F467795

General Info

Members Datasets Scaffolds Average Seq Length
598 257 579 219

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10211175|Ga0207658_102111753
Length 256
Sequence MLCKVAARIGLHFSIRPDCTLFNIPSFLYICRSNPCMKIHKEGFKIIVITAILFALINLVSFYFVSFHYPIISWLIFIVTMGLLLFIISFFRQPARELTSGENLVICPADGKVVVIEEMFDTEYFNSKRLQVSIFMSPANVHVNRNPISGQVVYNKYHKGKYLVAWNPKSSTENERHSVVIRHSTSDILVKQIAGALAKRIKNYLEVGQQVQQNNELGFIRFGSRVDVLLPVGTTVNVQLNQVVKGGVTVLATLKP

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
9 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
10 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
11 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
12 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
13 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
14 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
15 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
16 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
17 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
18 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
227 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
253 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
254 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
257 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.03
Nodule 0
Rhizoplane 0.67
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007320 3300001979 Bacteria 4497
2 JGI24739J22299_10000030 3300001989 Bacteria 39896
3 JGI24739J22299_10108048 3300001989 Unclassified 836
4 JGI25158J39367_1014901 3300002739 Bacteria 1000
5 JGI25153J46596_10011676 3300003215 Bacteria 3861
6 JGI25153J46596_10017765 3300003215 Bacteria 2789
7 rootH2_10001429 3300003320 Bacteria 14331
8 rootH2_10035434 3300003320 Bacteria 17210
9 rootH2_10064945 3300003320 Bacteria 3949
10 rootH2_10093065 3300003320 Bacteria 1394
11 rootL2_10008865 3300003322 Bacteria 21299
12 rootL2_10026021 3300003322 Bacteria 20401
13 rootL2_10129454 3300003322 Bacteria 5168
14 rootH1_10007189 3300003323 Bacteria 65578
15 rootH1_10052389 3300003323 Bacteria 2098
16 rootH1_10093904 3300003323 Bacteria 2880
17 JGI25160J50197_1001552 3300003354 Bacteria 11373
18 JGI25160J50197_1011107 3300003354 Bacteria 3212
19 Ga0055535_1008804 3300003761 Bacteria 1786
20 Ga0055526_1022488 3300003771 Bacteria 2141
21 Ga0055528_1001162 3300003790 Bacteria 17034
22 Ga0055530_10000185 3300003791 Bacteria 55895
23 Ga0055531_10000080 3300003794 Bacteria 103922
24 Ga0065165_1000658 3300005262 Bacteria 49852
25 Ga0065704_10091350 3300005289 Bacteria 2723
26 Ga0070658_10006533 3300005327 Bacteria 9462
27 Ga0070658_10201064 3300005327 Unclassified 1681
28 Ga0070658_10376000 3300005327 Bacteria 1218
29 Ga0070683_100038010 3300005329 Bacteria 4410
30 Ga0070683_101047810 3300005329 Unclassified 783
31 Ga0070670_100125782 3300005331 Bacteria 2212
32 Ga0070670_100237683 3300005331 Bacteria 1586
33 Ga0070677_10224743 3300005333 Bacteria 919
34 Ga0068869_100028528 3300005334 Bacteria 3901
35 Ga0068869_100109804 3300005334 Bacteria 2097
36 Ga0068869_100474676 3300005334 Bacteria 1040
37 Ga0070666_10000072 3300005335 Bacteria 75356
38 Ga0070666_10056940 3300005335 Bacteria 2641
39 Ga0070680_100024400 3300005336 Bacteria 4831
40 Ga0070680_100066154 3300005336 Bacteria 2963
41 Ga0070682_100000019 3300005337 Bacteria 220844
42 Ga0070682_100002600 3300005337 Bacteria 9974
43 Ga0070682_100018150 3300005337 Bacteria 4108
44 Ga0070682_100031170 3300005337 Bacteria 3224
45 Ga0070682_100128072 3300005337 Bacteria 1714
46 Ga0068868_100023873 3300005338 Bacteria 4633
47 Ga0068868_100146592 3300005338 Bacteria 1941
48 Ga0068868_100410296 3300005338 Bacteria 1171
49 Ga0070660_100000519 3300005339 Bacteria 25704
50 Ga0070660_100010460 3300005339 Bacteria 6558
51 Ga0070660_100025572 3300005339 Bacteria 4389
52 Ga0070660_100066256 3300005339 Bacteria 2811
53 Ga0070689_100372195 3300005340 Bacteria 1202
54 Ga0070661_100010699 3300005344 Bacteria 6383
55 Ga0070692_10483593 3300005345 Bacteria 799
56 Ga0070668_100255139 3300005347 Unclassified 1457
57 Ga0070668_100268781 3300005347 Bacteria 1421
58 Ga0070669_100012698 3300005353 Bacteria 5979
59 Ga0070675_100542255 3300005354 Bacteria 1051
60 Ga0070671_100024703 3300005355 Bacteria 4922
61 Ga0070671_100291109 3300005355 Bacteria 1390
62 Ga0070671_100645420 3300005355 Bacteria 916
63 Ga0070673_100012881 3300005364 Bacteria 5760
64 Ga0070673_100017881 3300005364 Bacteria 5052
65 Ga0070673_100055827 3300005364 Unclassified 3113
66 Ga0070688_100033880 3300005365 Bacteria 3089
67 Ga0070659_100008369 3300005366 Bacteria 7555
68 Ga0070659_100074540 3300005366 Unclassified 2703
69 Ga0070659_100082560 3300005366 Bacteria 2567
70 Ga0070659_100092926 3300005366 Bacteria 2420
71 Ga0070659_100252371 3300005366 Bacteria 1462
72 Ga0070659_100787528 3300005366 Bacteria 826
73 Ga0070667_100007874 3300005367 Bacteria 8840
74 Ga0070667_100012570 3300005367 Bacteria 7001
75 Ga0070663_100125519 3300005455 Bacteria 1944
76 Ga0070662_100017715 3300005457 Bacteria 4805
77 Ga0070662_100527477 3300005457 Bacteria 987
78 Ga0070681_10046803 3300005458 Bacteria 4324
79 Ga0070681_10128947 3300005458 Unclassified 2462
80 Ga0070681_10156507 3300005458 Bacteria 2203
81 Ga0068867_100085178 3300005459 Bacteria 2389
82 Ga0068867_100198407 3300005459 Bacteria 1605
83 Ga0068867_100283194 3300005459 Unclassified 1360
84 Ga0068867_100520203 3300005459 Bacteria 1026
85 Ga0068867_100570857 3300005459 Bacteria 982
86 Ga0070685_10042112 3300005466 Bacteria 2604
87 Ga0070679_100006985 3300005530 Bacteria 10536
88 Ga0070679_100022824 3300005530 Bacteria 6120
89 Ga0070679_100038514 3300005530 Bacteria 4754
90 Ga0070679_100040283 3300005530 Bacteria 4648
91 Ga0070679_100060254 3300005530 Unclassified 3782
92 Ga0070679_100136411 3300005530 Bacteria 2434
93 Ga0070684_100044026 3300005535 Bacteria 3859
94 Ga0070684_100137687 3300005535 Unclassified 2206
95 Ga0070684_100174326 3300005535 Unclassified 1954
96 Ga0068853_100009686 3300005539 Bacteria 7769
97 Ga0068853_100013295 3300005539 Bacteria 6721
98 Ga0068853_100016635 3300005539 Bacteria 6056
99 Ga0068853_100110454 3300005539 Bacteria 2442
100 Ga0068853_100405807 3300005539 Bacteria 1276
101 Ga0068853_100884841 3300005539 Unclassified 857
102 Ga0070672_100137911 3300005543 Bacteria 2010
103 Ga0070672_100186938 3300005543 Bacteria 1728
104 Ga0070665_100265127 3300005548 Bacteria 1719
105 Ga0068855_100001027 3300005563 Bacteria 34809
106 Ga0068855_100029906 3300005563 Bacteria 6514
107 Ga0068855_100081073 3300005563 Bacteria 3762
108 Ga0068855_100090491 3300005563 Bacteria 3532
109 Ga0068855_100098048 3300005563 Bacteria 3376
110 Ga0068855_100106522 3300005563 Unclassified 3222
111 Ga0068855_100239595 3300005563 Unclassified 2028
112 Ga0070664_100018535 3300005564 Bacteria 5720
113 Ga0068857_100049368 3300005577 Bacteria 3733
114 Ga0068857_100073176 3300005577 Bacteria 3053
115 Ga0068857_100213809 3300005577 Bacteria 1760
116 Ga0068854_100035141 3300005578 Bacteria 3506
117 Ga0068854_100089154 3300005578 Bacteria 2292
118 Ga0068854_100882581 3300005578 Bacteria 785
119 Ga0068856_100008593 3300005614 Bacteria 9930
120 Ga0068856_100013882 3300005614 Bacteria 7790
121 Ga0068856_100065752 3300005614 Bacteria 3584
122 Ga0068856_100341168 3300005614 Bacteria 1516
123 Ga0068852_100004838 3300005616 Bacteria 9569
124 Ga0068852_100005736 3300005616 Bacteria 8906
125 Ga0068852_100013163 3300005616 Bacteria 6323
126 Ga0068852_100023890 3300005616 Bacteria 4930
127 Ga0068852_100110708 3300005616 Bacteria 2496
128 Ga0068852_100137175 3300005616 Bacteria 2259
129 Ga0068852_100149265 3300005616 Unclassified 2172
130 Ga0068859_100000006 3300005617 Bacteria 421509
131 Ga0068859_100001537 3300005617 Bacteria 23548
132 Ga0068859_100031496 3300005617 Bacteria 5326
133 Ga0068859_100036292 3300005617 Bacteria 4948
134 Ga0068864_100023261 3300005618 Bacteria 5202
135 Ga0068864_100029084 3300005618 Bacteria 4676
136 Ga0068864_100101185 3300005618 Bacteria 2556
137 Ga0068864_100273309 3300005618 Bacteria 1575
138 Ga0068864_100321400 3300005618 Bacteria 1454
139 Ga0068864_100363186 3300005618 Bacteria 1369
140 Ga0068851_10013185 3300005834 Bacteria 3910
141 Ga0068851_10022420 3300005834 Bacteria 3076
142 Ga0068851_10193295 3300005834 Bacteria 1132
143 Ga0068851_10204155 3300005834 Bacteria 1104
144 Ga0068863_100037396 3300005841 Bacteria 4622
145 Ga0068863_100083792 3300005841 Bacteria 3022
146 Ga0068863_100127428 3300005841 Bacteria 2429
147 Ga0068863_100224853 3300005841 Bacteria 1809
148 Ga0068863_100794219 3300005841 Bacteria 944
149 Ga0068858_100031261 3300005842 Bacteria 4943
150 Ga0068860_100001096 3300005843 Bacteria 29818
151 Ga0068860_100001650 3300005843 Bacteria 23869
152 Ga0068860_100127997 3300005843 Bacteria 2435
153 Ga0068862_100016480 3300005844 Bacteria 6151
154 Ga0075366_10015481 3300006195 Bacteria 4372
155 Ga0097621_100002080 3300006237 Bacteria 13697
156 Ga0097621_100023211 3300006237 Bacteria 4826
157 Ga0097621_100224077 3300006237 Unclassified 1639
158 Ga0068871_100005800 3300006358 Bacteria 8678
159 Ga0068871_100145417 3300006358 Bacteria 2018
160 Ga0068865_100016555 3300006881 Bacteria 4720
161 Ga0068865_100680424 3300006881 Bacteria 877
162 Ga0097620_100000006 3300006931 Bacteria 421509
163 Ga0097620_100001537 3300006931 Bacteria 23548
164 Ga0097620_100031496 3300006931 Bacteria 5326
165 Ga0097620_100036292 3300006931 Bacteria 4948
166 Ga0097620_101087988 3300006931 Bacteria 879
167 Ga0105240_10000800 3300009093 Bacteria 56989
168 Ga0105240_10006347 3300009093 Bacteria 17410
169 Ga0105240_10034582 3300009093 Bacteria 6517
170 Ga0105240_10053991 3300009093 Bacteria 5039
171 Ga0105245_10120940 3300009098 Bacteria 2446
172 Ga0105247_10027735 3300009101 Bacteria 3424
173 Ga0105243_10000003 3300009148 Bacteria 712931
174 Ga0105241_10001839 3300009174 Bacteria 16088
175 Ga0105241_10007179 3300009174 Bacteria 8200
176 Ga0105241_10008379 3300009174 Bacteria 7613
177 Ga0105241_10019304 3300009174 Bacteria 5027
178 Ga0105242_10163926 3300009176 Bacteria 1948
179 Ga0105248_10045663 3300009177 Bacteria 4912
180 Ga0105237_10007301 3300009545 Bacteria 12120
181 Ga0105237_10013605 3300009545 Bacteria 8525
182 Ga0105237_10037287 3300009545 Bacteria 4915
183 Ga0105237_10086440 3300009545 Bacteria 3125
184 Ga0105238_10000592 3300009551 Bacteria 38095
185 Ga0105238_10029073 3300009551 Bacteria 5631
186 Ga0105249_10003608 3300009553 Bacteria 13384
187 Ga0105249_10010749 3300009553 Bacteria 8042
188 Ga0105249_10211544 3300009553 Bacteria 1903
189 Ga0105249_10490878 3300009553 Bacteria 1272
190 Ga0105239_10039800 3300010375 Bacteria 5150
191 Ga0105239_10045372 3300010375 Bacteria 4817
192 Ga0105239_10080298 3300010375 Bacteria 3589
193 Ga0105239_10086193 3300010375 Bacteria 3461
194 Ga0105239_10179023 3300010375 Bacteria 2372
195 Ga0157373_10000927 3300013100 Bacteria 22674
196 Ga0157373_10008645 3300013100 Bacteria 7555
197 Ga0157373_10010363 3300013100 Bacteria 6861
198 Ga0157373_10010705 3300013100 Bacteria 6747
199 Ga0157371_10000218 3300013102 Bacteria 83919
200 Ga0157371_10001629 3300013102 Bacteria 22978
201 Ga0157371_10005354 3300013102 Bacteria 10845
202 Ga0157371_10005551 3300013102 Bacteria 10609
203 Ga0157371_10005559 3300013102 Bacteria 10598
204 Ga0157371_10014434 3300013102 Bacteria 5960
205 Ga0157371_10021485 3300013102 Bacteria 4737
206 Ga0157371_10025438 3300013102 Bacteria 4314
207 Ga0157371_10477489 3300013102 Unclassified 919
208 Ga0157371_10600811 3300013102 Bacteria 818
209 Ga0157370_10001029 3300013104 Bacteria 35080
210 Ga0157370_10008275 3300013104 Bacteria 11231
211 Ga0157370_10018211 3300013104 Bacteria 7067
212 Ga0157370_10093810 3300013104 Unclassified 2817
213 Ga0157370_10118506 3300013104 Bacteria 2472
214 Ga0157370_10140073 3300013104 Bacteria 2254
215 Ga0157370_10241688 3300013104 Bacteria 1670
216 Ga0157369_10008996 3300013105 Bacteria 11440
217 Ga0157369_10052097 3300013105 Bacteria 4429
218 Ga0157369_10117048 3300013105 Bacteria 2829
219 Ga0157369_10288024 3300013105 Unclassified 1710
220 Ga0157369_10893333 3300013105 Unclassified 911
221 Ga0157374_10043806 3300013296 Bacteria 4135
222 Ga0157374_10092122 3300013296 Bacteria 2891
223 Ga0157374_10194339 3300013296 Bacteria 1985
224 Ga0157378_10006154 3300013297 Bacteria 10506
225 Ga0157378_10006592 3300013297 Bacteria 10141
226 Ga0157378_10019626 3300013297 Bacteria 5941
227 Ga0157378_10038046 3300013297 Bacteria 4263
228 Ga0157378_10091740 3300013297 Unclassified 2762
229 Ga0157378_10711139 3300013297 Bacteria 1025
230 Ga0163162_10002714 3300013306 Bacteria 16800
231 Ga0163162_10002780 3300013306 Bacteria 16628
232 Ga0163162_10008817 3300013306 Bacteria 9807
233 Ga0163162_10190554 3300013306 Bacteria 2178
234 Ga0163162_10213644 3300013306 Bacteria 2059
235 Ga0163162_10395764 3300013306 Bacteria 1514
236 Ga0163162_10459939 3300013306 Bacteria 1404
237 Ga0163162_10543390 3300013306 Bacteria 1290
238 Ga0157372_10003581 3300013307 Bacteria 16712
239 Ga0157372_10013617 3300013307 Bacteria 8694
240 Ga0157372_10038889 3300013307 Bacteria 5250
241 Ga0157372_10050819 3300013307 Bacteria 4611
242 Ga0157372_10051028 3300013307 Bacteria 4603
243 Ga0157372_10069814 3300013307 Bacteria 3952
244 Ga0157372_10117263 3300013307 Unclassified 3053
245 Ga0157372_10123969 3300013307 Bacteria 2970
246 Ga0157372_10124972 3300013307 Bacteria 2958
247 Ga0157372_10133131 3300013307 Bacteria 2862
248 Ga0157372_10270314 3300013307 Bacteria 1975
249 Ga0157372_10295952 3300013307 Bacteria 1882
250 Ga0157372_10528380 3300013307 Unclassified 1375
251 Ga0157372_10581221 3300013307 Bacteria 1306
252 Ga0157375_10000534 3300013308 Bacteria 34107
253 Ga0157375_10059325 3300013308 Bacteria 3790
254 Ga0157375_10148157 3300013308 Bacteria 2480
255 Ga0157375_10412093 3300013308 Bacteria 1518
256 Ga0157375_11199110 3300013308 Bacteria 890
257 Ga0163163_10000682 3300014325 Bacteria 28889
258 Ga0163163_10719211 3300014325 Bacteria 1062
259 Ga0157380_10586256 3300014326 Bacteria 1100
260 Ga0157379_10018347 3300014968 Bacteria 6168
261 Ga0157379_10020819 3300014968 Bacteria 5805
262 Ga0157379_10098047 3300014968 Bacteria 2631
263 Ga0157376_10000426 3300014969 Bacteria 27278
264 Ga0157376_10047734 3300014969 Bacteria 3537
265 Ga0157376_10064757 3300014969 Bacteria 3084
266 Ga0157376_10086989 3300014969 Bacteria 2695
267 Ga0157376_10147724 3300014969 Bacteria 2116
268 Ga0157376_10189974 3300014969 Bacteria 1883
269 Ga0157376_10660252 3300014969 Bacteria 1047
270 Ga0182005_1000347 3300015265 Bacteria 26332
271 Ga0163161_10300704 3300017792 Bacteria 1263
272 Ga0209436_101020 3300025208 Bacteria 10729
273 Ga0209436_103416 3300025208 Bacteria 4233
274 Ga0209258_100116 3300025242 Bacteria 190317
275 Ga0209646_1000004 3300025246 Bacteria 786587
276 Ga0209026_1000136 3300025250 Bacteria 116507
277 Ga0209148_1000175 3300025254 Bacteria 129536
278 Ga0209673_1000519 3300025273 Bacteria 63063
279 Ga0209673_1025779 3300025273 Bacteria 1947
280 Ga0209673_1072792 3300025273 Bacteria 812
281 Ga0209130_1010836 3300025284 Bacteria 2482
282 Ga0209564_1010972 3300025295 Bacteria 4112
283 Ga0209564_1011998 3300025295 Bacteria 3821
284 Ga0209564_1031420 3300025295 Bacteria 1622
285 Ga0209758_1019870 3300025297 Bacteria 3211
286 Ga0209758_1023231 3300025297 Bacteria 2811
287 Ga0209050_1000276 3300025298 Bacteria 109997
288 Ga0207426_1000024 3300025302 Bacteria 534075
289 Ga0207426_1000104 3300025302 Bacteria 249464
290 Ga0207426_1001807 3300025302 Bacteria 15872
291 Ga0207426_1002756 3300025302 Bacteria 10629
292 Ga0209051_1013249 3300025303 Bacteria 3935
293 Ga0209257_1000004 3300025304 Bacteria 1678347
294 Ga0209257_1000736 3300025304 Bacteria 49668
295 Ga0207656_10011073 3300025321 Bacteria 3398
296 Ga0207656_10131731 3300025321 Bacteria 1172
297 Ga0207682_10007850 3300025893 Bacteria 4240
298 Ga0207710_10045923 3300025900 Bacteria 1949
299 Ga0207680_10000137 3300025903 Bacteria 34668
300 Ga0207680_10005652 3300025903 Bacteria 5983
301 Ga0207680_10287583 3300025903 Bacteria 1143
302 Ga0207647_10015704 3300025904 Bacteria 5185
303 Ga0207647_10039340 3300025904 Bacteria 2984
304 Ga0207645_10318335 3300025907 Bacteria 1037
305 Ga0207705_10008476 3300025909 Bacteria 7503
306 Ga0207705_10092546 3300025909 Bacteria 2215
307 Ga0207705_10157074 3300025909 Unclassified 1707
308 Ga0207705_10357902 3300025909 Unclassified 1125
309 Ga0207654_10001668 3300025911 Bacteria 11602
310 Ga0207654_10006854 3300025911 Bacteria 5734
311 Ga0207654_10275882 3300025911 Bacteria 1136
312 Ga0207707_10000747 3300025912 Bacteria 32068
313 Ga0207707_10124478 3300025912 Unclassified 2254
314 Ga0207707_10186738 3300025912 Unclassified 1809
315 Ga0207695_10001230 3300025913 Bacteria 43841
316 Ga0207695_10028221 3300025913 Bacteria 6229
317 Ga0207695_10199309 3300025913 Bacteria 1917
318 Ga0207671_10000453 3300025914 Bacteria 56447
319 Ga0207671_10000931 3300025914 Bacteria 36651
320 Ga0207671_10035560 3300025914 Bacteria 3695
321 Ga0207660_10012825 3300025917 Bacteria 5487
322 Ga0207660_10051350 3300025917 Bacteria 2931
323 Ga0207660_10064870 3300025917 Unclassified 2637
324 Ga0207660_10690481 3300025917 Bacteria 833
325 Ga0207657_10001373 3300025919 Bacteria 25953
326 Ga0207657_10002923 3300025919 Bacteria 18338
327 Ga0207657_10033182 3300025919 Bacteria 4656
328 Ga0207657_10043799 3300025919 Unclassified 3939
329 Ga0207657_10259292 3300025919 Bacteria 1384
330 Ga0207649_10572529 3300025920 Unclassified 866
331 Ga0207652_10000013 3300025921 Bacteria 222247
332 Ga0207652_10002726 3300025921 Bacteria 14817
333 Ga0207652_10019984 3300025921 Bacteria 5514
334 Ga0207652_10024091 3300025921 Bacteria 5048
335 Ga0207652_10029218 3300025921 Bacteria 4606
336 Ga0207652_10074746 3300025921 Bacteria 2951
337 Ga0207652_10131141 3300025921 Unclassified 2236
338 Ga0207681_10279777 3300025923 Bacteria 1313
339 Ga0207694_10033590 3300025924 Bacteria 3930
340 Ga0207694_10106618 3300025924 Bacteria 2226
341 Ga0207650_10041112 3300025925 Bacteria 3386
342 Ga0207650_10087017 3300025925 Unclassified 2380
343 Ga0207650_10814814 3300025925 Bacteria 791
344 Ga0207659_10132026 3300025926 Bacteria 1929
345 Ga0207659_10160569 3300025926 Bacteria 1764
346 Ga0207659_10189352 3300025926 Bacteria 1636
347 Ga0207659_10781572 3300025926 Bacteria 820
348 Ga0207664_10434133 3300025929 Unclassified 1171
349 Ga0207644_10028736 3300025931 Bacteria 3853
350 Ga0207690_10027042 3300025932 Bacteria 3621
351 Ga0207690_10034696 3300025932 Unclassified 3252
352 Ga0207690_10075337 3300025932 Unclassified 2340
353 Ga0207690_10189075 3300025932 Bacteria 1556
354 Ga0207706_10005466 3300025933 Bacteria 11846
355 Ga0207669_10605275 3300025937 Bacteria 891
356 Ga0207691_10022756 3300025940 Bacteria 5908
357 Ga0207691_10130113 3300025940 Bacteria 2224
358 Ga0207691_10219345 3300025940 Bacteria 1650
359 Ga0207691_10350751 3300025940 Bacteria 1262
360 Ga0207691_10407886 3300025940 Bacteria 1159
361 Ga0207711_10103947 3300025941 Bacteria 2516
362 Ga0207689_10004743 3300025942 Bacteria 12259
363 Ga0207689_10076399 3300025942 Bacteria 2754
364 Ga0207689_10238157 3300025942 Bacteria 1504
365 Ga0207689_10537368 3300025942 Unclassified 981
366 Ga0207661_10246851 3300025944 Unclassified 1585
367 Ga0207661_10747428 3300025944 Unclassified 900
368 Ga0207679_10043667 3300025945 Bacteria 3229
369 Ga0207667_10000098 3300025949 Bacteria 140051
370 Ga0207667_10023418 3300025949 Bacteria 6800
371 Ga0207667_10097007 3300025949 Bacteria 3043
372 Ga0207667_10158638 3300025949 Bacteria 2327
373 Ga0207667_10334402 3300025949 Bacteria 1546
374 Ga0207667_10337131 3300025949 Bacteria 1539
375 Ga0207667_11000812 3300025949 Bacteria 823
376 Ga0207651_10051093 3300025960 Bacteria 2811
377 Ga0207651_10435957 3300025960 Bacteria 1121
378 Ga0207712_10007102 3300025961 Bacteria 7063
379 Ga0207712_10011002 3300025961 Bacteria 5760
380 Ga0207668_10706602 3300025972 Bacteria 886
381 Ga0207640_10069022 3300025981 Bacteria 2371
382 Ga0207658_10010201 3300025986 Bacteria 6383
383 Ga0207658_10023454 3300025986 Bacteria 4307
384 Ga0207658_10098228 3300025986 Bacteria 2288
385 Ga0207658_10211175 3300025986 Bacteria 1627
386 Ga0207677_10071190 3300026023 Bacteria 2453
387 Ga0207677_10109976 3300026023 Bacteria 2050
388 Ga0207677_10383701 3300026023 Bacteria 1187
389 Ga0207677_10753100 3300026023 Bacteria 868
390 Ga0207703_10005646 3300026035 Bacteria 10045
391 Ga0207639_10026703 3300026041 Bacteria 4197
392 Ga0207639_10083244 3300026041 Bacteria 2539
393 Ga0207639_10086754 3300026041 Bacteria 2493
394 Ga0207639_10093861 3300026041 Bacteria 2407
395 Ga0207639_10161062 3300026041 Bacteria 1891
396 Ga0207639_10184154 3300026041 Unclassified 1779
397 Ga0207639_10209336 3300026041 Unclassified 1677
398 Ga0207639_10367693 3300026041 Bacteria 1289
399 Ga0207639_10410040 3300026041 Bacteria 1223
400 Ga0207639_10964748 3300026041 Unclassified 798
401 Ga0207678_10006330 3300026067 Bacteria 10512
402 Ga0207702_10048604 3300026078 Bacteria 3578
403 Ga0207702_10053865 3300026078 Bacteria 3407
404 Ga0207702_10355884 3300026078 Bacteria 1402
405 Ga0207641_10000058 3300026088 Bacteria 166385
406 Ga0207641_10014569 3300026088 Bacteria 6446
407 Ga0207641_10042064 3300026088 Bacteria 3832
408 Ga0207641_10047978 3300026088 Bacteria 3604
409 Ga0207641_10720892 3300026088 Bacteria 983
410 Ga0207648_10040263 3300026089 Unclassified 4107
411 Ga0207648_10117470 3300026089 Bacteria 2337
412 Ga0207648_10120546 3300026089 Bacteria 2306
413 Ga0207648_10155994 3300026089 Bacteria 2015
414 Ga0207648_10278448 3300026089 Bacteria 1496
415 Ga0207648_10616631 3300026089 Bacteria 1001
416 Ga0207676_10004562 3300026095 Bacteria 9810
417 Ga0207676_10051429 3300026095 Bacteria 3217
418 Ga0207676_10175098 3300026095 Bacteria 1873
419 Ga0207676_10289212 3300026095 Unclassified 1491
420 Ga0207676_11205988 3300026095 Unclassified 750
421 Ga0207674_10000969 3300026116 Bacteria 37567
422 Ga0207674_10023895 3300026116 Bacteria 6538
423 Ga0207674_10062691 3300026116 Bacteria 3754
424 Ga0207674_10081440 3300026116 Bacteria 3239
425 Ga0207674_10089693 3300026116 Unclassified 3067
426 Ga0207674_10145317 3300026116 Bacteria 2330
427 Ga0207683_10012906 3300026121 Bacteria 7133
428 Ga0207683_10515237 3300026121 Bacteria 1105
429 Ga0207683_10822585 3300026121 Bacteria 862
430 Ga0207698_10000937 3300026142 Bacteria 16993
431 Ga0207698_10003938 3300026142 Bacteria 8990
432 Ga0207698_10023764 3300026142 Bacteria 4288
433 Ga0207698_10086891 3300026142 Bacteria 2545
434 Ga0207698_10289256 3300026142 Unclassified 1520
435 Ga0268266_10000068 3300028379 Bacteria 241100
436 Ga0268266_10656138 3300028379 Unclassified 1010
437 Ga0268265_10022069 3300028380 Bacteria 4469
438 Ga0268265_10609260 3300028380 Bacteria 1045
439 Ga0268264_10003074 3300028381 Bacteria 14443
440 Ga0268264_10207704 3300028381 Unclassified 1796
441 Ga0268264_11252752 3300028381 Bacteria 752
442 Ga0307515_10000001 3300028794 Bacteria 4259510
443 Ga0307515_10000059 3300028794 Bacteria 257520
444 Ga0307515_10269292 3300028794 Bacteria 1427
445 Ga0265338_10141715 3300028800 Bacteria 1882
446 Ga0307511_10000201 3300030521 Bacteria 60079
447 Ga0265327_10000013 3300031251 Bacteria 519549
448 Ga0265327_10000288 3300031251 Bacteria 99230
449 Ga0265327_10035674 3300031251 Bacteria 2746
450 Ga0265327_10129267 3300031251 Bacteria 1190
451 Ga0265316_10039776 3300031344 Bacteria 3775
452 Ga0307513_10036214 3300031456 Bacteria 5510
453 Ga0307513_10052525 3300031456 Bacteria 4388
454 Ga0307509_10029227 3300031507 Bacteria 6120
455 Ga0307509_10161100 3300031507 Bacteria 2141
456 Ga0307509_10213553 3300031507 Bacteria 1751
457 Ga0307516_10218420 3300031730 Bacteria 1617
458 Ga0307410_10372350 3300031852 Unclassified 1147
459 Ga0373955_0252363 3300035172 Bacteria 1058
460 Ga0373933_0257462 3300035724 Bacteria 1125
461 Ga0373937_0310604 3300036401 Bacteria 1491
462 Ga0373937_0566346 3300036401 Bacteria 1079
463 Ga0373937_0807063 3300036401 Bacteria 886
464 Ga0316582_0139304 3300036647 Bacteria 1635
465 Ga0316584_0052487 3300036712 Unclassified 3049
466 Ga0395899_0009123 3300037312 Bacteria 7619
467 Ga0395899_0026146 3300037312 Bacteria 4405
468 Ga0395900_0002692 3300037418 Bacteria 19416
469 Ga0395900_0008628 3300037418 Bacteria 10473
470 Ga0395900_0082094 3300037418 Bacteria 3311
471 Ga0395900_0235086 3300037418 Unclassified 1841
472 Ga0395898_0000595 3300037466 Bacteria 67162
473 Ga0395898_0017447 3300037466 Bacteria 7329
474 Ga0395898_0221294 3300037466 Unclassified 1805
475 Ga0395905_0004944 3300037471 Bacteria 13731
476 Ga0395905_0379246 3300037471 Bacteria 1308
477 Ga0395905_0569274 3300037471 Unclassified 1034
478 Ga0395901_0001672 3300038443 Bacteria 22890
479 Ga0395901_0007597 3300038443 Bacteria 10947
480 Ga0395901_0007671 3300038443 Bacteria 10885
481 Ga0395901_0114128 3300038443 Bacteria 2837
482 Ga0395901_0193612 3300038443 Bacteria 2132
483 Ga0451787_748704 3300041441 Bacteria 1841
484 Ga0451793_1095409 3300041452 Bacteria 941
485 Ga0451849_0688680 3300041505 Bacteria 959
486 Ga0451853_2525003 3300041512 Bacteria 1013
487 Ga0439431_0027745 3300041997 Bacteria 1392
488 Ga0439431_0070608 3300041997 Bacteria 930
489 Ga0439448_0088074 3300042005 Unclassified 1047
490 Ga0439449_0046423 3300042007 Bacteria 1609
491 Ga0439449_0061030 3300042007 Bacteria 1391
492 Ga0439457_028482 3300042014 Bacteria 1237
493 Ga0439460_0060072 3300042461 Unclassified 1159
494 Ga0451577_0053664 3300042876 Bacteria 3598
495 Ga0451577_0249263 3300042876 Bacteria 1607
496 Ga0451577_0799327 3300042876 Bacteria 852
497 Ga0466972_0000057 3300044658 Bacteria 110775
498 Ga0466972_0001286 3300044658 Bacteria 12123
499 Ga0466972_0077972 3300044658 Bacteria 1578
500 Ga0453683_0354821 3300044673 Bacteria 942
501 Ga0453684_0011435 3300044712 Bacteria 14889
502 Ga0453684_0017764 3300044712 Bacteria 10983
503 Ga0453684_0057694 3300044712 Bacteria 5022
504 Ga0453684_0331994 3300044712 Bacteria 1719
505 Ga0466970_0131394 3300044765 Bacteria 1375
506 Ga0495627_006057 3300046453 Bacteria 4781
507 Ga0495638_0118696 3300046460 Bacteria 1565
508 Ga0495639_0217866 3300046475 Unclassified 938
509 Ga0495586_0114007 3300046535 Bacteria 1506
510 Ga0495587_0089912 3300046536 Bacteria 1774
511 Ga0495621_0033310 3300046539 Bacteria 1776
512 Ga0495633_0000116 3300046558 Bacteria 108667
513 Ga0495668_0000099 3300046616 Bacteria 137915
514 Ga0495668_0002655 3300046616 Bacteria 14375
515 Ga0495635_0131993 3300046663 Bacteria 1703
516 Ga0495658_0318132 3300046683 Bacteria 986
517 Ga0495670_0094099 3300046691 Unclassified 1536
518 Ga0495674_0131800 3300047319 Bacteria 2106
519 Ga0495674_0308199 3300047319 Bacteria 1292
520 Ga0495684_0481590 3300047471 Bacteria 857
521 Ga0496104_0158260 3300048907 Bacteria 2173
522 Ga0496114_0023774 3300048917 Bacteria 5001
523 Ga0496121_0000081 3300048924 Bacteria 229506
524 Ga0496126_0077415 3300048929 Bacteria 2948
525 Ga0501033_0008636 3300049570 Bacteria 7884
526 Ga0501033_0034295 3300049570 Bacteria 3808
527 Ga0501033_0136954 3300049570 Bacteria 1772
528 Ga0501033_0308481 3300049570 Bacteria 1113
529 Ga0501033_0365160 3300049570 Bacteria 1010
530 Ga0501034_0014518 3300049571 Bacteria 8110
531 Ga0501034_0023070 3300049571 Bacteria 6341
532 Ga0501034_0069892 3300049571 Unclassified 3522
533 Ga0501034_0099099 3300049571 Bacteria 2909
534 Ga0501043_0074054 3300049579 Bacteria 2675
535 Ga0501047_0116620 3300049581 Bacteria 2552
536 Ga0501070_0098427 3300049586 Bacteria 2419
537 Ga0501238_006580 3300049671 Bacteria 1499
538 Ga0501219_000178 3300049703 Bacteria 11731
539 Ga0501080_0334765 3300049742 Bacteria 1368
540 Ga0501241_012764 3300049758 Bacteria 1527
541 Ga0501035_0023737 3300049822 Bacteria 5627
542 Ga0501035_0114943 3300049822 Bacteria 2356
543 Ga0501044_0029803 3300049823 Bacteria 5753
544 Ga0501044_0047818 3300049823 Bacteria 4424
545 Ga0501044_0058772 3300049823 Bacteria 3942
546 Ga0501044_0139891 3300049823 Bacteria 2410
547 Ga0501044_0243747 3300049823 Bacteria 1740
548 Ga0501284_00036 3300050005 Bacteria 57905
549 Ga0501284_00614 3300050005 Bacteria 1837
550 nmdc:mga0k408_44352_c1 3300050493 Bacteria 2564
551 nmdc:mga05p37_43236_c1 3300050507 Bacteria 5541
552 nmdc:mga08y16_714280_c1 3300050511 Bacteria 1001
553 Ga0495619_0186445 3300053085 Unclassified 1436
554 Ga0500644_0000260 3300053088 Bacteria 30005
555 Ga0500646_0001397 3300053090 Bacteria 6401
556 Ga0500646_0004077 3300053090 Bacteria 3707
557 Ga0500583_0010948 3300053092 Bacteria 3393
558 Ga0500651_0032311 3300053093 Bacteria 3298
559 Ga0500651_0229784 3300053093 Bacteria 1085
560 Ga0500651_0287662 3300053093 Unclassified 946
561 Ga0500660_070104 3300053100 Bacteria 1648
562 Ga0500562_000013 3300053108 Bacteria 150003
563 Ga0500594_0017945 3300053118 Bacteria 1737
564 Ga0500652_029591 3300053131 Bacteria 2137
565 Ga0500655_031558 3300053133 Bacteria 1022
566 Ga0500658_0004288 3300053134 Bacteria 5346
567 Ga0500577_0001916 3300053142 Bacteria 5329
568 Ga0500590_041398 3300053148 Bacteria 2369
569 Ga0500604_0024558 3300053151 Bacteria 1726
570 Ga0500616_0013304 3300053153 Bacteria 4784
571 Ga0500616_0032834 3300053153 Bacteria 2836
572 Ga0500622_0000212 3300053156 Bacteria 61612
573 Ga0500622_0000242 3300053156 Bacteria 56575
574 Ga0500633_0001577 3300053160 Bacteria 4371
575 Ga0500634_0022500 3300053161 Bacteria 3422
576 Ga0500636_0002821 3300053177 Bacteria 9699
577 Ga0500645_045660 3300053730 Bacteria 1287
578 Ga0500645_116112 3300053730 Bacteria 749
579 Ga0500661_004853 3300055283 Bacteria 2515

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10006533 Ga0070658_100065331 187
2 3300005329 Ga0070683_101047810 Ga0070683_1010478101 188
3 3300005336 Ga0070680_100024400 Ga0070680_1000244003 188
4 3300005337 Ga0070682_100018150 Ga0070682_1000181502 188
5 3300005339 Ga0070660_100010460 Ga0070660_1000104606 188
6 3300005458 Ga0070681_10128947 Ga0070681_101289473 188
7 3300005530 Ga0070679_100006985 Ga0070679_1000069857 188
8 3300005535 Ga0070684_100174326 Ga0070684_1001743263 188
9 3300005539 Ga0068853_100110454 Ga0068853_1001104543 188
10 3300005563 Ga0068855_100239595 Ga0068855_1002395952 188
11 3300005616 Ga0068852_100005736 Ga0068852_1000057363 188
12 3300013307 Ga0157372_10038889 Ga0157372_100388895 188
13 3300025909 Ga0207705_10357902 Ga0207705_103579021 188
14 3300025912 Ga0207707_10124478 Ga0207707_101244783 188
15 3300025917 Ga0207660_10012825 Ga0207660_100128253 188
16 3300025919 Ga0207657_10043799 Ga0207657_100437994 188
17 3300025921 Ga0207652_10019984 Ga0207652_100199846 188
18 3300025944 Ga0207661_10747428 Ga0207661_107474282 188
19 3300026041 Ga0207639_10086754 Ga0207639_100867542 188
20 3300026142 Ga0207698_10000937 Ga0207698_1000093711 188
21 3300044712 Ga0453684_0331994 Ga0453684_0331994_1033_1686 193
22 3300053156 Ga0500622_0000242 Ga0500622_0000242_47247_47972 194
23 3300049571 Ga0501034_0069892 Ga0501034_0069892_933_1604 200
24 3300001989 JGI24739J22299_10108048 JGI24739J22299_101080482 202
25 3300005329 Ga0070683_100038010 Ga0070683_1000380103 202
26 3300005334 Ga0068869_100474676 Ga0068869_1004746761 202
27 3300005335 Ga0070666_10056940 Ga0070666_100569402 202
28 3300005338 Ga0068868_100023873 Ga0068868_1000238733 202
29 3300005339 Ga0070660_100025572 Ga0070660_1000255726 202
30 3300005344 Ga0070661_100010699 Ga0070661_1000106992 202
31 3300005354 Ga0070675_100542255 Ga0070675_1005422552 202
32 3300005355 Ga0070671_100024703 Ga0070671_1000247036 202
33 3300005364 Ga0070673_100012881 Ga0070673_1000128813 202
34 3300005366 Ga0070659_100082560 Ga0070659_1000825603 202
35 3300005457 Ga0070662_100017715 Ga0070662_1000177153 202
36 3300005530 Ga0070679_100022824 Ga0070679_1000228246 202
37 3300005535 Ga0070684_100044026 Ga0070684_1000440262 202
38 3300005539 Ga0068853_100013295 Ga0068853_1000132956 202
39 3300005563 Ga0068855_100098048 Ga0068855_1000980486 202
40 3300005564 Ga0070664_100018535 Ga0070664_1000185355 202
41 3300005577 Ga0068857_100213809 Ga0068857_1002138092 202
42 3300005578 Ga0068854_100035141 Ga0068854_1000351413 202
43 3300005614 Ga0068856_100013882 Ga0068856_1000138826 202
44 3300005616 Ga0068852_100137175 Ga0068852_1001371752 202
45 3300005618 Ga0068864_100273309 Ga0068864_1002733093 202
46 3300006237 Ga0097621_100023211 Ga0097621_1000232113 202
47 3300013100 Ga0157373_10008645 Ga0157373_100086456 202
48 3300013102 Ga0157371_10014434 Ga0157371_100144345 202
49 3300013104 Ga0157370_10140073 Ga0157370_101400732 202
50 3300013105 Ga0157369_10008996 Ga0157369_100089963 202
51 3300013296 Ga0157374_10092122 Ga0157374_100921222 202
52 3300013297 Ga0157378_10038046 Ga0157378_100380463 202
53 3300013307 Ga0157372_10050819 Ga0157372_100508196 202
54 3300014969 Ga0157376_10064757 Ga0157376_100647572 202
55 3300025903 Ga0207680_10005652 Ga0207680_100056524 202
56 3300025919 Ga0207657_10001373 Ga0207657_100013736 202
57 3300025920 Ga0207649_10572529 Ga0207649_105725291 202
58 3300025921 Ga0207652_10029218 Ga0207652_100292186 202
59 3300025926 Ga0207659_10189352 Ga0207659_101893522 202
60 3300025931 Ga0207644_10028736 Ga0207644_100287364 202
61 3300025932 Ga0207690_10027042 Ga0207690_100270425 202
62 3300025933 Ga0207706_10005466 Ga0207706_1000546614 202
63 3300025942 Ga0207689_10537368 Ga0207689_105373682 202
64 3300025944 Ga0207661_10246851 Ga0207661_102468511 202
65 3300025945 Ga0207679_10043667 Ga0207679_100436672 202
66 3300025949 Ga0207667_10158638 Ga0207667_101586383 202
67 3300025981 Ga0207640_10069022 Ga0207640_100690223 202
68 3300026023 Ga0207677_10109976 Ga0207677_101099763 202
69 3300026041 Ga0207639_10209336 Ga0207639_102093361 202
70 3300026078 Ga0207702_10355884 Ga0207702_103558843 202
71 3300026095 Ga0207676_11205988 Ga0207676_112059881 202
72 3300026116 Ga0207674_10145317 Ga0207674_101453173 202
73 3300005617 Ga0068859_100001537 Ga0068859_10000153721 203
74 3300006931 Ga0097620_100001537 Ga0097620_10000153721 203
75 3300013105 Ga0157369_10288024 Ga0157369_102880242 203
76 3300005459 Ga0068867_100520203 Ga0068867_1005202031 204
77 3300005841 Ga0068863_100224853 Ga0068863_1002248532 204
78 3300025302 Ga0207426_1000104 Ga0207426_1000104166 204
79 3300025907 Ga0207645_10318335 Ga0207645_103183352 204
80 3300026088 Ga0207641_10047978 Ga0207641_100479783 204
81 3300026089 Ga0207648_10155994 Ga0207648_101559944 204
82 3300028379 Ga0268266_10656138 Ga0268266_106561381 204
83 3300042876 Ga0451577_0053664 Ga0451577_0053664_2894_3550 204
84 3300005347 Ga0070668_100268781 Ga0070668_1002687811 206
85 3300009176 Ga0105242_10163926 Ga0105242_101639263 206
86 3300013307 Ga0157372_10051028 Ga0157372_100510286 206
87 3300025972 Ga0207668_10706602 Ga0207668_107066021 206
88 3300005366 Ga0070659_100008369 Ga0070659_1000083693 207
89 3300009093 Ga0105240_10053991 Ga0105240_100539916 207
90 3300025960 Ga0207651_10051093 Ga0207651_100510933 207
91 3300026023 Ga0207677_10071190 Ga0207677_100711902 207
92 3300005365 Ga0070688_100033880 Ga0070688_1000338803 208
93 3300038443 Ga0395901_0193612 Ga0395901_0193612_413_1087 208
94 3300042461 Ga0439460_0060072 Ga0439460_0060072_132_782 208
95 3300042876 Ga0451577_0799327 Ga0451577_0799327_83_730 208
96 3300013102 Ga0157371_10001629 Ga0157371_100016292 209
97 3300013102 Ga0157371_10477489 Ga0157371_104774891 209
98 3300013307 Ga0157372_10069814 Ga0157372_100698141 209
99 3300025986 Ga0207658_10098228 Ga0207658_100982284 209
100 3300041441 Ga0451787_748704 Ga0451787_748704_830_1486 209
101 3300005333 Ga0070677_10224743 Ga0070677_102247431 210
102 3300005347 Ga0070668_100255139 Ga0070668_1002551393 210
103 3300013306 Ga0163162_10213644 Ga0163162_102136442 210
104 3300014969 Ga0157376_10660252 Ga0157376_106602522 210
105 3300025926 Ga0207659_10160569 Ga0207659_101605693 210
106 3300025940 Ga0207691_10219345 Ga0207691_102193452 210
107 iso_pu_bacteria 2890737413 2890738941 210
108 iso_pu_bacteria 2896344016 2896345381 210
109 3300003323 rootH1_10093904 rootH1_100939045 211
110 3300005336 Ga0070680_100066154 Ga0070680_1000661544 211
111 3300005339 Ga0070660_100066256 Ga0070660_1000662562 211
112 3300005366 Ga0070659_100092926 Ga0070659_1000929263 211
113 3300005455 Ga0070663_100125519 Ga0070663_1001255194 211
114 3300005458 Ga0070681_10156507 Ga0070681_101565072 211
115 3300005539 Ga0068853_100884841 Ga0068853_1008848411 211
116 3300005563 Ga0068855_100001027 Ga0068855_10000102720 211
117 3300005563 Ga0068855_100029906 Ga0068855_1000299066 211
118 3300005563 Ga0068855_100081073 Ga0068855_1000810733 211
119 3300005578 Ga0068854_100089154 Ga0068854_1000891542 211
120 3300005614 Ga0068856_100341168 Ga0068856_1003411682 211
121 3300013102 Ga0157371_10005551 Ga0157371_100055512 211
122 3300013104 Ga0157370_10001029 Ga0157370_1000102917 211
123 3300013104 Ga0157370_10008275 Ga0157370_100082755 211
124 3300013104 Ga0157370_10241688 Ga0157370_102416882 211
125 3300013307 Ga0157372_10295952 Ga0157372_102959523 211
126 3300025904 Ga0207647_10015704 Ga0207647_100157045 211
127 3300025909 Ga0207705_10008476 Ga0207705_100084767 211
128 3300025917 Ga0207660_10051350 Ga0207660_100513502 211
129 3300025917 Ga0207660_10690481 Ga0207660_106904811 211
130 3300025919 Ga0207657_10259292 Ga0207657_102592922 211
131 3300025929 Ga0207664_10434133 Ga0207664_104341332 211
132 3300025949 Ga0207667_10097007 Ga0207667_100970073 211
133 3300025949 Ga0207667_10337131 Ga0207667_103371311 211
134 3300026041 Ga0207639_10964748 Ga0207639_109647481 211
135 3300026067 Ga0207678_10006330 Ga0207678_1000633010 211
136 3300037312 Ga0395899_0009123 Ga0395899_0009123_5215_5937 211
137 3300037418 Ga0395900_0082094 Ga0395900_0082094_1989_2711 211
138 3300037418 Ga0395900_0235086 Ga0395900_0235086_146_853 211
139 3300037466 Ga0395898_0221294 Ga0395898_0221294_589_1311 211
140 3300037471 Ga0395905_0379246 Ga0395905_0379246_532_1236 211
141 3300037471 Ga0395905_0569274 Ga0395905_0569274_292_1014 211
142 3300038443 Ga0395901_0007671 Ga0395901_0007671_4534_5256 211
143 3300001989 JGI24739J22299_10000030 JGI24739J22299_1000003011 212
144 3300003215 JGI25153J46596_10011676 JGI25153J46596_100116762 212
145 3300003354 JGI25160J50197_1001552 JGI25160J50197_10015528 212
146 3300003771 Ga0055526_1022488 Ga0055526_10224884 212
147 3300003790 Ga0055528_1001162 Ga0055528_100116215 212
148 3300003791 Ga0055530_10000185 Ga0055530_1000018532 212
149 3300005262 Ga0065165_1000658 Ga0065165_100065835 212
150 3300005334 Ga0068869_100028528 Ga0068869_1000285282 212
151 3300005335 Ga0070666_10000072 Ga0070666_1000007231 212
152 3300005337 Ga0070682_100002600 Ga0070682_1000026009 212
153 3300005338 Ga0068868_100146592 Ga0068868_1001465922 212
154 3300005340 Ga0070689_100372195 Ga0070689_1003721952 212
155 3300005364 Ga0070673_100017881 Ga0070673_1000178811 212
156 3300005466 Ga0070685_10042112 Ga0070685_100421122 212
157 3300005548 Ga0070665_100265127 Ga0070665_1002651273 212
158 3300005616 Ga0068852_100023890 Ga0068852_1000238904 212
159 3300005617 Ga0068859_100000006 Ga0068859_10000000629 212
160 3300005618 Ga0068864_100023261 Ga0068864_1000232613 212
161 3300005834 Ga0068851_10193295 Ga0068851_101932952 212
162 3300005841 Ga0068863_100127428 Ga0068863_1001274283 212
163 3300005842 Ga0068858_100031261 Ga0068858_1000312614 212
164 3300006931 Ga0097620_100000006 Ga0097620_10000000629 212
165 3300009098 Ga0105245_10120940 Ga0105245_101209401 212
166 3300009101 Ga0105247_10027735 Ga0105247_100277353 212
167 3300009174 Ga0105241_10008379 Ga0105241_100083797 212
168 3300009545 Ga0105237_10037287 Ga0105237_100372874 212
169 3300009553 Ga0105249_10003608 Ga0105249_100036084 212
170 3300010375 Ga0105239_10039800 Ga0105239_100398004 212
171 3300013102 Ga0157371_10600811 Ga0157371_106008111 212
172 3300013306 Ga0163162_10002714 Ga0163162_100027147 212
173 3300013308 Ga0157375_10412093 Ga0157375_104120931 212
174 3300014968 Ga0157379_10098047 Ga0157379_100980474 212
175 3300014969 Ga0157376_10086989 Ga0157376_100869894 212
176 3300025273 Ga0209673_1000519 Ga0209673_10005198 212
177 3300025273 Ga0209673_1025779 Ga0209673_10257793 212
178 3300025273 Ga0209673_1072792 Ga0209673_10727921 212
179 3300025295 Ga0209564_1010972 Ga0209564_10109723 212
180 3300025295 Ga0209564_1011998 Ga0209564_10119984 212
181 3300025295 Ga0209564_1031420 Ga0209564_10314201 212
182 3300025297 Ga0209758_1019870 Ga0209758_10198702 212
183 3300025298 Ga0209050_1000276 Ga0209050_100027653 212
184 3300025302 Ga0207426_1002756 Ga0207426_10027566 212
185 3300025303 Ga0209051_1013249 Ga0209051_10132492 212
186 3300025304 Ga0209257_1000736 Ga0209257_100073618 212
187 3300025321 Ga0207656_10131731 Ga0207656_101317312 212
188 3300025900 Ga0207710_10045923 Ga0207710_100459232 212
189 3300025903 Ga0207680_10000137 Ga0207680_100001376 212
190 3300025911 Ga0207654_10001668 Ga0207654_1000166811 212
191 3300025911 Ga0207654_10006854 Ga0207654_100068541 212
192 3300025914 Ga0207671_10000453 Ga0207671_100004533 212
193 3300025942 Ga0207689_10004743 Ga0207689_1000474312 212
194 3300025961 Ga0207712_10011002 Ga0207712_100110024 212
195 3300026035 Ga0207703_10005646 Ga0207703_1000564610 212
196 3300026088 Ga0207641_10000058 Ga0207641_1000005843 212
197 3300026095 Ga0207676_10004562 Ga0207676_1000456210 212
198 3300026142 Ga0207698_10003938 Ga0207698_100039384 212
199 3300028381 Ga0268264_11252752 Ga0268264_112527521 212
200 3300005530 Ga0070679_100136411 Ga0070679_1001364113 213
201 3300005577 Ga0068857_100073176 Ga0068857_1000731762 213
202 3300013100 Ga0157373_10010363 Ga0157373_100103632 213
203 3300013307 Ga0157372_10270314 Ga0157372_102703141 213
204 3300013307 Ga0157372_10581221 Ga0157372_105812212 213
205 3300025909 Ga0207705_10092546 Ga0207705_100925463 213
206 3300025921 Ga0207652_10000013 Ga0207652_1000001325 213
207 3300025932 Ga0207690_10189075 Ga0207690_101890752 213
208 3300026116 Ga0207674_10081440 Ga0207674_100814402 213
209 3300037418 Ga0395900_0002692 Ga0395900_0002692_16629_17342 213
210 3300037466 Ga0395898_0000595 Ga0395898_0000595_43728_44441 213
211 3300038443 Ga0395901_0001672 Ga0395901_0001672_16132_16845 213
212 iso_pu_bacteria 2738541278 2738725624 213
213 iso_pu_bacteria 2818991442 2819575028 213
214 iso_pu_bacteria 2818991460 2819676989 213
215 iso_pu_bacteria 2821136567 2821141125 213
216 iso_pu_bacteria 2884791551 2884796828 213
217 iso_pu_bacteria 2904467357 2904471626 213
218 iso_pu_bacteria 2929154850 2929159626 213
219 iso_pu_bacteria 2929177148 2929177655 213
220 iso_pu_bacteria 2929239360 2929240021 213
221 iso_pu_bacteria 2945977869 2945980004 213
222 3300009148 Ga0105243_10000003 Ga0105243_1000000316 214
223 3300049823 Ga0501044_0139891 Ga0501044_0139891_1184_1846 214
224 iso_pu_bacteria 2840677318 2840678737 214
225 iso_pu_bacteria 2883068021 2883071687 214
226 iso_pu_bacteria 2886627955 2886629909 214
227 iso_pu_bacteria 2896085136 2896086555 214
228 iso_pu_bacteria 2896109856 2896113144 214
229 iso_pu_bacteria 2929921140 2929921729 214
230 iso_pu_bacteria 8003151029 8003154276 214
231 3300006931 Ga0097620_101087988 Ga0097620_1010879881 215
232 3300025926 Ga0207659_10781572 Ga0207659_107815721 215
233 3300003761 Ga0055535_1008804 Ga0055535_10088041 216
234 3300005327 Ga0070658_10376000 Ga0070658_103760002 216
235 3300025242 Ga0209258_100116 Ga0209258_10011699 216
236 3300025254 Ga0209148_1000175 Ga0209148_100017530 216
237 3300049571 Ga0501034_0099099 Ga0501034_0099099_1587_2237 216
238 3300053088 Ga0500644_0000260 Ga0500644_0000260_11868_12518 216
239 3300053148 Ga0500590_041398 Ga0500590_041398_414_1064 216
240 3300053160 Ga0500633_0001577 Ga0500633_0001577_1815_2465 216
241 3300053161 Ga0500634_0022500 Ga0500634_0022500_1272_1922 216
242 3300053177 Ga0500636_0002821 Ga0500636_0002821_8177_8827 216
243 3300002739 JGI25158J39367_1014901 JGI25158J39367_10149012 217
244 3300003320 rootH2_10001429 rootH2_100014294 217
245 3300003320 rootH2_10035434 rootH2_100354343 217
246 3300003320 rootH2_10064945 rootH2_100649454 217
247 3300003322 rootL2_10008865 rootL2_1000886512 217
248 3300003322 rootL2_10026021 rootL2_1002602116 217
249 3300003322 rootL2_10129454 rootL2_101294542 217
250 3300003323 rootH1_10052389 rootH1_100523892 217
251 3300003794 Ga0055531_10000080 Ga0055531_1000008085 217
252 3300005327 Ga0070658_10201064 Ga0070658_102010642 217
253 3300005331 Ga0070670_100125782 Ga0070670_1001257823 217
254 3300005334 Ga0068869_100109804 Ga0068869_1001098043 217
255 3300005337 Ga0070682_100128072 Ga0070682_1001280721 217
256 3300005338 Ga0068868_100410296 Ga0068868_1004102961 217
257 3300005353 Ga0070669_100012698 Ga0070669_1000126982 217
258 3300005355 Ga0070671_100291109 Ga0070671_1002911092 217
259 3300005364 Ga0070673_100055827 Ga0070673_1000558275 217
260 3300005366 Ga0070659_100252371 Ga0070659_1002523712 217
261 3300005366 Ga0070659_100787528 Ga0070659_1007875281 217
262 3300005367 Ga0070667_100007874 Ga0070667_1000078747 217
263 3300005367 Ga0070667_100012570 Ga0070667_1000125703 217
264 3300005457 Ga0070662_100527477 Ga0070662_1005274771 217
265 3300005459 Ga0068867_100198407 Ga0068867_1001984072 217
266 3300005459 Ga0068867_100283194 Ga0068867_1002831941 217
267 3300005530 Ga0070679_100040283 Ga0070679_1000402832 217
268 3300005539 Ga0068853_100009686 Ga0068853_1000096862 217
269 3300005539 Ga0068853_100016635 Ga0068853_1000166354 217
270 3300005543 Ga0070672_100137911 Ga0070672_1001379113 217
271 3300005563 Ga0068855_100090491 Ga0068855_1000904913 217
272 3300005577 Ga0068857_100049368 Ga0068857_1000493684 217
273 3300005614 Ga0068856_100065752 Ga0068856_1000657523 217
274 3300005616 Ga0068852_100013163 Ga0068852_1000131632 217
275 3300005616 Ga0068852_100149265 Ga0068852_1001492652 217
276 3300005617 Ga0068859_100031496 Ga0068859_1000314967 217
277 3300005618 Ga0068864_100101185 Ga0068864_1001011852 217
278 3300005618 Ga0068864_100321400 Ga0068864_1003214002 217
279 3300005834 Ga0068851_10013185 Ga0068851_100131853 217
280 3300005834 Ga0068851_10022420 Ga0068851_100224202 217
281 3300005841 Ga0068863_100037396 Ga0068863_1000373961 217
282 3300005841 Ga0068863_100083792 Ga0068863_1000837921 217
283 3300005843 Ga0068860_100001096 Ga0068860_10000109618 217
284 3300006237 Ga0097621_100002080 Ga0097621_1000020803 217
285 3300006237 Ga0097621_100224077 Ga0097621_1002240773 217
286 3300006358 Ga0068871_100005800 Ga0068871_1000058004 217
287 3300006358 Ga0068871_100145417 Ga0068871_1001454171 217
288 3300006881 Ga0068865_100016555 Ga0068865_1000165553 217
289 3300006881 Ga0068865_100680424 Ga0068865_1006804241 217
290 3300006931 Ga0097620_100031496 Ga0097620_1000314967 217
291 3300009093 Ga0105240_10000800 Ga0105240_1000080038 217
292 3300009093 Ga0105240_10006347 Ga0105240_100063477 217
293 3300009093 Ga0105240_10034582 Ga0105240_100345823 217
294 3300009174 Ga0105241_10001839 Ga0105241_100018394 217
295 3300009174 Ga0105241_10019304 Ga0105241_100193043 217
296 3300009177 Ga0105248_10045663 Ga0105248_100456635 217
297 3300009545 Ga0105237_10007301 Ga0105237_100073019 217
298 3300009545 Ga0105237_10013605 Ga0105237_100136058 217
299 3300009545 Ga0105237_10086440 Ga0105237_100864403 217
300 3300009551 Ga0105238_10000592 Ga0105238_100005927 217
301 3300009551 Ga0105238_10029073 Ga0105238_100290733 217
302 3300009553 Ga0105249_10010749 Ga0105249_100107495 217
303 3300009553 Ga0105249_10490878 Ga0105249_104908782 217
304 3300010375 Ga0105239_10045372 Ga0105239_100453724 217
305 3300010375 Ga0105239_10086193 Ga0105239_100861932 217
306 3300013104 Ga0157370_10018211 Ga0157370_100182113 217
307 3300013104 Ga0157370_10093810 Ga0157370_100938102 217
308 3300013104 Ga0157370_10118506 Ga0157370_101185062 217
309 3300013105 Ga0157369_10117048 Ga0157369_101170483 217
310 3300013105 Ga0157369_10893333 Ga0157369_108933331 217
311 3300013296 Ga0157374_10043806 Ga0157374_100438064 217
312 3300013297 Ga0157378_10006154 Ga0157378_1000615411 217
313 3300013297 Ga0157378_10006592 Ga0157378_100065924 217
314 3300013297 Ga0157378_10019626 Ga0157378_100196266 217
315 3300013297 Ga0157378_10091740 Ga0157378_100917404 217
316 3300013297 Ga0157378_10711139 Ga0157378_107111392 217
317 3300013306 Ga0163162_10008817 Ga0163162_100088175 217
318 3300013306 Ga0163162_10190554 Ga0163162_101905543 217
319 3300013306 Ga0163162_10459939 Ga0163162_104599392 217
320 3300013306 Ga0163162_10543390 Ga0163162_105433901 217
321 3300013307 Ga0157372_10003581 Ga0157372_1000358112 217
322 3300013307 Ga0157372_10117263 Ga0157372_101172633 217
323 3300013307 Ga0157372_10124972 Ga0157372_101249722 217
324 3300013307 Ga0157372_10133131 Ga0157372_101331315 217
325 3300013307 Ga0157372_10528380 Ga0157372_105283802 217
326 3300013308 Ga0157375_10000534 Ga0157375_1000053421 217
327 3300013308 Ga0157375_10059325 Ga0157375_100593252 217
328 3300013308 Ga0157375_10148157 Ga0157375_101481574 217
329 3300014325 Ga0163163_10000682 Ga0163163_1000068227 217
330 3300014325 Ga0163163_10719211 Ga0163163_107192112 217
331 3300014326 Ga0157380_10586256 Ga0157380_105862562 217
332 3300014968 Ga0157379_10018347 Ga0157379_100183475 217
333 3300014968 Ga0157379_10020819 Ga0157379_100208193 217
334 3300014969 Ga0157376_10000426 Ga0157376_100004267 217
335 3300014969 Ga0157376_10047734 Ga0157376_100477344 217
336 3300014969 Ga0157376_10147724 Ga0157376_101477243 217
337 3300014969 Ga0157376_10189974 Ga0157376_101899741 217
338 3300015265 Ga0182005_1000347 Ga0182005_10003476 217
339 3300017792 Ga0163161_10300704 Ga0163161_103007042 217
340 3300025208 Ga0209436_101020 Ga0209436_1010204 217
341 3300025208 Ga0209436_103416 Ga0209436_1034164 217
342 3300025284 Ga0209130_1010836 Ga0209130_10108362 217
343 3300025302 Ga0207426_1000024 Ga0207426_1000024122 217
344 3300025304 Ga0209257_1000004 Ga0209257_100000485 217
345 3300025321 Ga0207656_10011073 Ga0207656_100110733 217
346 3300025903 Ga0207680_10287583 Ga0207680_102875832 217
347 3300025904 Ga0207647_10039340 Ga0207647_100393404 217
348 3300025909 Ga0207705_10157074 Ga0207705_101570742 217
349 3300025911 Ga0207654_10275882 Ga0207654_102758822 217
350 3300025912 Ga0207707_10000747 Ga0207707_1000074712 217
351 3300025913 Ga0207695_10001230 Ga0207695_1000123030 217
352 3300025913 Ga0207695_10028221 Ga0207695_100282216 217
353 3300025913 Ga0207695_10199309 Ga0207695_101993092 217
354 3300025914 Ga0207671_10000931 Ga0207671_100009317 217
355 3300025914 Ga0207671_10035560 Ga0207671_100355602 217
356 3300025917 Ga0207660_10064870 Ga0207660_100648701 217
357 3300025921 Ga0207652_10002726 Ga0207652_100027269 217
358 3300025923 Ga0207681_10279777 Ga0207681_102797772 217
359 3300025924 Ga0207694_10033590 Ga0207694_100335904 217
360 3300025924 Ga0207694_10106618 Ga0207694_101066181 217
361 3300025925 Ga0207650_10041112 Ga0207650_100411121 217
362 3300025925 Ga0207650_10087017 Ga0207650_100870172 217
363 3300025925 Ga0207650_10814814 Ga0207650_108148142 217
364 3300025932 Ga0207690_10075337 Ga0207690_100753371 217
365 3300025940 Ga0207691_10350751 Ga0207691_103507513 217
366 3300025941 Ga0207711_10103947 Ga0207711_101039471 217
367 3300025942 Ga0207689_10238157 Ga0207689_102381572 217
368 3300025949 Ga0207667_10000098 Ga0207667_1000009892 217
369 3300025949 Ga0207667_10334402 Ga0207667_103344022 217
370 3300025961 Ga0207712_10007102 Ga0207712_100071025 217
371 3300025986 Ga0207658_10010201 Ga0207658_100102015 217
372 3300025986 Ga0207658_10023454 Ga0207658_100234543 217
373 3300026023 Ga0207677_10753100 Ga0207677_107531001 217
374 3300026041 Ga0207639_10083244 Ga0207639_100832443 217
375 3300026041 Ga0207639_10093861 Ga0207639_100938612 217
376 3300026041 Ga0207639_10367693 Ga0207639_103676932 217
377 3300026041 Ga0207639_10410040 Ga0207639_104100401 217
378 3300026078 Ga0207702_10048604 Ga0207702_100486043 217
379 3300026078 Ga0207702_10053865 Ga0207702_100538652 217
380 3300026088 Ga0207641_10014569 Ga0207641_100145697 217
381 3300026088 Ga0207641_10042064 Ga0207641_100420644 217
382 3300026089 Ga0207648_10278448 Ga0207648_102784482 217
383 3300026089 Ga0207648_10616631 Ga0207648_106166312 217
384 3300026095 Ga0207676_10051429 Ga0207676_100514292 217
385 3300026095 Ga0207676_10289212 Ga0207676_102892121 217
386 3300026116 Ga0207674_10000969 Ga0207674_1000096925 217
387 3300026116 Ga0207674_10062691 Ga0207674_100626914 217
388 3300026121 Ga0207683_10515237 Ga0207683_105152372 217
389 3300026142 Ga0207698_10023764 Ga0207698_100237644 217
390 3300026142 Ga0207698_10289256 Ga0207698_102892562 217
391 3300028379 Ga0268266_10000068 Ga0268266_10000068216 217
392 3300028380 Ga0268265_10609260 Ga0268265_106092602 217
393 3300028381 Ga0268264_10003074 Ga0268264_100030747 217
394 3300028794 Ga0307515_10000001 Ga0307515_100000012292 217
395 3300028794 Ga0307515_10000059 Ga0307515_10000059179 217
396 3300028794 Ga0307515_10269292 Ga0307515_102692922 217
397 3300031251 Ga0265327_10000013 Ga0265327_10000013302 217
398 3300031251 Ga0265327_10000288 Ga0265327_1000028851 217
399 3300031251 Ga0265327_10035674 Ga0265327_100356742 217
400 3300031251 Ga0265327_10129267 Ga0265327_101292671 217
401 3300031456 Ga0307513_10036214 Ga0307513_100362143 217
402 3300031456 Ga0307513_10052525 Ga0307513_100525254 217
403 3300031507 Ga0307509_10029227 Ga0307509_100292276 217
404 3300031507 Ga0307509_10161100 Ga0307509_101611003 217
405 3300031507 Ga0307509_10213553 Ga0307509_102135532 217
406 3300031730 Ga0307516_10218420 Ga0307516_102184201 217
407 3300031852 Ga0307410_10372350 Ga0307410_103723502 217
408 3300036401 Ga0373937_0310604 Ga0373937_0310604_587_1243 217
409 3300036401 Ga0373937_0807063 Ga0373937_0807063_77_733 217
410 3300041452 Ga0451793_1095409 Ga0451793_1095409_47_703 217
411 3300041997 Ga0439431_0070608 Ga0439431_0070608_97_750 217
412 3300042007 Ga0439449_0046423 Ga0439449_0046423_336_989 217
413 3300042014 Ga0439457_028482 Ga0439457_028482_428_1081 217
414 3300042876 Ga0451577_0249263 Ga0451577_0249263_850_1506 217
415 3300044658 Ga0466972_0000057 Ga0466972_0000057_22691_23347 217
416 3300044658 Ga0466972_0001286 Ga0466972_0001286_8220_8876 217
417 3300044658 Ga0466972_0077972 Ga0466972_0077972_103_756 217
418 3300044673 Ga0453683_0354821 Ga0453683_0354821_139_795 217
419 3300044712 Ga0453684_0011435 Ga0453684_0011435_11996_12652 217
420 3300044712 Ga0453684_0057694 Ga0453684_0057694_2701_3357 217
421 3300044765 Ga0466970_0131394 Ga0466970_0131394_186_842 217
422 3300046453 Ga0495627_006057 Ga0495627_006057_559_1212 217
423 3300046460 Ga0495638_0118696 Ga0495638_0118696_476_1132 217
424 3300046558 Ga0495633_0000116 Ga0495633_0000116_62859_63512 217
425 3300046616 Ga0495668_0002655 Ga0495668_0002655_2429_3085 217
426 3300046691 Ga0495670_0094099 Ga0495670_0094099_630_1286 217
427 3300047471 Ga0495684_0481590 Ga0495684_0481590_42_698 217
428 3300048907 Ga0496104_0158260 Ga0496104_0158260_74_730 217
429 3300048917 Ga0496114_0023774 Ga0496114_0023774_4021_4677 217
430 3300048929 Ga0496126_0077415 Ga0496126_0077415_31_684 217
431 3300049570 Ga0501033_0008636 Ga0501033_0008636_1508_2164 217
432 3300049570 Ga0501033_0365160 Ga0501033_0365160_133_789 217
433 3300049571 Ga0501034_0023070 Ga0501034_0023070_4950_5606 217
434 3300049703 Ga0501219_000178 Ga0501219_000178_7199_7855 217
435 3300049742 Ga0501080_0334765 Ga0501080_0334765_514_1170 217
436 3300049758 Ga0501241_012764 Ga0501241_012764_681_1337 217
437 3300049823 Ga0501044_0029803 Ga0501044_0029803_5077_5733 217
438 3300049823 Ga0501044_0243747 Ga0501044_0243747_407_1063 217
439 3300050005 Ga0501284_00036 Ga0501284_00036_45593_46249 217
440 3300050005 Ga0501284_00614 Ga0501284_00614_1058_1714 217
441 3300050507 nmdc:mga05p37_43236_c1 nmdc:mga05p37_43236_c1_3586_4242 217
442 3300053090 Ga0500646_0001397 Ga0500646_0001397_1317_1973 217
443 3300053090 Ga0500646_0004077 Ga0500646_0004077_2855_3508 217
444 3300053092 Ga0500583_0010948 Ga0500583_0010948_2354_3007 217
445 3300053093 Ga0500651_0032311 Ga0500651_0032311_1288_1941 217
446 3300053093 Ga0500651_0229784 Ga0500651_0229784_320_976 217
447 3300053093 Ga0500651_0287662 Ga0500651_0287662_59_712 217
448 3300053100 Ga0500660_070104 Ga0500660_070104_389_1042 217
449 3300053108 Ga0500562_000013 Ga0500562_000013_87680_88336 217
450 3300053118 Ga0500594_0017945 Ga0500594_0017945_265_921 217
451 3300053131 Ga0500652_029591 Ga0500652_029591_849_1505 217
452 3300053134 Ga0500658_0004288 Ga0500658_0004288_1894_2547 217
453 3300053142 Ga0500577_0001916 Ga0500577_0001916_3671_4324 217
454 3300053151 Ga0500604_0024558 Ga0500604_0024558_883_1539 217
455 3300053153 Ga0500616_0013304 Ga0500616_0013304_1089_1745 217
456 3300053153 Ga0500616_0032834 Ga0500616_0032834_256_909 217
457 3300053156 Ga0500622_0000212 Ga0500622_0000212_11632_12285 217
458 3300053730 Ga0500645_045660 Ga0500645_045660_232_888 217
459 3300053730 Ga0500645_116112 Ga0500645_116112_26_679 217
460 3300055283 Ga0500661_004853 Ga0500661_004853_1315_1968 217
461 3300001979 JGI24740J21852_10007320 JGI24740J21852_100073203 218
462 3300003215 JGI25153J46596_10017765 JGI25153J46596_100177652 218
463 3300003320 rootH2_10093065 rootH2_100930653 218
464 3300003323 rootH1_10007189 rootH1_100071896 218
465 3300003354 JGI25160J50197_1011107 JGI25160J50197_10111074 218
466 3300005289 Ga0065704_10091350 Ga0065704_100913503 218
467 3300005331 Ga0070670_100237683 Ga0070670_1002376832 218
468 3300005337 Ga0070682_100000019 Ga0070682_100000019163 218
469 3300005337 Ga0070682_100031170 Ga0070682_1000311703 218
470 3300005339 Ga0070660_100000519 Ga0070660_1000005194 218
471 3300005345 Ga0070692_10483593 Ga0070692_104835931 218
472 3300005355 Ga0070671_100645420 Ga0070671_1006454201 218
473 3300005366 Ga0070659_100074540 Ga0070659_1000745402 218
474 3300005458 Ga0070681_10046803 Ga0070681_100468032 218
475 3300005459 Ga0068867_100085178 Ga0068867_1000851783 218
476 3300005459 Ga0068867_100570857 Ga0068867_1005708571 218
477 3300005530 Ga0070679_100038514 Ga0070679_1000385144 218
478 3300005530 Ga0070679_100060254 Ga0070679_1000602544 218
479 3300005535 Ga0070684_100137687 Ga0070684_1001376873 218
480 3300005539 Ga0068853_100405807 Ga0068853_1004058072 218
481 3300005543 Ga0070672_100186938 Ga0070672_1001869382 218
482 3300005563 Ga0068855_100106522 Ga0068855_1001065223 218
483 3300005578 Ga0068854_100882581 Ga0068854_1008825811 218
484 3300005614 Ga0068856_100008593 Ga0068856_1000085937 218
485 3300005616 Ga0068852_100004838 Ga0068852_10000483810 218
486 3300005616 Ga0068852_100110708 Ga0068852_1001107083 218
487 3300005617 Ga0068859_100036292 Ga0068859_1000362924 218
488 3300005618 Ga0068864_100029084 Ga0068864_1000290844 218
489 3300005618 Ga0068864_100363186 Ga0068864_1003631862 218
490 3300005834 Ga0068851_10204155 Ga0068851_102041552 218
491 3300005841 Ga0068863_100794219 Ga0068863_1007942192 218
492 3300005843 Ga0068860_100001650 Ga0068860_1000016505 218
493 3300005843 Ga0068860_100127997 Ga0068860_1001279972 218
494 3300005844 Ga0068862_100016480 Ga0068862_1000164806 218
495 3300006195 Ga0075366_10015481 Ga0075366_100154814 218
496 3300006931 Ga0097620_100036292 Ga0097620_1000362924 218
497 3300009174 Ga0105241_10007179 Ga0105241_100071798 218
498 3300009553 Ga0105249_10211544 Ga0105249_102115443 218
499 3300010375 Ga0105239_10080298 Ga0105239_100802983 218
500 3300010375 Ga0105239_10179023 Ga0105239_101790234 218
501 3300013100 Ga0157373_10000927 Ga0157373_100009276 218
502 3300013100 Ga0157373_10010705 Ga0157373_100107058 218
503 3300013102 Ga0157371_10000218 Ga0157371_1000021870 218
504 3300013102 Ga0157371_10005354 Ga0157371_100053547 218
505 3300013102 Ga0157371_10005559 Ga0157371_1000555911 218
506 3300013102 Ga0157371_10021485 Ga0157371_100214856 218
507 3300013102 Ga0157371_10025438 Ga0157371_100254382 218
508 3300013105 Ga0157369_10052097 Ga0157369_100520973 218
509 3300013296 Ga0157374_10194339 Ga0157374_101943393 218
510 3300013306 Ga0163162_10002780 Ga0163162_100027809 218
511 3300013306 Ga0163162_10395764 Ga0163162_103957641 218
512 3300013307 Ga0157372_10013617 Ga0157372_100136176 218
513 3300013307 Ga0157372_10123969 Ga0157372_101239693 218
514 3300013308 Ga0157375_11199110 Ga0157375_111991101 218
515 3300025246 Ga0209646_1000004 Ga0209646_1000004594 218
516 3300025250 Ga0209026_1000136 Ga0209026_100013665 218
517 3300025297 Ga0209758_1023231 Ga0209758_10232312 218
518 3300025302 Ga0207426_1001807 Ga0207426_10018078 218
519 3300025893 Ga0207682_10007850 Ga0207682_100078502 218
520 3300025912 Ga0207707_10186738 Ga0207707_101867382 218
521 3300025919 Ga0207657_10002923 Ga0207657_100029234 218
522 3300025919 Ga0207657_10033182 Ga0207657_100331822 218
523 3300025921 Ga0207652_10024091 Ga0207652_100240914 218
524 3300025921 Ga0207652_10074746 Ga0207652_100747464 218
525 3300025921 Ga0207652_10131141 Ga0207652_101311412 218
526 3300025926 Ga0207659_10132026 Ga0207659_101320262 218
527 3300025932 Ga0207690_10034696 Ga0207690_100346962 218
528 3300025937 Ga0207669_10605275 Ga0207669_106052751 218
529 3300025940 Ga0207691_10022756 Ga0207691_100227563 218
530 3300025940 Ga0207691_10130113 Ga0207691_101301133 218
531 3300025940 Ga0207691_10407886 Ga0207691_104078861 218
532 3300025942 Ga0207689_10076399 Ga0207689_100763993 218
533 3300025949 Ga0207667_10023418 Ga0207667_100234184 218
534 3300025949 Ga0207667_11000812 Ga0207667_110008121 218
535 3300025960 Ga0207651_10435957 Ga0207651_104359572 218
536 3300025986 Ga0207658_10211175 Ga0207658_102111753 218
537 3300026023 Ga0207677_10383701 Ga0207677_103837011 218
538 3300026041 Ga0207639_10026703 Ga0207639_100267033 218
539 3300026041 Ga0207639_10161062 Ga0207639_101610622 218
540 3300026041 Ga0207639_10184154 Ga0207639_101841541 218
541 3300026088 Ga0207641_10720892 Ga0207641_107208921 218
542 3300026089 Ga0207648_10040263 Ga0207648_100402634 218
543 3300026089 Ga0207648_10117470 Ga0207648_101174703 218
544 3300026089 Ga0207648_10120546 Ga0207648_101205463 218
545 3300026095 Ga0207676_10175098 Ga0207676_101750982 218
546 3300026116 Ga0207674_10023895 Ga0207674_100238954 218
547 3300026116 Ga0207674_10089693 Ga0207674_100896933 218
548 3300026121 Ga0207683_10012906 Ga0207683_100129065 218
549 3300026121 Ga0207683_10822585 Ga0207683_108225851 218
550 3300026142 Ga0207698_10086891 Ga0207698_100868911 218
551 3300028380 Ga0268265_10022069 Ga0268265_100220692 218
552 3300028381 Ga0268264_10207704 Ga0268264_102077042 218
553 3300028800 Ga0265338_10141715 Ga0265338_101417152 218
554 3300030521 Ga0307511_10000201 Ga0307511_1000020150 218
555 3300031344 Ga0265316_10039776 Ga0265316_100397763 218
556 3300035172 Ga0373955_0252363 Ga0373955_0252363_158_817 218
557 3300035724 Ga0373933_0257462 Ga0373933_0257462_149_808 218
558 3300036401 Ga0373937_0566346 Ga0373937_0566346_86_745 218
559 3300036647 Ga0316582_0139304 Ga0316582_0139304_887_1558 218
560 3300036712 Ga0316584_0052487 Ga0316584_0052487_2294_2965 218
561 3300037312 Ga0395899_0026146 Ga0395899_0026146_2479_3198 218
562 3300037418 Ga0395900_0008628 Ga0395900_0008628_6643_7362 218
563 3300037466 Ga0395898_0017447 Ga0395898_0017447_220_939 218
564 3300037471 Ga0395905_0004944 Ga0395905_0004944_2170_2889 218
565 3300038443 Ga0395901_0007597 Ga0395901_0007597_6391_7110 218
566 3300038443 Ga0395901_0114128 Ga0395901_0114128_522_1244 218
567 3300041505 Ga0451849_0688680 Ga0451849_0688680_201_860 218
568 3300041512 Ga0451853_2525003 Ga0451853_2525003_124_783 218
569 3300041997 Ga0439431_0027745 Ga0439431_0027745_91_747 218
570 3300042005 Ga0439448_0088074 Ga0439448_0088074_67_726 218
571 3300042007 Ga0439449_0061030 Ga0439449_0061030_722_1381 218
572 3300044712 Ga0453684_0017764 Ga0453684_0017764_7965_8639 218
573 3300046475 Ga0495639_0217866 Ga0495639_0217866_14_673 218
574 3300046535 Ga0495586_0114007 Ga0495586_0114007_194_853 218
575 3300046536 Ga0495587_0089912 Ga0495587_0089912_93_752 218
576 3300046539 Ga0495621_0033310 Ga0495621_0033310_341_1000 218
577 3300046616 Ga0495668_0000099 Ga0495668_0000099_29518_30177 218
578 3300046663 Ga0495635_0131993 Ga0495635_0131993_889_1548 218
579 3300046683 Ga0495658_0318132 Ga0495658_0318132_67_726 218
580 3300047319 Ga0495674_0131800 Ga0495674_0131800_882_1541 218
581 3300047319 Ga0495674_0308199 Ga0495674_0308199_92_751 218
582 3300048924 Ga0496121_0000081 Ga0496121_0000081_187353_188009 218
583 3300049570 Ga0501033_0034295 Ga0501033_0034295_190_909 218
584 3300049570 Ga0501033_0136954 Ga0501033_0136954_153_866 218
585 3300049570 Ga0501033_0308481 Ga0501033_0308481_130_786 218
586 3300049571 Ga0501034_0014518 Ga0501034_0014518_3553_4266 218
587 3300049579 Ga0501043_0074054 Ga0501043_0074054_743_1462 218
588 3300049581 Ga0501047_0116620 Ga0501047_0116620_289_945 218
589 3300049586 Ga0501070_0098427 Ga0501070_0098427_709_1422 218
590 3300049671 Ga0501238_006580 Ga0501238_006580_322_978 218
591 3300049822 Ga0501035_0023737 Ga0501035_0023737_2653_3372 218
592 3300049822 Ga0501035_0114943 Ga0501035_0114943_1404_2117 218
593 3300049823 Ga0501044_0047818 Ga0501044_0047818_3556_4275 218
594 3300049823 Ga0501044_0058772 Ga0501044_0058772_491_1201 218
595 3300050493 nmdc:mga0k408_44352_c1 nmdc:mga0k408_44352_c1_68_727 218
596 3300050511 nmdc:mga08y16_714280_c1 nmdc:mga08y16_714280_c1_102_761 218
597 3300053085 Ga0495619_0186445 Ga0495619_0186445_29_688 218
598 3300053133 Ga0500655_031558 Ga0500655_031558_189_851 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

83

252

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gt1-assembly1.cif.gz_A crystal structure of cbpa from l. salivarius ren 0.6893 96 191
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.6579 54 193
6f6w-assembly1.cif.gz_D structure of mycobacterium smegmatis rna polymerase core 0.5913 112 181
4lxc-assembly5.cif.gz_C-2 the antimicrobial peptidase lysostaphin from staphylococcus simulans 0.5701 63 191
4qpb-assembly1.cif.gz_A catalytic domain of the antimicrobial peptidase lysostaphin from staphylococcus simulans crystallized in the absence of phosphate 0.54 74 191
ID Description Score Start End Superfamily
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9579 52 215 2.70.70.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8994 52 215 2.70.70.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8685 48 215 2.70.70.10
af_I1KUF4_411_621_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.852 55 215 2.70.70.10
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8459 52 215 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A2G4GR72-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9931 68 216 GO:0004609
GO:0005886
GO:0008654
AF-A0A822EUS2-F1-model_v4 Phosphatidylserine decarboxylase 0.9924 55 218 GO:0004609
GO:0005886
GO:0008654
AF-A0A3D5J2C6-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9899 84 217 GO:0004609
GO:0005886
GO:0008654
AF-A0A4Q3P002-F1-model_v4 deleted 0.9898 84 218
AF-A0A7C7NC87-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9866 78 218 GO:0004609
GO:0005886
GO:0008654

Feature Viewer

pLDDT pTM Quality
94.59 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map