
| 287 | Ga0209050_1000276 | 3300025298 | Bacteria | 109997 |
| 288 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 289 | Ga0207426_1000104 | 3300025302 | Bacteria | 249464 |
| 290 | Ga0207426_1001807 | 3300025302 | Bacteria | 15872 |
| 291 | Ga0207426_1002756 | 3300025302 | Bacteria | 10629 |
| 292 | Ga0209051_1013249 | 3300025303 | Bacteria | 3935 |
| 293 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 294 | Ga0209257_1000736 | 3300025304 | Bacteria | 49668 |
| 295 | Ga0207656_10011073 | 3300025321 | Bacteria | 3398 |
| 296 | Ga0207656_10131731 | 3300025321 | Bacteria | 1172 |
| 297 | Ga0207682_10007850 | 3300025893 | Bacteria | 4240 |
| 298 | Ga0207710_10045923 | 3300025900 | Bacteria | 1949 |
| 299 | Ga0207680_10000137 | 3300025903 | Bacteria | 34668 |
| 300 | Ga0207680_10005652 | 3300025903 | Bacteria | 5983 |
| 301 | Ga0207680_10287583 | 3300025903 | Bacteria | 1143 |
| 302 | Ga0207647_10015704 | 3300025904 | Bacteria | 5185 |
| 303 | Ga0207647_10039340 | 3300025904 | Bacteria | 2984 |
| 304 | Ga0207645_10318335 | 3300025907 | Bacteria | 1037 |
| 305 | Ga0207705_10008476 | 3300025909 | Bacteria | 7503 |
| 306 | Ga0207705_10092546 | 3300025909 | Bacteria | 2215 |
| 307 | Ga0207705_10157074 | 3300025909 | Unclassified | 1707 |
| 308 | Ga0207705_10357902 | 3300025909 | Unclassified | 1125 |
| 309 | Ga0207654_10001668 | 3300025911 | Bacteria | 11602 |
| 310 | Ga0207654_10006854 | 3300025911 | Bacteria | 5734 |
| 311 | Ga0207654_10275882 | 3300025911 | Bacteria | 1136 |
| 312 | Ga0207707_10000747 | 3300025912 | Bacteria | 32068 |
| 313 | Ga0207707_10124478 | 3300025912 | Unclassified | 2254 |
| 314 | Ga0207707_10186738 | 3300025912 | Unclassified | 1809 |
| 315 | Ga0207695_10001230 | 3300025913 | Bacteria | 43841 |
| 316 | Ga0207695_10028221 | 3300025913 | Bacteria | 6229 |
| 317 | Ga0207695_10199309 | 3300025913 | Bacteria | 1917 |
| 318 | Ga0207671_10000453 | 3300025914 | Bacteria | 56447 |
| 319 | Ga0207671_10000931 | 3300025914 | Bacteria | 36651 |
| 320 | Ga0207671_10035560 | 3300025914 | Bacteria | 3695 |
| 321 | Ga0207660_10012825 | 3300025917 | Bacteria | 5487 |
| 322 | Ga0207660_10051350 | 3300025917 | Bacteria | 2931 |
| 323 | Ga0207660_10064870 | 3300025917 | Unclassified | 2637 |
| 324 | Ga0207660_10690481 | 3300025917 | Bacteria | 833 |
| 325 | Ga0207657_10001373 | 3300025919 | Bacteria | 25953 |
| 326 | Ga0207657_10002923 | 3300025919 | Bacteria | 18338 |
| 327 | Ga0207657_10033182 | 3300025919 | Bacteria | 4656 |
| 328 | Ga0207657_10043799 | 3300025919 | Unclassified | 3939 |
| 329 | Ga0207657_10259292 | 3300025919 | Bacteria | 1384 |
| 330 | Ga0207649_10572529 | 3300025920 | Unclassified | 866 |
| 331 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 332 | Ga0207652_10002726 | 3300025921 | Bacteria | 14817 |
| 333 | Ga0207652_10019984 | 3300025921 | Bacteria | 5514 |
| 334 | Ga0207652_10024091 | 3300025921 | Bacteria | 5048 |
| 335 | Ga0207652_10029218 | 3300025921 | Bacteria | 4606 |
| 336 | Ga0207652_10074746 | 3300025921 | Bacteria | 2951 |
| 337 | Ga0207652_10131141 | 3300025921 | Unclassified | 2236 |
| 338 | Ga0207681_10279777 | 3300025923 | Bacteria | 1313 |
| 339 | Ga0207694_10033590 | 3300025924 | Bacteria | 3930 |
| 340 | Ga0207694_10106618 | 3300025924 | Bacteria | 2226 |
| 341 | Ga0207650_10041112 | 3300025925 | Bacteria | 3386 |
| 342 | Ga0207650_10087017 | 3300025925 | Unclassified | 2380 |
| 343 | Ga0207650_10814814 | 3300025925 | Bacteria | 791 |
| 344 | Ga0207659_10132026 | 3300025926 | Bacteria | 1929 |
| 345 | Ga0207659_10160569 | 3300025926 | Bacteria | 1764 |
| 346 | Ga0207659_10189352 | 3300025926 | Bacteria | 1636 |
| 347 | Ga0207659_10781572 | 3300025926 | Bacteria | 820 |
| 348 | Ga0207664_10434133 | 3300025929 | Unclassified | 1171 |
| 349 | Ga0207644_10028736 | 3300025931 | Bacteria | 3853 |
| 350 | Ga0207690_10027042 | 3300025932 | Bacteria | 3621 |
| 351 | Ga0207690_10034696 | 3300025932 | Unclassified | 3252 |
| 352 | Ga0207690_10075337 | 3300025932 | Unclassified | 2340 |
| 353 | Ga0207690_10189075 | 3300025932 | Bacteria | 1556 |
| 354 | Ga0207706_10005466 | 3300025933 | Bacteria | 11846 |
| 355 | Ga0207669_10605275 | 3300025937 | Bacteria | 891 |
| 356 | Ga0207691_10022756 | 3300025940 | Bacteria | 5908 |
| 357 | Ga0207691_10130113 | 3300025940 | Bacteria | 2224 |
| 358 | Ga0207691_10219345 | 3300025940 | Bacteria | 1650 |
| 359 | Ga0207691_10350751 | 3300025940 | Bacteria | 1262 |
| 360 | Ga0207691_10407886 | 3300025940 | Bacteria | 1159 |
| 361 | Ga0207711_10103947 | 3300025941 | Bacteria | 2516 |
| 362 | Ga0207689_10004743 | 3300025942 | Bacteria | 12259 |
| 363 | Ga0207689_10076399 | 3300025942 | Bacteria | 2754 |
| 364 | Ga0207689_10238157 | 3300025942 | Bacteria | 1504 |
| 365 | Ga0207689_10537368 | 3300025942 | Unclassified | 981 |
| 366 | Ga0207661_10246851 | 3300025944 | Unclassified | 1585 |
| 367 | Ga0207661_10747428 | 3300025944 | Unclassified | 900 |
| 368 | Ga0207679_10043667 | 3300025945 | Bacteria | 3229 |
| 369 | Ga0207667_10000098 | 3300025949 | Bacteria | 140051 |
| 370 | Ga0207667_10023418 | 3300025949 | Bacteria | 6800 |
| 371 | Ga0207667_10097007 | 3300025949 | Bacteria | 3043 |
| 372 | Ga0207667_10158638 | 3300025949 | Bacteria | 2327 |
| 373 | Ga0207667_10334402 | 3300025949 | Bacteria | 1546 |
| 374 | Ga0207667_10337131 | 3300025949 | Bacteria | 1539 |
| 375 | Ga0207667_11000812 | 3300025949 | Bacteria | 823 |
| 376 | Ga0207651_10051093 | 3300025960 | Bacteria | 2811 |
| 377 | Ga0207651_10435957 | 3300025960 | Bacteria | 1121 |
| 378 | Ga0207712_10007102 | 3300025961 | Bacteria | 7063 |
| 379 | Ga0207712_10011002 | 3300025961 | Bacteria | 5760 |
| 380 | Ga0207668_10706602 | 3300025972 | Bacteria | 886 |
| 381 | Ga0207640_10069022 | 3300025981 | Bacteria | 2371 |
| 382 | Ga0207658_10010201 | 3300025986 | Bacteria | 6383 |
| 383 | Ga0207658_10023454 | 3300025986 | Bacteria | 4307 |
| 384 | Ga0207658_10098228 | 3300025986 | Bacteria | 2288 |
| 385 | Ga0207658_10211175 | 3300025986 | Bacteria | 1627 |
| 386 | Ga0207677_10071190 | 3300026023 | Bacteria | 2453 |
| 387 | Ga0207677_10109976 | 3300026023 | Bacteria | 2050 |
| 388 | Ga0207677_10383701 | 3300026023 | Bacteria | 1187 |
| 389 | Ga0207677_10753100 | 3300026023 | Bacteria | 868 |
| 390 | Ga0207703_10005646 | 3300026035 | Bacteria | 10045 |
| 391 | Ga0207639_10026703 | 3300026041 | Bacteria | 4197 |
| 392 | Ga0207639_10083244 | 3300026041 | Bacteria | 2539 |
| 393 | Ga0207639_10086754 | 3300026041 | Bacteria | 2493 |
| 394 | Ga0207639_10093861 | 3300026041 | Bacteria | 2407 |
| 395 | Ga0207639_10161062 | 3300026041 | Bacteria | 1891 |
| 396 | Ga0207639_10184154 | 3300026041 | Unclassified | 1779 |
| 397 | Ga0207639_10209336 | 3300026041 | Unclassified | 1677 |
| 398 | Ga0207639_10367693 | 3300026041 | Bacteria | 1289 |
| 399 | Ga0207639_10410040 | 3300026041 | Bacteria | 1223 |
| 400 | Ga0207639_10964748 | 3300026041 | Unclassified | 798 |
| 401 | Ga0207678_10006330 | 3300026067 | Bacteria | 10512 |
| 402 | Ga0207702_10048604 | 3300026078 | Bacteria | 3578 |
| 403 | Ga0207702_10053865 | 3300026078 | Bacteria | 3407 |
| 404 | Ga0207702_10355884 | 3300026078 | Bacteria | 1402 |
| 405 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 406 | Ga0207641_10014569 | 3300026088 | Bacteria | 6446 |
| 407 | Ga0207641_10042064 | 3300026088 | Bacteria | 3832 |
| 408 | Ga0207641_10047978 | 3300026088 | Bacteria | 3604 |
| 409 | Ga0207641_10720892 | 3300026088 | Bacteria | 983 |
| 410 | Ga0207648_10040263 | 3300026089 | Unclassified | 4107 |
| 411 | Ga0207648_10117470 | 3300026089 | Bacteria | 2337 |
| 412 | Ga0207648_10120546 | 3300026089 | Bacteria | 2306 |
| 413 | Ga0207648_10155994 | 3300026089 | Bacteria | 2015 |
| 414 | Ga0207648_10278448 | 3300026089 | Bacteria | 1496 |
| 415 | Ga0207648_10616631 | 3300026089 | Bacteria | 1001 |
| 416 | Ga0207676_10004562 | 3300026095 | Bacteria | 9810 |
| 417 | Ga0207676_10051429 | 3300026095 | Bacteria | 3217 |
| 418 | Ga0207676_10175098 | 3300026095 | Bacteria | 1873 |
| 419 | Ga0207676_10289212 | 3300026095 | Unclassified | 1491 |
| 420 | Ga0207676_11205988 | 3300026095 | Unclassified | 750 |
| 421 | Ga0207674_10000969 | 3300026116 | Bacteria | 37567 |
| 422 | Ga0207674_10023895 | 3300026116 | Bacteria | 6538 |
| 423 | Ga0207674_10062691 | 3300026116 | Bacteria | 3754 |
| 424 | Ga0207674_10081440 | 3300026116 | Bacteria | 3239 |
| 425 | Ga0207674_10089693 | 3300026116 | Unclassified | 3067 |
| 426 | Ga0207674_10145317 | 3300026116 | Bacteria | 2330 |
| 427 | Ga0207683_10012906 | 3300026121 | Bacteria | 7133 |
| 428 | Ga0207683_10515237 | 3300026121 | Bacteria | 1105 |
| 429 | Ga0207683_10822585 | 3300026121 | Bacteria | 862 |
| 430 | Ga0207698_10000937 | 3300026142 | Bacteria | 16993 |
| 431 | Ga0207698_10003938 | 3300026142 | Bacteria | 8990 |
| 432 | Ga0207698_10023764 | 3300026142 | Bacteria | 4288 |
| 433 | Ga0207698_10086891 | 3300026142 | Bacteria | 2545 |
| 434 | Ga0207698_10289256 | 3300026142 | Unclassified | 1520 |
| 435 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 436 | Ga0268266_10656138 | 3300028379 | Unclassified | 1010 |
| 437 | Ga0268265_10022069 | 3300028380 | Bacteria | 4469 |
| 438 | Ga0268265_10609260 | 3300028380 | Bacteria | 1045 |
| 439 | Ga0268264_10003074 | 3300028381 | Bacteria | 14443 |
| 440 | Ga0268264_10207704 | 3300028381 | Unclassified | 1796 |
| 441 | Ga0268264_11252752 | 3300028381 | Bacteria | 752 |
| 442 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 443 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 444 | Ga0307515_10269292 | 3300028794 | Bacteria | 1427 |
| 445 | Ga0265338_10141715 | 3300028800 | Bacteria | 1882 |
| 446 | Ga0307511_10000201 | 3300030521 | Bacteria | 60079 |
| 447 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 448 | Ga0265327_10000288 | 3300031251 | Bacteria | 99230 |
| 449 | Ga0265327_10035674 | 3300031251 | Bacteria | 2746 |
| 450 | Ga0265327_10129267 | 3300031251 | Bacteria | 1190 |
| 451 | Ga0265316_10039776 | 3300031344 | Bacteria | 3775 |
| 452 | Ga0307513_10036214 | 3300031456 | Bacteria | 5510 |
| 453 | Ga0307513_10052525 | 3300031456 | Bacteria | 4388 |
| 454 | Ga0307509_10029227 | 3300031507 | Bacteria | 6120 |
| 455 | Ga0307509_10161100 | 3300031507 | Bacteria | 2141 |
| 456 | Ga0307509_10213553 | 3300031507 | Bacteria | 1751 |
| 457 | Ga0307516_10218420 | 3300031730 | Bacteria | 1617 |
| 458 | Ga0307410_10372350 | 3300031852 | Unclassified | 1147 |
| 459 | Ga0373955_0252363 | 3300035172 | Bacteria | 1058 |
| 460 | Ga0373933_0257462 | 3300035724 | Bacteria | 1125 |
| 461 | Ga0373937_0310604 | 3300036401 | Bacteria | 1491 |
| 462 | Ga0373937_0566346 | 3300036401 | Bacteria | 1079 |
| 463 | Ga0373937_0807063 | 3300036401 | Bacteria | 886 |
| 464 | Ga0316582_0139304 | 3300036647 | Bacteria | 1635 |
| 465 | Ga0316584_0052487 | 3300036712 | Unclassified | 3049 |
| 466 | Ga0395899_0009123 | 3300037312 | Bacteria | 7619 |
| 467 | Ga0395899_0026146 | 3300037312 | Bacteria | 4405 |
| 468 | Ga0395900_0002692 | 3300037418 | Bacteria | 19416 |
| 469 | Ga0395900_0008628 | 3300037418 | Bacteria | 10473 |
| 470 | Ga0395900_0082094 | 3300037418 | Bacteria | 3311 |
| 471 | Ga0395900_0235086 | 3300037418 | Unclassified | 1841 |
| 472 | Ga0395898_0000595 | 3300037466 | Bacteria | 67162 |
| 473 | Ga0395898_0017447 | 3300037466 | Bacteria | 7329 |
| 474 | Ga0395898_0221294 | 3300037466 | Unclassified | 1805 |
| 475 | Ga0395905_0004944 | 3300037471 | Bacteria | 13731 |
| 476 | Ga0395905_0379246 | 3300037471 | Bacteria | 1308 |
| 477 | Ga0395905_0569274 | 3300037471 | Unclassified | 1034 |
| 478 | Ga0395901_0001672 | 3300038443 | Bacteria | 22890 |
| 479 | Ga0395901_0007597 | 3300038443 | Bacteria | 10947 |
| 480 | Ga0395901_0007671 | 3300038443 | Bacteria | 10885 |
| 481 | Ga0395901_0114128 | 3300038443 | Bacteria | 2837 |
| 482 | Ga0395901_0193612 | 3300038443 | Bacteria | 2132 |
| 483 | Ga0451787_748704 | 3300041441 | Bacteria | 1841 |
| 484 | Ga0451793_1095409 | 3300041452 | Bacteria | 941 |
| 485 | Ga0451849_0688680 | 3300041505 | Bacteria | 959 |
| 486 | Ga0451853_2525003 | 3300041512 | Bacteria | 1013 |
| 487 | Ga0439431_0027745 | 3300041997 | Bacteria | 1392 |
| 488 | Ga0439431_0070608 | 3300041997 | Bacteria | 930 |
| 489 | Ga0439448_0088074 | 3300042005 | Unclassified | 1047 |
| 490 | Ga0439449_0046423 | 3300042007 | Bacteria | 1609 |
| 491 | Ga0439449_0061030 | 3300042007 | Bacteria | 1391 |
| 492 | Ga0439457_028482 | 3300042014 | Bacteria | 1237 |
| 493 | Ga0439460_0060072 | 3300042461 | Unclassified | 1159 |
| 494 | Ga0451577_0053664 | 3300042876 | Bacteria | 3598 |
| 495 | Ga0451577_0249263 | 3300042876 | Bacteria | 1607 |
| 496 | Ga0451577_0799327 | 3300042876 | Bacteria | 852 |
| 497 | Ga0466972_0000057 | 3300044658 | Bacteria | 110775 |
| 498 | Ga0466972_0001286 | 3300044658 | Bacteria | 12123 |
| 499 | Ga0466972_0077972 | 3300044658 | Bacteria | 1578 |
| 500 | Ga0453683_0354821 | 3300044673 | Bacteria | 942 |
| 501 | Ga0453684_0011435 | 3300044712 | Bacteria | 14889 |
| 502 | Ga0453684_0017764 | 3300044712 | Bacteria | 10983 |
| 503 | Ga0453684_0057694 | 3300044712 | Bacteria | 5022 |
| 504 | Ga0453684_0331994 | 3300044712 | Bacteria | 1719 |
| 505 | Ga0466970_0131394 | 3300044765 | Bacteria | 1375 |
| 506 | Ga0495627_006057 | 3300046453 | Bacteria | 4781 |
| 507 | Ga0495638_0118696 | 3300046460 | Bacteria | 1565 |
| 508 | Ga0495639_0217866 | 3300046475 | Unclassified | 938 |
| 509 | Ga0495586_0114007 | 3300046535 | Bacteria | 1506 |
| 510 | Ga0495587_0089912 | 3300046536 | Bacteria | 1774 |
| 511 | Ga0495621_0033310 | 3300046539 | Bacteria | 1776 |
| 512 | Ga0495633_0000116 | 3300046558 | Bacteria | 108667 |
| 513 | Ga0495668_0000099 | 3300046616 | Bacteria | 137915 |
| 514 | Ga0495668_0002655 | 3300046616 | Bacteria | 14375 |
| 515 | Ga0495635_0131993 | 3300046663 | Bacteria | 1703 |
| 516 | Ga0495658_0318132 | 3300046683 | Bacteria | 986 |
| 517 | Ga0495670_0094099 | 3300046691 | Unclassified | 1536 |
| 518 | Ga0495674_0131800 | 3300047319 | Bacteria | 2106 |
| 519 | Ga0495674_0308199 | 3300047319 | Bacteria | 1292 |
| 520 | Ga0495684_0481590 | 3300047471 | Bacteria | 857 |
| 521 | Ga0496104_0158260 | 3300048907 | Bacteria | 2173 |
| 522 | Ga0496114_0023774 | 3300048917 | Bacteria | 5001 |
| 523 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 524 | Ga0496126_0077415 | 3300048929 | Bacteria | 2948 |
| 525 | Ga0501033_0008636 | 3300049570 | Bacteria | 7884 |
| 526 | Ga0501033_0034295 | 3300049570 | Bacteria | 3808 |
| 527 | Ga0501033_0136954 | 3300049570 | Bacteria | 1772 |
| 528 | Ga0501033_0308481 | 3300049570 | Bacteria | 1113 |
| 529 | Ga0501033_0365160 | 3300049570 | Bacteria | 1010 |
| 530 | Ga0501034_0014518 | 3300049571 | Bacteria | 8110 |
| 531 | Ga0501034_0023070 | 3300049571 | Bacteria | 6341 |
| 532 | Ga0501034_0069892 | 3300049571 | Unclassified | 3522 |
| 533 | Ga0501034_0099099 | 3300049571 | Bacteria | 2909 |
| 534 | Ga0501043_0074054 | 3300049579 | Bacteria | 2675 |
| 535 | Ga0501047_0116620 | 3300049581 | Bacteria | 2552 |
| 536 | Ga0501070_0098427 | 3300049586 | Bacteria | 2419 |
| 537 | Ga0501238_006580 | 3300049671 | Bacteria | 1499 |
| 538 | Ga0501219_000178 | 3300049703 | Bacteria | 11731 |
| 539 | Ga0501080_0334765 | 3300049742 | Bacteria | 1368 |
| 540 | Ga0501241_012764 | 3300049758 | Bacteria | 1527 |
| 541 | Ga0501035_0023737 | 3300049822 | Bacteria | 5627 |
| 542 | Ga0501035_0114943 | 3300049822 | Bacteria | 2356 |
| 543 | Ga0501044_0029803 | 3300049823 | Bacteria | 5753 |
| 544 | Ga0501044_0047818 | 3300049823 | Bacteria | 4424 |
| 545 | Ga0501044_0058772 | 3300049823 | Bacteria | 3942 |
| 546 | Ga0501044_0139891 | 3300049823 | Bacteria | 2410 |
| 547 | Ga0501044_0243747 | 3300049823 | Bacteria | 1740 |
| 548 | Ga0501284_00036 | 3300050005 | Bacteria | 57905 |
| 549 | Ga0501284_00614 | 3300050005 | Bacteria | 1837 |
| 550 | nmdc:mga0k408_44352_c1 | 3300050493 | Bacteria | 2564 |
| 551 | nmdc:mga05p37_43236_c1 | 3300050507 | Bacteria | 5541 |
| 552 | nmdc:mga08y16_714280_c1 | 3300050511 | Bacteria | 1001 |
| 553 | Ga0495619_0186445 | 3300053085 | Unclassified | 1436 |
| 554 | Ga0500644_0000260 | 3300053088 | Bacteria | 30005 |
| 555 | Ga0500646_0001397 | 3300053090 | Bacteria | 6401 |
| 556 | Ga0500646_0004077 | 3300053090 | Bacteria | 3707 |
| 557 | Ga0500583_0010948 | 3300053092 | Bacteria | 3393 |
| 558 | Ga0500651_0032311 | 3300053093 | Bacteria | 3298 |
| 559 | Ga0500651_0229784 | 3300053093 | Bacteria | 1085 |
| 560 | Ga0500651_0287662 | 3300053093 | Unclassified | 946 |
| 561 | Ga0500660_070104 | 3300053100 | Bacteria | 1648 |
| 562 | Ga0500562_000013 | 3300053108 | Bacteria | 150003 |
| 563 | Ga0500594_0017945 | 3300053118 | Bacteria | 1737 |
| 564 | Ga0500652_029591 | 3300053131 | Bacteria | 2137 |
| 565 | Ga0500655_031558 | 3300053133 | Bacteria | 1022 |
| 566 | Ga0500658_0004288 | 3300053134 | Bacteria | 5346 |
| 567 | Ga0500577_0001916 | 3300053142 | Bacteria | 5329 |
| 568 | Ga0500590_041398 | 3300053148 | Bacteria | 2369 |
| 569 | Ga0500604_0024558 | 3300053151 | Bacteria | 1726 |
| 570 | Ga0500616_0013304 | 3300053153 | Bacteria | 4784 |
| 571 | Ga0500616_0032834 | 3300053153 | Bacteria | 2836 |
| 572 | Ga0500622_0000212 | 3300053156 | Bacteria | 61612 |
| 573 | Ga0500622_0000242 | 3300053156 | Bacteria | 56575 |
| 574 | Ga0500633_0001577 | 3300053160 | Bacteria | 4371 |
| 575 | Ga0500634_0022500 | 3300053161 | Bacteria | 3422 |
| 576 | Ga0500636_0002821 | 3300053177 | Bacteria | 9699 |
| 577 | Ga0500645_045660 | 3300053730 | Bacteria | 1287 |
| 578 | Ga0500645_116112 | 3300053730 | Bacteria | 749 |
| 579 | Ga0500661_004853 | 3300055283 | Bacteria | 2515 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10006533 | Ga0070658_100065331 | 187 |
| 2 | 3300005329 | Ga0070683_101047810 | Ga0070683_1010478101 | 188 |
| 3 | 3300005336 | Ga0070680_100024400 | Ga0070680_1000244003 | 188 |
| 4 | 3300005337 | Ga0070682_100018150 | Ga0070682_1000181502 | 188 |
| 5 | 3300005339 | Ga0070660_100010460 | Ga0070660_1000104606 | 188 |
| 6 | 3300005458 | Ga0070681_10128947 | Ga0070681_101289473 | 188 |
| 7 | 3300005530 | Ga0070679_100006985 | Ga0070679_1000069857 | 188 |
| 8 | 3300005535 | Ga0070684_100174326 | Ga0070684_1001743263 | 188 |
| 9 | 3300005539 | Ga0068853_100110454 | Ga0068853_1001104543 | 188 |
| 10 | 3300005563 | Ga0068855_100239595 | Ga0068855_1002395952 | 188 |
| 11 | 3300005616 | Ga0068852_100005736 | Ga0068852_1000057363 | 188 |
| 12 | 3300013307 | Ga0157372_10038889 | Ga0157372_100388895 | 188 |
| 13 | 3300025909 | Ga0207705_10357902 | Ga0207705_103579021 | 188 |
| 14 | 3300025912 | Ga0207707_10124478 | Ga0207707_101244783 | 188 |
| 15 | 3300025917 | Ga0207660_10012825 | Ga0207660_100128253 | 188 |
| 16 | 3300025919 | Ga0207657_10043799 | Ga0207657_100437994 | 188 |
| 17 | 3300025921 | Ga0207652_10019984 | Ga0207652_100199846 | 188 |
| 18 | 3300025944 | Ga0207661_10747428 | Ga0207661_107474282 | 188 |
| 19 | 3300026041 | Ga0207639_10086754 | Ga0207639_100867542 | 188 |
| 20 | 3300026142 | Ga0207698_10000937 | Ga0207698_1000093711 | 188 |
| 21 | 3300044712 | Ga0453684_0331994 | Ga0453684_0331994_1033_1686 | 193 |
| 22 | 3300053156 | Ga0500622_0000242 | Ga0500622_0000242_47247_47972 | 194 |
| 23 | 3300049571 | Ga0501034_0069892 | Ga0501034_0069892_933_1604 | 200 |
| 24 | 3300001989 | JGI24739J22299_10108048 | JGI24739J22299_101080482 | 202 |
| 25 | 3300005329 | Ga0070683_100038010 | Ga0070683_1000380103 | 202 |
| 26 | 3300005334 | Ga0068869_100474676 | Ga0068869_1004746761 | 202 |
| 27 | 3300005335 | Ga0070666_10056940 | Ga0070666_100569402 | 202 |
| 28 | 3300005338 | Ga0068868_100023873 | Ga0068868_1000238733 | 202 |
| 29 | 3300005339 | Ga0070660_100025572 | Ga0070660_1000255726 | 202 |
| 30 | 3300005344 | Ga0070661_100010699 | Ga0070661_1000106992 | 202 |
| 31 | 3300005354 | Ga0070675_100542255 | Ga0070675_1005422552 | 202 |
| 32 | 3300005355 | Ga0070671_100024703 | Ga0070671_1000247036 | 202 |
| 33 | 3300005364 | Ga0070673_100012881 | Ga0070673_1000128813 | 202 |
| 34 | 3300005366 | Ga0070659_100082560 | Ga0070659_1000825603 | 202 |
| 35 | 3300005457 | Ga0070662_100017715 | Ga0070662_1000177153 | 202 |
| 36 | 3300005530 | Ga0070679_100022824 | Ga0070679_1000228246 | 202 |
| 37 | 3300005535 | Ga0070684_100044026 | Ga0070684_1000440262 | 202 |
| 38 | 3300005539 | Ga0068853_100013295 | Ga0068853_1000132956 | 202 |
| 39 | 3300005563 | Ga0068855_100098048 | Ga0068855_1000980486 | 202 |
| 40 | 3300005564 | Ga0070664_100018535 | Ga0070664_1000185355 | 202 |
| 41 | 3300005577 | Ga0068857_100213809 | Ga0068857_1002138092 | 202 |
| 42 | 3300005578 | Ga0068854_100035141 | Ga0068854_1000351413 | 202 |
| 43 | 3300005614 | Ga0068856_100013882 | Ga0068856_1000138826 | 202 |
| 44 | 3300005616 | Ga0068852_100137175 | Ga0068852_1001371752 | 202 |
| 45 | 3300005618 | Ga0068864_100273309 | Ga0068864_1002733093 | 202 |
| 46 | 3300006237 | Ga0097621_100023211 | Ga0097621_1000232113 | 202 |
| 47 | 3300013100 | Ga0157373_10008645 | Ga0157373_100086456 | 202 |
| 48 | 3300013102 | Ga0157371_10014434 | Ga0157371_100144345 | 202 |
| 49 | 3300013104 | Ga0157370_10140073 | Ga0157370_101400732 | 202 |
| 50 | 3300013105 | Ga0157369_10008996 | Ga0157369_100089963 | 202 |
| 51 | 3300013296 | Ga0157374_10092122 | Ga0157374_100921222 | 202 |
| 52 | 3300013297 | Ga0157378_10038046 | Ga0157378_100380463 | 202 |
| 53 | 3300013307 | Ga0157372_10050819 | Ga0157372_100508196 | 202 |
| 54 | 3300014969 | Ga0157376_10064757 | Ga0157376_100647572 | 202 |
| 55 | 3300025903 | Ga0207680_10005652 | Ga0207680_100056524 | 202 |
| 56 | 3300025919 | Ga0207657_10001373 | Ga0207657_100013736 | 202 |
| 57 | 3300025920 | Ga0207649_10572529 | Ga0207649_105725291 | 202 |
| 58 | 3300025921 | Ga0207652_10029218 | Ga0207652_100292186 | 202 |
| 59 | 3300025926 | Ga0207659_10189352 | Ga0207659_101893522 | 202 |
| 60 | 3300025931 | Ga0207644_10028736 | Ga0207644_100287364 | 202 |
| 61 | 3300025932 | Ga0207690_10027042 | Ga0207690_100270425 | 202 |
| 62 | 3300025933 | Ga0207706_10005466 | Ga0207706_1000546614 | 202 |
| 63 | 3300025942 | Ga0207689_10537368 | Ga0207689_105373682 | 202 |
| 64 | 3300025944 | Ga0207661_10246851 | Ga0207661_102468511 | 202 |
| 65 | 3300025945 | Ga0207679_10043667 | Ga0207679_100436672 | 202 |
| 66 | 3300025949 | Ga0207667_10158638 | Ga0207667_101586383 | 202 |
| 67 | 3300025981 | Ga0207640_10069022 | Ga0207640_100690223 | 202 |
| 68 | 3300026023 | Ga0207677_10109976 | Ga0207677_101099763 | 202 |
| 69 | 3300026041 | Ga0207639_10209336 | Ga0207639_102093361 | 202 |
| 70 | 3300026078 | Ga0207702_10355884 | Ga0207702_103558843 | 202 |
| 71 | 3300026095 | Ga0207676_11205988 | Ga0207676_112059881 | 202 |
| 72 | 3300026116 | Ga0207674_10145317 | Ga0207674_101453173 | 202 |
| 73 | 3300005617 | Ga0068859_100001537 | Ga0068859_10000153721 | 203 |
| 74 | 3300006931 | Ga0097620_100001537 | Ga0097620_10000153721 | 203 |
| 75 | 3300013105 | Ga0157369_10288024 | Ga0157369_102880242 | 203 |
| 76 | 3300005459 | Ga0068867_100520203 | Ga0068867_1005202031 | 204 |
| 77 | 3300005841 | Ga0068863_100224853 | Ga0068863_1002248532 | 204 |
| 78 | 3300025302 | Ga0207426_1000104 | Ga0207426_1000104166 | 204 |
| 79 | 3300025907 | Ga0207645_10318335 | Ga0207645_103183352 | 204 |
| 80 | 3300026088 | Ga0207641_10047978 | Ga0207641_100479783 | 204 |
| 81 | 3300026089 | Ga0207648_10155994 | Ga0207648_101559944 | 204 |
| 82 | 3300028379 | Ga0268266_10656138 | Ga0268266_106561381 | 204 |
| 83 | 3300042876 | Ga0451577_0053664 | Ga0451577_0053664_2894_3550 | 204 |
| 84 | 3300005347 | Ga0070668_100268781 | Ga0070668_1002687811 | 206 |
| 85 | 3300009176 | Ga0105242_10163926 | Ga0105242_101639263 | 206 |
| 86 | 3300013307 | Ga0157372_10051028 | Ga0157372_100510286 | 206 |
| 87 | 3300025972 | Ga0207668_10706602 | Ga0207668_107066021 | 206 |
| 88 | 3300005366 | Ga0070659_100008369 | Ga0070659_1000083693 | 207 |
| 89 | 3300009093 | Ga0105240_10053991 | Ga0105240_100539916 | 207 |
| 90 | 3300025960 | Ga0207651_10051093 | Ga0207651_100510933 | 207 |
| 91 | 3300026023 | Ga0207677_10071190 | Ga0207677_100711902 | 207 |
| 92 | 3300005365 | Ga0070688_100033880 | Ga0070688_1000338803 | 208 |
| 93 | 3300038443 | Ga0395901_0193612 | Ga0395901_0193612_413_1087 | 208 |
| 94 | 3300042461 | Ga0439460_0060072 | Ga0439460_0060072_132_782 | 208 |
| 95 | 3300042876 | Ga0451577_0799327 | Ga0451577_0799327_83_730 | 208 |
| 96 | 3300013102 | Ga0157371_10001629 | Ga0157371_100016292 | 209 |
| 97 | 3300013102 | Ga0157371_10477489 | Ga0157371_104774891 | 209 |
| 98 | 3300013307 | Ga0157372_10069814 | Ga0157372_100698141 | 209 |
| 99 | 3300025986 | Ga0207658_10098228 | Ga0207658_100982284 | 209 |
| 100 | 3300041441 | Ga0451787_748704 | Ga0451787_748704_830_1486 | 209 |
| 101 | 3300005333 | Ga0070677_10224743 | Ga0070677_102247431 | 210 |
| 102 | 3300005347 | Ga0070668_100255139 | Ga0070668_1002551393 | 210 |
| 103 | 3300013306 | Ga0163162_10213644 | Ga0163162_102136442 | 210 |
| 104 | 3300014969 | Ga0157376_10660252 | Ga0157376_106602522 | 210 |
| 105 | 3300025926 | Ga0207659_10160569 | Ga0207659_101605693 | 210 |
| 106 | 3300025940 | Ga0207691_10219345 | Ga0207691_102193452 | 210 |
| 107 | iso_pu_bacteria | 2890737413 | 2890738941 | 210 |
| 108 | iso_pu_bacteria | 2896344016 | 2896345381 | 210 |
| 109 | 3300003323 | rootH1_10093904 | rootH1_100939045 | 211 |
| 110 | 3300005336 | Ga0070680_100066154 | Ga0070680_1000661544 | 211 |
| 111 | 3300005339 | Ga0070660_100066256 | Ga0070660_1000662562 | 211 |
| 112 | 3300005366 | Ga0070659_100092926 | Ga0070659_1000929263 | 211 |
| 113 | 3300005455 | Ga0070663_100125519 | Ga0070663_1001255194 | 211 |
| 114 | 3300005458 | Ga0070681_10156507 | Ga0070681_101565072 | 211 |
| 115 | 3300005539 | Ga0068853_100884841 | Ga0068853_1008848411 | 211 |
| 116 | 3300005563 | Ga0068855_100001027 | Ga0068855_10000102720 | 211 |
| 117 | 3300005563 | Ga0068855_100029906 | Ga0068855_1000299066 | 211 |
| 118 | 3300005563 | Ga0068855_100081073 | Ga0068855_1000810733 | 211 |
| 119 | 3300005578 | Ga0068854_100089154 | Ga0068854_1000891542 | 211 |
| 120 | 3300005614 | Ga0068856_100341168 | Ga0068856_1003411682 | 211 |
| 121 | 3300013102 | Ga0157371_10005551 | Ga0157371_100055512 | 211 |
| 122 | 3300013104 | Ga0157370_10001029 | Ga0157370_1000102917 | 211 |
| 123 | 3300013104 | Ga0157370_10008275 | Ga0157370_100082755 | 211 |
| 124 | 3300013104 | Ga0157370_10241688 | Ga0157370_102416882 | 211 |
| 125 | 3300013307 | Ga0157372_10295952 | Ga0157372_102959523 | 211 |
| 126 | 3300025904 | Ga0207647_10015704 | Ga0207647_100157045 | 211 |
| 127 | 3300025909 | Ga0207705_10008476 | Ga0207705_100084767 | 211 |
| 128 | 3300025917 | Ga0207660_10051350 | Ga0207660_100513502 | 211 |
| 129 | 3300025917 | Ga0207660_10690481 | Ga0207660_106904811 | 211 |
| 130 | 3300025919 | Ga0207657_10259292 | Ga0207657_102592922 | 211 |
| 131 | 3300025929 | Ga0207664_10434133 | Ga0207664_104341332 | 211 |
| 132 | 3300025949 | Ga0207667_10097007 | Ga0207667_100970073 | 211 |
| 133 | 3300025949 | Ga0207667_10337131 | Ga0207667_103371311 | 211 |
| 134 | 3300026041 | Ga0207639_10964748 | Ga0207639_109647481 | 211 |
| 135 | 3300026067 | Ga0207678_10006330 | Ga0207678_1000633010 | 211 |
| 136 | 3300037312 | Ga0395899_0009123 | Ga0395899_0009123_5215_5937 | 211 |
| 137 | 3300037418 | Ga0395900_0082094 | Ga0395900_0082094_1989_2711 | 211 |
| 138 | 3300037418 | Ga0395900_0235086 | Ga0395900_0235086_146_853 | 211 |
| 139 | 3300037466 | Ga0395898_0221294 | Ga0395898_0221294_589_1311 | 211 |
| 140 | 3300037471 | Ga0395905_0379246 | Ga0395905_0379246_532_1236 | 211 |
| 141 | 3300037471 | Ga0395905_0569274 | Ga0395905_0569274_292_1014 | 211 |
| 142 | 3300038443 | Ga0395901_0007671 | Ga0395901_0007671_4534_5256 | 211 |
| 143 | 3300001989 | JGI24739J22299_10000030 | JGI24739J22299_1000003011 | 212 |
| 144 | 3300003215 | JGI25153J46596_10011676 | JGI25153J46596_100116762 | 212 |
| 145 | 3300003354 | JGI25160J50197_1001552 | JGI25160J50197_10015528 | 212 |
| 146 | 3300003771 | Ga0055526_1022488 | Ga0055526_10224884 | 212 |
| 147 | 3300003790 | Ga0055528_1001162 | Ga0055528_100116215 | 212 |
| 148 | 3300003791 | Ga0055530_10000185 | Ga0055530_1000018532 | 212 |
| 149 | 3300005262 | Ga0065165_1000658 | Ga0065165_100065835 | 212 |
| 150 | 3300005334 | Ga0068869_100028528 | Ga0068869_1000285282 | 212 |
| 151 | 3300005335 | Ga0070666_10000072 | Ga0070666_1000007231 | 212 |
| 152 | 3300005337 | Ga0070682_100002600 | Ga0070682_1000026009 | 212 |
| 153 | 3300005338 | Ga0068868_100146592 | Ga0068868_1001465922 | 212 |
| 154 | 3300005340 | Ga0070689_100372195 | Ga0070689_1003721952 | 212 |
| 155 | 3300005364 | Ga0070673_100017881 | Ga0070673_1000178811 | 212 |
| 156 | 3300005466 | Ga0070685_10042112 | Ga0070685_100421122 | 212 |
| 157 | 3300005548 | Ga0070665_100265127 | Ga0070665_1002651273 | 212 |
| 158 | 3300005616 | Ga0068852_100023890 | Ga0068852_1000238904 | 212 |
| 159 | 3300005617 | Ga0068859_100000006 | Ga0068859_10000000629 | 212 |
| 160 | 3300005618 | Ga0068864_100023261 | Ga0068864_1000232613 | 212 |
| 161 | 3300005834 | Ga0068851_10193295 | Ga0068851_101932952 | 212 |
| 162 | 3300005841 | Ga0068863_100127428 | Ga0068863_1001274283 | 212 |
| 163 | 3300005842 | Ga0068858_100031261 | Ga0068858_1000312614 | 212 |
| 164 | 3300006931 | Ga0097620_100000006 | Ga0097620_10000000629 | 212 |
| 165 | 3300009098 | Ga0105245_10120940 | Ga0105245_101209401 | 212 |
| 166 | 3300009101 | Ga0105247_10027735 | Ga0105247_100277353 | 212 |
| 167 | 3300009174 | Ga0105241_10008379 | Ga0105241_100083797 | 212 |
| 168 | 3300009545 | Ga0105237_10037287 | Ga0105237_100372874 | 212 |
| 169 | 3300009553 | Ga0105249_10003608 | Ga0105249_100036084 | 212 |
| 170 | 3300010375 | Ga0105239_10039800 | Ga0105239_100398004 | 212 |
| 171 | 3300013102 | Ga0157371_10600811 | Ga0157371_106008111 | 212 |
| 172 | 3300013306 | Ga0163162_10002714 | Ga0163162_100027147 | 212 |
| 173 | 3300013308 | Ga0157375_10412093 | Ga0157375_104120931 | 212 |
| 174 | 3300014968 | Ga0157379_10098047 | Ga0157379_100980474 | 212 |
| 175 | 3300014969 | Ga0157376_10086989 | Ga0157376_100869894 | 212 |
| 176 | 3300025273 | Ga0209673_1000519 | Ga0209673_10005198 | 212 |
| 177 | 3300025273 | Ga0209673_1025779 | Ga0209673_10257793 | 212 |
| 178 | 3300025273 | Ga0209673_1072792 | Ga0209673_10727921 | 212 |
| 179 | 3300025295 | Ga0209564_1010972 | Ga0209564_10109723 | 212 |
| 180 | 3300025295 | Ga0209564_1011998 | Ga0209564_10119984 | 212 |
| 181 | 3300025295 | Ga0209564_1031420 | Ga0209564_10314201 | 212 |
| 182 | 3300025297 | Ga0209758_1019870 | Ga0209758_10198702 | 212 |
| 183 | 3300025298 | Ga0209050_1000276 | Ga0209050_100027653 | 212 |
| 184 | 3300025302 | Ga0207426_1002756 | Ga0207426_10027566 | 212 |
| 185 | 3300025303 | Ga0209051_1013249 | Ga0209051_10132492 | 212 |
| 186 | 3300025304 | Ga0209257_1000736 | Ga0209257_100073618 | 212 |
| 187 | 3300025321 | Ga0207656_10131731 | Ga0207656_101317312 | 212 |
| 188 | 3300025900 | Ga0207710_10045923 | Ga0207710_100459232 | 212 |
| 189 | 3300025903 | Ga0207680_10000137 | Ga0207680_100001376 | 212 |
| 190 | 3300025911 | Ga0207654_10001668 | Ga0207654_1000166811 | 212 |
| 191 | 3300025911 | Ga0207654_10006854 | Ga0207654_100068541 | 212 |
| 192 | 3300025914 | Ga0207671_10000453 | Ga0207671_100004533 | 212 |
| 193 | 3300025942 | Ga0207689_10004743 | Ga0207689_1000474312 | 212 |
| 194 | 3300025961 | Ga0207712_10011002 | Ga0207712_100110024 | 212 |
| 195 | 3300026035 | Ga0207703_10005646 | Ga0207703_1000564610 | 212 |
| 196 | 3300026088 | Ga0207641_10000058 | Ga0207641_1000005843 | 212 |
| 197 | 3300026095 | Ga0207676_10004562 | Ga0207676_1000456210 | 212 |
| 198 | 3300026142 | Ga0207698_10003938 | Ga0207698_100039384 | 212 |
| 199 | 3300028381 | Ga0268264_11252752 | Ga0268264_112527521 | 212 |
| 200 | 3300005530 | Ga0070679_100136411 | Ga0070679_1001364113 | 213 |
| 201 | 3300005577 | Ga0068857_100073176 | Ga0068857_1000731762 | 213 |
| 202 | 3300013100 | Ga0157373_10010363 | Ga0157373_100103632 | 213 |
| 203 | 3300013307 | Ga0157372_10270314 | Ga0157372_102703141 | 213 |
| 204 | 3300013307 | Ga0157372_10581221 | Ga0157372_105812212 | 213 |
| 205 | 3300025909 | Ga0207705_10092546 | Ga0207705_100925463 | 213 |
| 206 | 3300025921 | Ga0207652_10000013 | Ga0207652_1000001325 | 213 |
| 207 | 3300025932 | Ga0207690_10189075 | Ga0207690_101890752 | 213 |
| 208 | 3300026116 | Ga0207674_10081440 | Ga0207674_100814402 | 213 |
| 209 | 3300037418 | Ga0395900_0002692 | Ga0395900_0002692_16629_17342 | 213 |
| 210 | 3300037466 | Ga0395898_0000595 | Ga0395898_0000595_43728_44441 | 213 |
| 211 | 3300038443 | Ga0395901_0001672 | Ga0395901_0001672_16132_16845 | 213 |
| 212 | iso_pu_bacteria | 2738541278 | 2738725624 | 213 |
| 213 | iso_pu_bacteria | 2818991442 | 2819575028 | 213 |
| 214 | iso_pu_bacteria | 2818991460 | 2819676989 | 213 |
| 215 | iso_pu_bacteria | 2821136567 | 2821141125 | 213 |
| 216 | iso_pu_bacteria | 2884791551 | 2884796828 | 213 |
| 217 | iso_pu_bacteria | 2904467357 | 2904471626 | 213 |
| 218 | iso_pu_bacteria | 2929154850 | 2929159626 | 213 |
| 219 | iso_pu_bacteria | 2929177148 | 2929177655 | 213 |
| 220 | iso_pu_bacteria | 2929239360 | 2929240021 | 213 |
| 221 | iso_pu_bacteria | 2945977869 | 2945980004 | 213 |
| 222 | 3300009148 | Ga0105243_10000003 | Ga0105243_1000000316 | 214 |
| 223 | 3300049823 | Ga0501044_0139891 | Ga0501044_0139891_1184_1846 | 214 |
| 224 | iso_pu_bacteria | 2840677318 | 2840678737 | 214 |
| 225 | iso_pu_bacteria | 2883068021 | 2883071687 | 214 |
| 226 | iso_pu_bacteria | 2886627955 | 2886629909 | 214 |
| 227 | iso_pu_bacteria | 2896085136 | 2896086555 | 214 |
| 228 | iso_pu_bacteria | 2896109856 | 2896113144 | 214 |
| 229 | iso_pu_bacteria | 2929921140 | 2929921729 | 214 |
| 230 | iso_pu_bacteria | 8003151029 | 8003154276 | 214 |
| 231 | 3300006931 | Ga0097620_101087988 | Ga0097620_1010879881 | 215 |
| 232 | 3300025926 | Ga0207659_10781572 | Ga0207659_107815721 | 215 |
| 233 | 3300003761 | Ga0055535_1008804 | Ga0055535_10088041 | 216 |
| 234 | 3300005327 | Ga0070658_10376000 | Ga0070658_103760002 | 216 |
| 235 | 3300025242 | Ga0209258_100116 | Ga0209258_10011699 | 216 |
| 236 | 3300025254 | Ga0209148_1000175 | Ga0209148_100017530 | 216 |
| 237 | 3300049571 | Ga0501034_0099099 | Ga0501034_0099099_1587_2237 | 216 |
| 238 | 3300053088 | Ga0500644_0000260 | Ga0500644_0000260_11868_12518 | 216 |
| 239 | 3300053148 | Ga0500590_041398 | Ga0500590_041398_414_1064 | 216 |
| 240 | 3300053160 | Ga0500633_0001577 | Ga0500633_0001577_1815_2465 | 216 |
| 241 | 3300053161 | Ga0500634_0022500 | Ga0500634_0022500_1272_1922 | 216 |
| 242 | 3300053177 | Ga0500636_0002821 | Ga0500636_0002821_8177_8827 | 216 |
| 243 | 3300002739 | JGI25158J39367_1014901 | JGI25158J39367_10149012 | 217 |
| 244 | 3300003320 | rootH2_10001429 | rootH2_100014294 | 217 |
| 245 | 3300003320 | rootH2_10035434 | rootH2_100354343 | 217 |
| 246 | 3300003320 | rootH2_10064945 | rootH2_100649454 | 217 |
| 247 | 3300003322 | rootL2_10008865 | rootL2_1000886512 | 217 |
| 248 | 3300003322 | rootL2_10026021 | rootL2_1002602116 | 217 |
| 249 | 3300003322 | rootL2_10129454 | rootL2_101294542 | 217 |
| 250 | 3300003323 | rootH1_10052389 | rootH1_100523892 | 217 |
| 251 | 3300003794 | Ga0055531_10000080 | Ga0055531_1000008085 | 217 |
| 252 | 3300005327 | Ga0070658_10201064 | Ga0070658_102010642 | 217 |
| 253 | 3300005331 | Ga0070670_100125782 | Ga0070670_1001257823 | 217 |
| 254 | 3300005334 | Ga0068869_100109804 | Ga0068869_1001098043 | 217 |
| 255 | 3300005337 | Ga0070682_100128072 | Ga0070682_1001280721 | 217 |
| 256 | 3300005338 | Ga0068868_100410296 | Ga0068868_1004102961 | 217 |
| 257 | 3300005353 | Ga0070669_100012698 | Ga0070669_1000126982 | 217 |
| 258 | 3300005355 | Ga0070671_100291109 | Ga0070671_1002911092 | 217 |
| 259 | 3300005364 | Ga0070673_100055827 | Ga0070673_1000558275 | 217 |
| 260 | 3300005366 | Ga0070659_100252371 | Ga0070659_1002523712 | 217 |
| 261 | 3300005366 | Ga0070659_100787528 | Ga0070659_1007875281 | 217 |
| 262 | 3300005367 | Ga0070667_100007874 | Ga0070667_1000078747 | 217 |
| 263 | 3300005367 | Ga0070667_100012570 | Ga0070667_1000125703 | 217 |
| 264 | 3300005457 | Ga0070662_100527477 | Ga0070662_1005274771 | 217 |
| 265 | 3300005459 | Ga0068867_100198407 | Ga0068867_1001984072 | 217 |
| 266 | 3300005459 | Ga0068867_100283194 | Ga0068867_1002831941 | 217 |
| 267 | 3300005530 | Ga0070679_100040283 | Ga0070679_1000402832 | 217 |
| 268 | 3300005539 | Ga0068853_100009686 | Ga0068853_1000096862 | 217 |
| 269 | 3300005539 | Ga0068853_100016635 | Ga0068853_1000166354 | 217 |
| 270 | 3300005543 | Ga0070672_100137911 | Ga0070672_1001379113 | 217 |
| 271 | 3300005563 | Ga0068855_100090491 | Ga0068855_1000904913 | 217 |
| 272 | 3300005577 | Ga0068857_100049368 | Ga0068857_1000493684 | 217 |
| 273 | 3300005614 | Ga0068856_100065752 | Ga0068856_1000657523 | 217 |
| 274 | 3300005616 | Ga0068852_100013163 | Ga0068852_1000131632 | 217 |
| 275 | 3300005616 | Ga0068852_100149265 | Ga0068852_1001492652 | 217 |
| 276 | 3300005617 | Ga0068859_100031496 | Ga0068859_1000314967 | 217 |
| 277 | 3300005618 | Ga0068864_100101185 | Ga0068864_1001011852 | 217 |
| 278 | 3300005618 | Ga0068864_100321400 | Ga0068864_1003214002 | 217 |
| 279 | 3300005834 | Ga0068851_10013185 | Ga0068851_100131853 | 217 |
| 280 | 3300005834 | Ga0068851_10022420 | Ga0068851_100224202 | 217 |
| 281 | 3300005841 | Ga0068863_100037396 | Ga0068863_1000373961 | 217 |
| 282 | 3300005841 | Ga0068863_100083792 | Ga0068863_1000837921 | 217 |
| 283 | 3300005843 | Ga0068860_100001096 | Ga0068860_10000109618 | 217 |
| 284 | 3300006237 | Ga0097621_100002080 | Ga0097621_1000020803 | 217 |
| 285 | 3300006237 | Ga0097621_100224077 | Ga0097621_1002240773 | 217 |
| 286 | 3300006358 | Ga0068871_100005800 | Ga0068871_1000058004 | 217 |
| 287 | 3300006358 | Ga0068871_100145417 | Ga0068871_1001454171 | 217 |
| 288 | 3300006881 | Ga0068865_100016555 | Ga0068865_1000165553 | 217 |
| 289 | 3300006881 | Ga0068865_100680424 | Ga0068865_1006804241 | 217 |
| 290 | 3300006931 | Ga0097620_100031496 | Ga0097620_1000314967 | 217 |
| 291 | 3300009093 | Ga0105240_10000800 | Ga0105240_1000080038 | 217 |
| 292 | 3300009093 | Ga0105240_10006347 | Ga0105240_100063477 | 217 |
| 293 | 3300009093 | Ga0105240_10034582 | Ga0105240_100345823 | 217 |
| 294 | 3300009174 | Ga0105241_10001839 | Ga0105241_100018394 | 217 |
| 295 | 3300009174 | Ga0105241_10019304 | Ga0105241_100193043 | 217 |
| 296 | 3300009177 | Ga0105248_10045663 | Ga0105248_100456635 | 217 |
| 297 | 3300009545 | Ga0105237_10007301 | Ga0105237_100073019 | 217 |
| 298 | 3300009545 | Ga0105237_10013605 | Ga0105237_100136058 | 217 |
| 299 | 3300009545 | Ga0105237_10086440 | Ga0105237_100864403 | 217 |
| 300 | 3300009551 | Ga0105238_10000592 | Ga0105238_100005927 | 217 |
| 301 | 3300009551 | Ga0105238_10029073 | Ga0105238_100290733 | 217 |
| 302 | 3300009553 | Ga0105249_10010749 | Ga0105249_100107495 | 217 |
| 303 | 3300009553 | Ga0105249_10490878 | Ga0105249_104908782 | 217 |
| 304 | 3300010375 | Ga0105239_10045372 | Ga0105239_100453724 | 217 |
| 305 | 3300010375 | Ga0105239_10086193 | Ga0105239_100861932 | 217 |
| 306 | 3300013104 | Ga0157370_10018211 | Ga0157370_100182113 | 217 |
| 307 | 3300013104 | Ga0157370_10093810 | Ga0157370_100938102 | 217 |
| 308 | 3300013104 | Ga0157370_10118506 | Ga0157370_101185062 | 217 |
| 309 | 3300013105 | Ga0157369_10117048 | Ga0157369_101170483 | 217 |
| 310 | 3300013105 | Ga0157369_10893333 | Ga0157369_108933331 | 217 |
| 311 | 3300013296 | Ga0157374_10043806 | Ga0157374_100438064 | 217 |
| 312 | 3300013297 | Ga0157378_10006154 | Ga0157378_1000615411 | 217 |
| 313 | 3300013297 | Ga0157378_10006592 | Ga0157378_100065924 | 217 |
| 314 | 3300013297 | Ga0157378_10019626 | Ga0157378_100196266 | 217 |
| 315 | 3300013297 | Ga0157378_10091740 | Ga0157378_100917404 | 217 |
| 316 | 3300013297 | Ga0157378_10711139 | Ga0157378_107111392 | 217 |
| 317 | 3300013306 | Ga0163162_10008817 | Ga0163162_100088175 | 217 |
| 318 | 3300013306 | Ga0163162_10190554 | Ga0163162_101905543 | 217 |
| 319 | 3300013306 | Ga0163162_10459939 | Ga0163162_104599392 | 217 |
| 320 | 3300013306 | Ga0163162_10543390 | Ga0163162_105433901 | 217 |
| 321 | 3300013307 | Ga0157372_10003581 | Ga0157372_1000358112 | 217 |
| 322 | 3300013307 | Ga0157372_10117263 | Ga0157372_101172633 | 217 |
| 323 | 3300013307 | Ga0157372_10124972 | Ga0157372_101249722 | 217 |
| 324 | 3300013307 | Ga0157372_10133131 | Ga0157372_101331315 | 217 |
| 325 | 3300013307 | Ga0157372_10528380 | Ga0157372_105283802 | 217 |
| 326 | 3300013308 | Ga0157375_10000534 | Ga0157375_1000053421 | 217 |
| 327 | 3300013308 | Ga0157375_10059325 | Ga0157375_100593252 | 217 |
| 328 | 3300013308 | Ga0157375_10148157 | Ga0157375_101481574 | 217 |
| 329 | 3300014325 | Ga0163163_10000682 | Ga0163163_1000068227 | 217 |
| 330 | 3300014325 | Ga0163163_10719211 | Ga0163163_107192112 | 217 |
| 331 | 3300014326 | Ga0157380_10586256 | Ga0157380_105862562 | 217 |
| 332 | 3300014968 | Ga0157379_10018347 | Ga0157379_100183475 | 217 |
| 333 | 3300014968 | Ga0157379_10020819 | Ga0157379_100208193 | 217 |
| 334 | 3300014969 | Ga0157376_10000426 | Ga0157376_100004267 | 217 |
| 335 | 3300014969 | Ga0157376_10047734 | Ga0157376_100477344 | 217 |
| 336 | 3300014969 | Ga0157376_10147724 | Ga0157376_101477243 | 217 |
| 337 | 3300014969 | Ga0157376_10189974 | Ga0157376_101899741 | 217 |
| 338 | 3300015265 | Ga0182005_1000347 | Ga0182005_10003476 | 217 |
| 339 | 3300017792 | Ga0163161_10300704 | Ga0163161_103007042 | 217 |
| 340 | 3300025208 | Ga0209436_101020 | Ga0209436_1010204 | 217 |
| 341 | 3300025208 | Ga0209436_103416 | Ga0209436_1034164 | 217 |
| 342 | 3300025284 | Ga0209130_1010836 | Ga0209130_10108362 | 217 |
| 343 | 3300025302 | Ga0207426_1000024 | Ga0207426_1000024122 | 217 |
| 344 | 3300025304 | Ga0209257_1000004 | Ga0209257_100000485 | 217 |
| 345 | 3300025321 | Ga0207656_10011073 | Ga0207656_100110733 | 217 |
| 346 | 3300025903 | Ga0207680_10287583 | Ga0207680_102875832 | 217 |
| 347 | 3300025904 | Ga0207647_10039340 | Ga0207647_100393404 | 217 |
| 348 | 3300025909 | Ga0207705_10157074 | Ga0207705_101570742 | 217 |
| 349 | 3300025911 | Ga0207654_10275882 | Ga0207654_102758822 | 217 |
| 350 | 3300025912 | Ga0207707_10000747 | Ga0207707_1000074712 | 217 |
| 351 | 3300025913 | Ga0207695_10001230 | Ga0207695_1000123030 | 217 |
| 352 | 3300025913 | Ga0207695_10028221 | Ga0207695_100282216 | 217 |
| 353 | 3300025913 | Ga0207695_10199309 | Ga0207695_101993092 | 217 |
| 354 | 3300025914 | Ga0207671_10000931 | Ga0207671_100009317 | 217 |
| 355 | 3300025914 | Ga0207671_10035560 | Ga0207671_100355602 | 217 |
| 356 | 3300025917 | Ga0207660_10064870 | Ga0207660_100648701 | 217 |
| 357 | 3300025921 | Ga0207652_10002726 | Ga0207652_100027269 | 217 |
| 358 | 3300025923 | Ga0207681_10279777 | Ga0207681_102797772 | 217 |
| 359 | 3300025924 | Ga0207694_10033590 | Ga0207694_100335904 | 217 |
| 360 | 3300025924 | Ga0207694_10106618 | Ga0207694_101066181 | 217 |
| 361 | 3300025925 | Ga0207650_10041112 | Ga0207650_100411121 | 217 |
| 362 | 3300025925 | Ga0207650_10087017 | Ga0207650_100870172 | 217 |
| 363 | 3300025925 | Ga0207650_10814814 | Ga0207650_108148142 | 217 |
| 364 | 3300025932 | Ga0207690_10075337 | Ga0207690_100753371 | 217 |
| 365 | 3300025940 | Ga0207691_10350751 | Ga0207691_103507513 | 217 |
| 366 | 3300025941 | Ga0207711_10103947 | Ga0207711_101039471 | 217 |
| 367 | 3300025942 | Ga0207689_10238157 | Ga0207689_102381572 | 217 |
| 368 | 3300025949 | Ga0207667_10000098 | Ga0207667_1000009892 | 217 |
| 369 | 3300025949 | Ga0207667_10334402 | Ga0207667_103344022 | 217 |
| 370 | 3300025961 | Ga0207712_10007102 | Ga0207712_100071025 | 217 |
| 371 | 3300025986 | Ga0207658_10010201 | Ga0207658_100102015 | 217 |
| 372 | 3300025986 | Ga0207658_10023454 | Ga0207658_100234543 | 217 |
| 373 | 3300026023 | Ga0207677_10753100 | Ga0207677_107531001 | 217 |
| 374 | 3300026041 | Ga0207639_10083244 | Ga0207639_100832443 | 217 |
| 375 | 3300026041 | Ga0207639_10093861 | Ga0207639_100938612 | 217 |
| 376 | 3300026041 | Ga0207639_10367693 | Ga0207639_103676932 | 217 |
| 377 | 3300026041 | Ga0207639_10410040 | Ga0207639_104100401 | 217 |
| 378 | 3300026078 | Ga0207702_10048604 | Ga0207702_100486043 | 217 |
| 379 | 3300026078 | Ga0207702_10053865 | Ga0207702_100538652 | 217 |
| 380 | 3300026088 | Ga0207641_10014569 | Ga0207641_100145697 | 217 |
| 381 | 3300026088 | Ga0207641_10042064 | Ga0207641_100420644 | 217 |
| 382 | 3300026089 | Ga0207648_10278448 | Ga0207648_102784482 | 217 |
| 383 | 3300026089 | Ga0207648_10616631 | Ga0207648_106166312 | 217 |
| 384 | 3300026095 | Ga0207676_10051429 | Ga0207676_100514292 | 217 |
| 385 | 3300026095 | Ga0207676_10289212 | Ga0207676_102892121 | 217 |
| 386 | 3300026116 | Ga0207674_10000969 | Ga0207674_1000096925 | 217 |
| 387 | 3300026116 | Ga0207674_10062691 | Ga0207674_100626914 | 217 |
| 388 | 3300026121 | Ga0207683_10515237 | Ga0207683_105152372 | 217 |
| 389 | 3300026142 | Ga0207698_10023764 | Ga0207698_100237644 | 217 |
| 390 | 3300026142 | Ga0207698_10289256 | Ga0207698_102892562 | 217 |
| 391 | 3300028379 | Ga0268266_10000068 | Ga0268266_10000068216 | 217 |
| 392 | 3300028380 | Ga0268265_10609260 | Ga0268265_106092602 | 217 |
| 393 | 3300028381 | Ga0268264_10003074 | Ga0268264_100030747 | 217 |
| 394 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012292 | 217 |
| 395 | 3300028794 | Ga0307515_10000059 | Ga0307515_10000059179 | 217 |
| 396 | 3300028794 | Ga0307515_10269292 | Ga0307515_102692922 | 217 |
| 397 | 3300031251 | Ga0265327_10000013 | Ga0265327_10000013302 | 217 |
| 398 | 3300031251 | Ga0265327_10000288 | Ga0265327_1000028851 | 217 |
| 399 | 3300031251 | Ga0265327_10035674 | Ga0265327_100356742 | 217 |
| 400 | 3300031251 | Ga0265327_10129267 | Ga0265327_101292671 | 217 |
| 401 | 3300031456 | Ga0307513_10036214 | Ga0307513_100362143 | 217 |
| 402 | 3300031456 | Ga0307513_10052525 | Ga0307513_100525254 | 217 |
| 403 | 3300031507 | Ga0307509_10029227 | Ga0307509_100292276 | 217 |
| 404 | 3300031507 | Ga0307509_10161100 | Ga0307509_101611003 | 217 |
| 405 | 3300031507 | Ga0307509_10213553 | Ga0307509_102135532 | 217 |
| 406 | 3300031730 | Ga0307516_10218420 | Ga0307516_102184201 | 217 |
| 407 | 3300031852 | Ga0307410_10372350 | Ga0307410_103723502 | 217 |
| 408 | 3300036401 | Ga0373937_0310604 | Ga0373937_0310604_587_1243 | 217 |
| 409 | 3300036401 | Ga0373937_0807063 | Ga0373937_0807063_77_733 | 217 |
| 410 | 3300041452 | Ga0451793_1095409 | Ga0451793_1095409_47_703 | 217 |
| 411 | 3300041997 | Ga0439431_0070608 | Ga0439431_0070608_97_750 | 217 |
| 412 | 3300042007 | Ga0439449_0046423 | Ga0439449_0046423_336_989 | 217 |
| 413 | 3300042014 | Ga0439457_028482 | Ga0439457_028482_428_1081 | 217 |
| 414 | 3300042876 | Ga0451577_0249263 | Ga0451577_0249263_850_1506 | 217 |
| 415 | 3300044658 | Ga0466972_0000057 | Ga0466972_0000057_22691_23347 | 217 |
| 416 | 3300044658 | Ga0466972_0001286 | Ga0466972_0001286_8220_8876 | 217 |
| 417 | 3300044658 | Ga0466972_0077972 | Ga0466972_0077972_103_756 | 217 |
| 418 | 3300044673 | Ga0453683_0354821 | Ga0453683_0354821_139_795 | 217 |
| 419 | 3300044712 | Ga0453684_0011435 | Ga0453684_0011435_11996_12652 | 217 |
| 420 | 3300044712 | Ga0453684_0057694 | Ga0453684_0057694_2701_3357 | 217 |
| 421 | 3300044765 | Ga0466970_0131394 | Ga0466970_0131394_186_842 | 217 |
| 422 | 3300046453 | Ga0495627_006057 | Ga0495627_006057_559_1212 | 217 |
| 423 | 3300046460 | Ga0495638_0118696 | Ga0495638_0118696_476_1132 | 217 |
| 424 | 3300046558 | Ga0495633_0000116 | Ga0495633_0000116_62859_63512 | 217 |
| 425 | 3300046616 | Ga0495668_0002655 | Ga0495668_0002655_2429_3085 | 217 |
| 426 | 3300046691 | Ga0495670_0094099 | Ga0495670_0094099_630_1286 | 217 |
| 427 | 3300047471 | Ga0495684_0481590 | Ga0495684_0481590_42_698 | 217 |
| 428 | 3300048907 | Ga0496104_0158260 | Ga0496104_0158260_74_730 | 217 |
| 429 | 3300048917 | Ga0496114_0023774 | Ga0496114_0023774_4021_4677 | 217 |
| 430 | 3300048929 | Ga0496126_0077415 | Ga0496126_0077415_31_684 | 217 |
| 431 | 3300049570 | Ga0501033_0008636 | Ga0501033_0008636_1508_2164 | 217 |
| 432 | 3300049570 | Ga0501033_0365160 | Ga0501033_0365160_133_789 | 217 |
| 433 | 3300049571 | Ga0501034_0023070 | Ga0501034_0023070_4950_5606 | 217 |
| 434 | 3300049703 | Ga0501219_000178 | Ga0501219_000178_7199_7855 | 217 |
| 435 | 3300049742 | Ga0501080_0334765 | Ga0501080_0334765_514_1170 | 217 |
| 436 | 3300049758 | Ga0501241_012764 | Ga0501241_012764_681_1337 | 217 |
| 437 | 3300049823 | Ga0501044_0029803 | Ga0501044_0029803_5077_5733 | 217 |
| 438 | 3300049823 | Ga0501044_0243747 | Ga0501044_0243747_407_1063 | 217 |
| 439 | 3300050005 | Ga0501284_00036 | Ga0501284_00036_45593_46249 | 217 |
| 440 | 3300050005 | Ga0501284_00614 | Ga0501284_00614_1058_1714 | 217 |
| 441 | 3300050507 | nmdc:mga05p37_43236_c1 | nmdc:mga05p37_43236_c1_3586_4242 | 217 |
| 442 | 3300053090 | Ga0500646_0001397 | Ga0500646_0001397_1317_1973 | 217 |
| 443 | 3300053090 | Ga0500646_0004077 | Ga0500646_0004077_2855_3508 | 217 |
| 444 | 3300053092 | Ga0500583_0010948 | Ga0500583_0010948_2354_3007 | 217 |
| 445 | 3300053093 | Ga0500651_0032311 | Ga0500651_0032311_1288_1941 | 217 |
| 446 | 3300053093 | Ga0500651_0229784 | Ga0500651_0229784_320_976 | 217 |
| 447 | 3300053093 | Ga0500651_0287662 | Ga0500651_0287662_59_712 | 217 |
| 448 | 3300053100 | Ga0500660_070104 | Ga0500660_070104_389_1042 | 217 |
| 449 | 3300053108 | Ga0500562_000013 | Ga0500562_000013_87680_88336 | 217 |
| 450 | 3300053118 | Ga0500594_0017945 | Ga0500594_0017945_265_921 | 217 |
| 451 | 3300053131 | Ga0500652_029591 | Ga0500652_029591_849_1505 | 217 |
| 452 | 3300053134 | Ga0500658_0004288 | Ga0500658_0004288_1894_2547 | 217 |
| 453 | 3300053142 | Ga0500577_0001916 | Ga0500577_0001916_3671_4324 | 217 |
| 454 | 3300053151 | Ga0500604_0024558 | Ga0500604_0024558_883_1539 | 217 |
| 455 | 3300053153 | Ga0500616_0013304 | Ga0500616_0013304_1089_1745 | 217 |
| 456 | 3300053153 | Ga0500616_0032834 | Ga0500616_0032834_256_909 | 217 |
| 457 | 3300053156 | Ga0500622_0000212 | Ga0500622_0000212_11632_12285 | 217 |
| 458 | 3300053730 | Ga0500645_045660 | Ga0500645_045660_232_888 | 217 |
| 459 | 3300053730 | Ga0500645_116112 | Ga0500645_116112_26_679 | 217 |
| 460 | 3300055283 | Ga0500661_004853 | Ga0500661_004853_1315_1968 | 217 |
| 461 | 3300001979 | JGI24740J21852_10007320 | JGI24740J21852_100073203 | 218 |
| 462 | 3300003215 | JGI25153J46596_10017765 | JGI25153J46596_100177652 | 218 |
| 463 | 3300003320 | rootH2_10093065 | rootH2_100930653 | 218 |
| 464 | 3300003323 | rootH1_10007189 | rootH1_100071896 | 218 |
| 465 | 3300003354 | JGI25160J50197_1011107 | JGI25160J50197_10111074 | 218 |
| 466 | 3300005289 | Ga0065704_10091350 | Ga0065704_100913503 | 218 |
| 467 | 3300005331 | Ga0070670_100237683 | Ga0070670_1002376832 | 218 |
| 468 | 3300005337 | Ga0070682_100000019 | Ga0070682_100000019163 | 218 |
| 469 | 3300005337 | Ga0070682_100031170 | Ga0070682_1000311703 | 218 |
| 470 | 3300005339 | Ga0070660_100000519 | Ga0070660_1000005194 | 218 |
| 471 | 3300005345 | Ga0070692_10483593 | Ga0070692_104835931 | 218 |
| 472 | 3300005355 | Ga0070671_100645420 | Ga0070671_1006454201 | 218 |
| 473 | 3300005366 | Ga0070659_100074540 | Ga0070659_1000745402 | 218 |
| 474 | 3300005458 | Ga0070681_10046803 | Ga0070681_100468032 | 218 |
| 475 | 3300005459 | Ga0068867_100085178 | Ga0068867_1000851783 | 218 |
| 476 | 3300005459 | Ga0068867_100570857 | Ga0068867_1005708571 | 218 |
| 477 | 3300005530 | Ga0070679_100038514 | Ga0070679_1000385144 | 218 |
| 478 | 3300005530 | Ga0070679_100060254 | Ga0070679_1000602544 | 218 |
| 479 | 3300005535 | Ga0070684_100137687 | Ga0070684_1001376873 | 218 |
| 480 | 3300005539 | Ga0068853_100405807 | Ga0068853_1004058072 | 218 |
| 481 | 3300005543 | Ga0070672_100186938 | Ga0070672_1001869382 | 218 |
| 482 | 3300005563 | Ga0068855_100106522 | Ga0068855_1001065223 | 218 |
| 483 | 3300005578 | Ga0068854_100882581 | Ga0068854_1008825811 | 218 |
| 484 | 3300005614 | Ga0068856_100008593 | Ga0068856_1000085937 | 218 |
| 485 | 3300005616 | Ga0068852_100004838 | Ga0068852_10000483810 | 218 |
| 486 | 3300005616 | Ga0068852_100110708 | Ga0068852_1001107083 | 218 |
| 487 | 3300005617 | Ga0068859_100036292 | Ga0068859_1000362924 | 218 |
| 488 | 3300005618 | Ga0068864_100029084 | Ga0068864_1000290844 | 218 |
| 489 | 3300005618 | Ga0068864_100363186 | Ga0068864_1003631862 | 218 |
| 490 | 3300005834 | Ga0068851_10204155 | Ga0068851_102041552 | 218 |
| 491 | 3300005841 | Ga0068863_100794219 | Ga0068863_1007942192 | 218 |
| 492 | 3300005843 | Ga0068860_100001650 | Ga0068860_1000016505 | 218 |
| 493 | 3300005843 | Ga0068860_100127997 | Ga0068860_1001279972 | 218 |
| 494 | 3300005844 | Ga0068862_100016480 | Ga0068862_1000164806 | 218 |
| 495 | 3300006195 | Ga0075366_10015481 | Ga0075366_100154814 | 218 |
| 496 | 3300006931 | Ga0097620_100036292 | Ga0097620_1000362924 | 218 |
| 497 | 3300009174 | Ga0105241_10007179 | Ga0105241_100071798 | 218 |
| 498 | 3300009553 | Ga0105249_10211544 | Ga0105249_102115443 | 218 |
| 499 | 3300010375 | Ga0105239_10080298 | Ga0105239_100802983 | 218 |
| 500 | 3300010375 | Ga0105239_10179023 | Ga0105239_101790234 | 218 |
| 501 | 3300013100 | Ga0157373_10000927 | Ga0157373_100009276 | 218 |
| 502 | 3300013100 | Ga0157373_10010705 | Ga0157373_100107058 | 218 |
| 503 | 3300013102 | Ga0157371_10000218 | Ga0157371_1000021870 | 218 |
| 504 | 3300013102 | Ga0157371_10005354 | Ga0157371_100053547 | 218 |
| 505 | 3300013102 | Ga0157371_10005559 | Ga0157371_1000555911 | 218 |
| 506 | 3300013102 | Ga0157371_10021485 | Ga0157371_100214856 | 218 |
| 507 | 3300013102 | Ga0157371_10025438 | Ga0157371_100254382 | 218 |
| 508 | 3300013105 | Ga0157369_10052097 | Ga0157369_100520973 | 218 |
| 509 | 3300013296 | Ga0157374_10194339 | Ga0157374_101943393 | 218 |
| 510 | 3300013306 | Ga0163162_10002780 | Ga0163162_100027809 | 218 |
| 511 | 3300013306 | Ga0163162_10395764 | Ga0163162_103957641 | 218 |
| 512 | 3300013307 | Ga0157372_10013617 | Ga0157372_100136176 | 218 |
| 513 | 3300013307 | Ga0157372_10123969 | Ga0157372_101239693 | 218 |
| 514 | 3300013308 | Ga0157375_11199110 | Ga0157375_111991101 | 218 |
| 515 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004594 | 218 |
| 516 | 3300025250 | Ga0209026_1000136 | Ga0209026_100013665 | 218 |
| 517 | 3300025297 | Ga0209758_1023231 | Ga0209758_10232312 | 218 |
| 518 | 3300025302 | Ga0207426_1001807 | Ga0207426_10018078 | 218 |
| 519 | 3300025893 | Ga0207682_10007850 | Ga0207682_100078502 | 218 |
| 520 | 3300025912 | Ga0207707_10186738 | Ga0207707_101867382 | 218 |
| 521 | 3300025919 | Ga0207657_10002923 | Ga0207657_100029234 | 218 |
| 522 | 3300025919 | Ga0207657_10033182 | Ga0207657_100331822 | 218 |
| 523 | 3300025921 | Ga0207652_10024091 | Ga0207652_100240914 | 218 |
| 524 | 3300025921 | Ga0207652_10074746 | Ga0207652_100747464 | 218 |
| 525 | 3300025921 | Ga0207652_10131141 | Ga0207652_101311412 | 218 |
| 526 | 3300025926 | Ga0207659_10132026 | Ga0207659_101320262 | 218 |
| 527 | 3300025932 | Ga0207690_10034696 | Ga0207690_100346962 | 218 |
| 528 | 3300025937 | Ga0207669_10605275 | Ga0207669_106052751 | 218 |
| 529 | 3300025940 | Ga0207691_10022756 | Ga0207691_100227563 | 218 |
| 530 | 3300025940 | Ga0207691_10130113 | Ga0207691_101301133 | 218 |
| 531 | 3300025940 | Ga0207691_10407886 | Ga0207691_104078861 | 218 |
| 532 | 3300025942 | Ga0207689_10076399 | Ga0207689_100763993 | 218 |
| 533 | 3300025949 | Ga0207667_10023418 | Ga0207667_100234184 | 218 |
| 534 | 3300025949 | Ga0207667_11000812 | Ga0207667_110008121 | 218 |
| 535 | 3300025960 | Ga0207651_10435957 | Ga0207651_104359572 | 218 |
| 536 | 3300025986 | Ga0207658_10211175 | Ga0207658_102111753 | 218 |
| 537 | 3300026023 | Ga0207677_10383701 | Ga0207677_103837011 | 218 |
| 538 | 3300026041 | Ga0207639_10026703 | Ga0207639_100267033 | 218 |
| 539 | 3300026041 | Ga0207639_10161062 | Ga0207639_101610622 | 218 |
| 540 | 3300026041 | Ga0207639_10184154 | Ga0207639_101841541 | 218 |
| 541 | 3300026088 | Ga0207641_10720892 | Ga0207641_107208921 | 218 |
| 542 | 3300026089 | Ga0207648_10040263 | Ga0207648_100402634 | 218 |
| 543 | 3300026089 | Ga0207648_10117470 | Ga0207648_101174703 | 218 |
| 544 | 3300026089 | Ga0207648_10120546 | Ga0207648_101205463 | 218 |
| 545 | 3300026095 | Ga0207676_10175098 | Ga0207676_101750982 | 218 |
| 546 | 3300026116 | Ga0207674_10023895 | Ga0207674_100238954 | 218 |
| 547 | 3300026116 | Ga0207674_10089693 | Ga0207674_100896933 | 218 |
| 548 | 3300026121 | Ga0207683_10012906 | Ga0207683_100129065 | 218 |
| 549 | 3300026121 | Ga0207683_10822585 | Ga0207683_108225851 | 218 |
| 550 | 3300026142 | Ga0207698_10086891 | Ga0207698_100868911 | 218 |
| 551 | 3300028380 | Ga0268265_10022069 | Ga0268265_100220692 | 218 |
| 552 | 3300028381 | Ga0268264_10207704 | Ga0268264_102077042 | 218 |
| 553 | 3300028800 | Ga0265338_10141715 | Ga0265338_101417152 | 218 |
| 554 | 3300030521 | Ga0307511_10000201 | Ga0307511_1000020150 | 218 |
| 555 | 3300031344 | Ga0265316_10039776 | Ga0265316_100397763 | 218 |
| 556 | 3300035172 | Ga0373955_0252363 | Ga0373955_0252363_158_817 | 218 |
| 557 | 3300035724 | Ga0373933_0257462 | Ga0373933_0257462_149_808 | 218 |
| 558 | 3300036401 | Ga0373937_0566346 | Ga0373937_0566346_86_745 | 218 |
| 559 | 3300036647 | Ga0316582_0139304 | Ga0316582_0139304_887_1558 | 218 |
| 560 | 3300036712 | Ga0316584_0052487 | Ga0316584_0052487_2294_2965 | 218 |
| 561 | 3300037312 | Ga0395899_0026146 | Ga0395899_0026146_2479_3198 | 218 |
| 562 | 3300037418 | Ga0395900_0008628 | Ga0395900_0008628_6643_7362 | 218 |
| 563 | 3300037466 | Ga0395898_0017447 | Ga0395898_0017447_220_939 | 218 |
| 564 | 3300037471 | Ga0395905_0004944 | Ga0395905_0004944_2170_2889 | 218 |
| 565 | 3300038443 | Ga0395901_0007597 | Ga0395901_0007597_6391_7110 | 218 |
| 566 | 3300038443 | Ga0395901_0114128 | Ga0395901_0114128_522_1244 | 218 |
| 567 | 3300041505 | Ga0451849_0688680 | Ga0451849_0688680_201_860 | 218 |
| 568 | 3300041512 | Ga0451853_2525003 | Ga0451853_2525003_124_783 | 218 |
| 569 | 3300041997 | Ga0439431_0027745 | Ga0439431_0027745_91_747 | 218 |
| 570 | 3300042005 | Ga0439448_0088074 | Ga0439448_0088074_67_726 | 218 |
| 571 | 3300042007 | Ga0439449_0061030 | Ga0439449_0061030_722_1381 | 218 |
| 572 | 3300044712 | Ga0453684_0017764 | Ga0453684_0017764_7965_8639 | 218 |
| 573 | 3300046475 | Ga0495639_0217866 | Ga0495639_0217866_14_673 | 218 |
| 574 | 3300046535 | Ga0495586_0114007 | Ga0495586_0114007_194_853 | 218 |
| 575 | 3300046536 | Ga0495587_0089912 | Ga0495587_0089912_93_752 | 218 |
| 576 | 3300046539 | Ga0495621_0033310 | Ga0495621_0033310_341_1000 | 218 |
| 577 | 3300046616 | Ga0495668_0000099 | Ga0495668_0000099_29518_30177 | 218 |
| 578 | 3300046663 | Ga0495635_0131993 | Ga0495635_0131993_889_1548 | 218 |
| 579 | 3300046683 | Ga0495658_0318132 | Ga0495658_0318132_67_726 | 218 |
| 580 | 3300047319 | Ga0495674_0131800 | Ga0495674_0131800_882_1541 | 218 |
| 581 | 3300047319 | Ga0495674_0308199 | Ga0495674_0308199_92_751 | 218 |
| 582 | 3300048924 | Ga0496121_0000081 | Ga0496121_0000081_187353_188009 | 218 |
| 583 | 3300049570 | Ga0501033_0034295 | Ga0501033_0034295_190_909 | 218 |
| 584 | 3300049570 | Ga0501033_0136954 | Ga0501033_0136954_153_866 | 218 |
| 585 | 3300049570 | Ga0501033_0308481 | Ga0501033_0308481_130_786 | 218 |
| 586 | 3300049571 | Ga0501034_0014518 | Ga0501034_0014518_3553_4266 | 218 |
| 587 | 3300049579 | Ga0501043_0074054 | Ga0501043_0074054_743_1462 | 218 |
| 588 | 3300049581 | Ga0501047_0116620 | Ga0501047_0116620_289_945 | 218 |
| 589 | 3300049586 | Ga0501070_0098427 | Ga0501070_0098427_709_1422 | 218 |
| 590 | 3300049671 | Ga0501238_006580 | Ga0501238_006580_322_978 | 218 |
| 591 | 3300049822 | Ga0501035_0023737 | Ga0501035_0023737_2653_3372 | 218 |
| 592 | 3300049822 | Ga0501035_0114943 | Ga0501035_0114943_1404_2117 | 218 |
| 593 | 3300049823 | Ga0501044_0047818 | Ga0501044_0047818_3556_4275 | 218 |
| 594 | 3300049823 | Ga0501044_0058772 | Ga0501044_0058772_491_1201 | 218 |
| 595 | 3300050493 | nmdc:mga0k408_44352_c1 | nmdc:mga0k408_44352_c1_68_727 | 218 |
| 596 | 3300050511 | nmdc:mga08y16_714280_c1 | nmdc:mga08y16_714280_c1_102_761 | 218 |
| 597 | 3300053085 | Ga0495619_0186445 | Ga0495619_0186445_29_688 | 218 |
| 598 | 3300053133 | Ga0500655_031558 | Ga0500655_031558_189_851 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gt1-assembly1.cif.gz_A | crystal structure of cbpa from l. salivarius ren | 0.6893 | 96 | 191 |
| 7cnz-assembly2.cif.gz_G | crystal structure of 10pe bound psd from e. coli (2.70 a) | 0.6579 | 54 | 193 |
| 6f6w-assembly1.cif.gz_D | structure of mycobacterium smegmatis rna polymerase core | 0.5913 | 112 | 181 |
| 4lxc-assembly5.cif.gz_C-2 | the antimicrobial peptidase lysostaphin from staphylococcus simulans | 0.5701 | 63 | 191 |
| 4qpb-assembly1.cif.gz_A | catalytic domain of the antimicrobial peptidase lysostaphin from staphylococcus simulans crystallized in the absence of phosphate | 0.54 | 74 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9579 | 52 | 215 | 2.70.70.10 |
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8994 | 52 | 215 | 2.70.70.10 |
| af_Q58227_16_200_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8685 | 48 | 215 | 2.70.70.10 |
| af_I1KUF4_411_621_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.852 | 55 | 215 | 2.70.70.10 |
| af_P0A8K1_63_285_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8459 | 52 | 215 | 2.70.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G4GR72-F1-model_v4 | Phosphatidylserine decarboxylase family protein | 0.9931 | 68 | 216 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A822EUS2-F1-model_v4 | Phosphatidylserine decarboxylase | 0.9924 | 55 | 218 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A3D5J2C6-F1-model_v4 | Phosphatidylserine decarboxylase family protein | 0.9899 | 84 | 217 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A4Q3P002-F1-model_v4 | deleted | 0.9898 | 84 | 218 |
|
| AF-A0A7C7NC87-F1-model_v4 | Phosphatidylserine decarboxylase family protein | 0.9866 | 78 | 218 |
GO:0004609
GO:0005886 GO:0008654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar