F467761

General Info

Members Datasets Scaffolds Average Seq Length
598 200 598 114

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100184946|Ga0068855_1001849463
Length 122
Sequence MAAAGVLVAAMRKALLASLLVVSGSQALAGASGFTLINGTGAALAKLSIRRSGTQEWTALGPAPSPGARMAMKFTNPDCAFDISADVAGAGPVTWAGVNLCDVRSVTLNRDASAGAWVDYDH

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 1.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.02
Rhizosphere 93.81
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1007216 3300001915 Bacteria 2168
2 JGI24740J21852_10001231 3300001979 Bacteria 11590
3 JGI24739J22299_10005727 3300001989 Bacteria 4709
4 JGI24737J22298_10021697 3300001990 Bacteria 2044
5 JGI24735J21928_10008775 3300002067 Bacteria 3261
6 rootH1_10046825 3300003323 Bacteria 1170
7 Ga0065712_10117247 3300005290 Bacteria 1719
8 Ga0070658_10011479 3300005327 Bacteria 7104
9 Ga0070658_10053423 3300005327 Bacteria 3279
10 Ga0070658_10105094 3300005327 Bacteria 2336
11 Ga0070658_10131206 3300005327 Bacteria 2088
12 Ga0070658_10408624 3300005327 Bacteria 1166
13 Ga0070676_10006095 3300005328 Bacteria 6437
14 Ga0070676_10020828 3300005328 Bacteria 3665
15 Ga0070683_100007324 3300005329 Bacteria 9319
16 Ga0070683_100094910 3300005329 Bacteria 2803
17 Ga0070683_100502235 3300005329 Bacteria 1159
18 Ga0070683_101626675 3300005329 Bacteria 621
19 Ga0070683_101925339 3300005329 Bacteria 568
20 Ga0070670_100448384 3300005331 Bacteria 1143
21 Ga0070670_100535250 3300005331 Bacteria 1044
22 Ga0070677_10335555 3300005333 Bacteria 779
23 Ga0068869_100038985 3300005334 Bacteria 3389
24 Ga0068869_100158502 3300005334 Bacteria 1760
25 Ga0068869_100268503 3300005334 Unclassified 1368
26 Ga0070666_10416248 3300005335 Bacteria 967
27 Ga0070680_100000949 3300005336 Bacteria 20532
28 Ga0070680_100003333 3300005336 Bacteria 11982
29 Ga0070680_100010364 3300005336 Bacteria 7184
30 Ga0070680_100065654 3300005336 Bacteria 2974
31 Ga0070680_100067464 3300005336 Bacteria 2934
32 Ga0070680_100096040 3300005336 Bacteria 2457
33 Ga0070680_100146829 3300005336 Bacteria 1979
34 Ga0070682_100049596 3300005337 Bacteria 2617
35 Ga0070682_100301049 3300005337 Bacteria 1177
36 Ga0070682_101186002 3300005337 Bacteria 644
37 Ga0068868_100248787 3300005338 Bacteria 1496
38 Ga0070660_100067266 3300005339 Bacteria 2791
39 Ga0070660_100158201 3300005339 Bacteria 1824
40 Ga0070660_100191803 3300005339 Bacteria 1655
41 Ga0070660_100431726 3300005339 Bacteria 1091
42 Ga0070660_100450873 3300005339 Unclassified 1067
43 Ga0070660_101449531 3300005339 Unclassified 583
44 Ga0070689_100811878 3300005340 Unclassified 823
45 Ga0070691_10402856 3300005341 Bacteria 771
46 Ga0070661_100013498 3300005344 Bacteria 5735
47 Ga0070661_100054103 3300005344 Bacteria 2940
48 Ga0070661_100077562 3300005344 Bacteria 2450
49 Ga0070661_100117780 3300005344 Bacteria 1987
50 Ga0070661_100206329 3300005344 Unclassified 1503
51 Ga0070661_100752039 3300005344 Unclassified 797
52 Ga0070692_10016712 3300005345 Bacteria 3496
53 Ga0070692_10073536 3300005345 Bacteria 1826
54 Ga0070692_10085163 3300005345 Bacteria 1709
55 Ga0070692_10404006 3300005345 Bacteria 863
56 Ga0070692_11077572 3300005345 Bacteria 566
57 Ga0070668_100002885 3300005347 Bacteria 12686
58 Ga0070668_100038698 3300005347 Bacteria 3646
59 Ga0070669_101912144 3300005353 Unclassified 518
60 Ga0070671_100017905 3300005355 Bacteria 5745
61 Ga0070671_100021979 3300005355 Bacteria 5211
62 Ga0070671_100025268 3300005355 Bacteria 4872
63 Ga0070671_100069229 3300005355 Bacteria 2943
64 Ga0070671_100741270 3300005355 Bacteria 853
65 Ga0070674_100174267 3300005356 Bacteria 1642
66 Ga0070673_100140358 3300005364 Bacteria 2037
67 Ga0070673_100296893 3300005364 Bacteria 1421
68 Ga0070673_100536262 3300005364 Bacteria 1062
69 Ga0070673_101761435 3300005364 Bacteria 587
70 Ga0070659_100011702 3300005366 Bacteria 6494
71 Ga0070659_100020141 3300005366 Bacteria 5065
72 Ga0070659_100225855 3300005366 Bacteria 1546
73 Ga0070659_100278807 3300005366 Bacteria 1390
74 Ga0070659_100322285 3300005366 Bacteria 1292
75 Ga0070659_100363391 3300005366 Bacteria 1216
76 Ga0070659_101400549 3300005366 Unclassified 621
77 Ga0070667_100051050 3300005367 Bacteria 3486
78 Ga0070667_100057107 3300005367 Bacteria 3297
79 Ga0070667_100244397 3300005367 Bacteria 1603
80 Ga0070714_100032130 3300005435 Bacteria 4381
81 Ga0070714_100273561 3300005435 Bacteria 1567
82 Ga0070714_100773482 3300005435 Bacteria 929
83 Ga0070714_100788668 3300005435 Bacteria 920
84 Ga0070713_101354120 3300005436 Bacteria 690
85 Ga0070663_100041297 3300005455 Bacteria 3234
86 Ga0070663_100082579 3300005455 Bacteria 2364
87 Ga0070663_100121184 3300005455 Bacteria 1976
88 Ga0070663_100314404 3300005455 Bacteria 1258
89 Ga0070663_100417742 3300005455 Bacteria 1100
90 Ga0070678_100468433 3300005456 Bacteria 1106
91 Ga0070678_102156415 3300005456 Unclassified 528
92 Ga0070662_100009290 3300005457 Bacteria 6428
93 Ga0070662_100032110 3300005457 Bacteria 3688
94 Ga0070662_100164105 3300005457 Bacteria 1739
95 Ga0070681_10038221 3300005458 Bacteria 4812
96 Ga0070681_10062316 3300005458 Bacteria 3703
97 Ga0070681_10125312 3300005458 Bacteria 2501
98 Ga0070681_10128067 3300005458 Bacteria 2471
99 Ga0068867_100052204 3300005459 Bacteria 3016
100 Ga0068867_100231959 3300005459 Bacteria 1493
101 Ga0070706_101676158 3300005467 Unclassified 579
102 Ga0070679_100046021 3300005530 Bacteria 4348
103 Ga0070679_100071466 3300005530 Bacteria 3461
104 Ga0070679_100137597 3300005530 Bacteria 2423
105 Ga0070679_100374568 3300005530 Bacteria 1370
106 Ga0070679_100415477 3300005530 Bacteria 1291
107 Ga0070679_100422933 3300005530 Bacteria 1277
108 Ga0070679_100542212 3300005530 Bacteria 1107
109 Ga0070679_100817588 3300005530 Unclassified 875
110 Ga0070684_100002908 3300005535 Bacteria 12725
111 Ga0070684_100382198 3300005535 Bacteria 1297
112 Ga0068853_100344343 3300005539 Bacteria 1385
113 Ga0068853_100871950 3300005539 Unclassified 864
114 Ga0068853_102366817 3300005539 Bacteria 514
115 Ga0070672_100036975 3300005543 Bacteria 3723
116 Ga0070672_100536056 3300005543 Bacteria 1015
117 Ga0070672_101424316 3300005543 Bacteria 620
118 Ga0070686_100702108 3300005544 Bacteria 807
119 Ga0070696_100254288 3300005546 Bacteria 1330
120 Ga0070696_100265131 3300005546 Bacteria 1304
121 Ga0070693_100017098 3300005547 Bacteria 3764
122 Ga0070693_100026295 3300005547 Bacteria 3141
123 Ga0070693_100040989 3300005547 Bacteria 2603
124 Ga0070693_100135056 3300005547 Bacteria 1547
125 Ga0070693_100404387 3300005547 Bacteria 947
126 Ga0070665_100031834 3300005548 Bacteria 5309
127 Ga0070665_100271570 3300005548 Bacteria 1698
128 Ga0068855_100035866 3300005563 Bacteria 5906
129 Ga0068855_100060775 3300005563 Bacteria 4417
130 Ga0068855_100061726 3300005563 Bacteria 4378
131 Ga0068855_100131289 3300005563 Bacteria 2861
132 Ga0068855_100184946 3300005563 Bacteria 2354
133 Ga0068855_100241658 3300005563 Bacteria 2017
134 Ga0068855_101550478 3300005563 Unclassified 679
135 Ga0068855_101686678 3300005563 Bacteria 646
136 Ga0070664_100013494 3300005564 Bacteria 6656
137 Ga0070664_100021333 3300005564 Bacteria 5337
138 Ga0070664_100121298 3300005564 Bacteria 2289
139 Ga0070664_100225338 3300005564 Bacteria 1678
140 Ga0070664_100639941 3300005564 Bacteria 988
141 Ga0070664_101356782 3300005564 Bacteria 672
142 Ga0068857_100012761 3300005577 Bacteria 7323
143 Ga0068857_100030244 3300005577 Bacteria 4780
144 Ga0068857_100063999 3300005577 Bacteria 3269
145 Ga0068857_100149899 3300005577 Bacteria 2112
146 Ga0068857_100289642 3300005577 Bacteria 1507
147 Ga0068857_100431390 3300005577 Unclassified 1230
148 Ga0068857_100539462 3300005577 Bacteria 1098
149 Ga0068857_101270250 3300005577 Unclassified 714
150 Ga0068854_100010744 3300005578 Bacteria 5940
151 Ga0068854_100020503 3300005578 Bacteria 4473
152 Ga0068854_100022213 3300005578 Bacteria 4318
153 Ga0068856_100025471 3300005614 Bacteria 5770
154 Ga0068856_100056122 3300005614 Bacteria 3886
155 Ga0068856_100112010 3300005614 Bacteria 2726
156 Ga0068856_100125416 3300005614 Bacteria 2571
157 Ga0068856_100170768 3300005614 Bacteria 2187
158 Ga0068856_100231203 3300005614 Bacteria 1864
159 Ga0068856_100291769 3300005614 Unclassified 1648
160 Ga0068856_100432367 3300005614 Bacteria 1336
161 Ga0068856_100571685 3300005614 Bacteria 1151
162 Ga0068856_100667865 3300005614 Unclassified 1060
163 Ga0068856_102319905 3300005614 Unclassified 545
164 Ga0070702_100207006 3300005615 Bacteria 1303
165 Ga0068852_100005692 3300005616 Bacteria 8937
166 Ga0068852_100031780 3300005616 Bacteria 4363
167 Ga0068852_100070701 3300005616 Bacteria 3063
168 Ga0068852_100778676 3300005616 Unclassified 970
169 Ga0068852_101157837 3300005616 Bacteria 794
170 Ga0068859_100009099 3300005617 Bacteria 10029
171 Ga0068859_100020350 3300005617 Bacteria 6661
172 Ga0068864_100015503 3300005618 Bacteria 6337
173 Ga0068864_100025133 3300005618 Bacteria 5014
174 Ga0068864_101342296 3300005618 Bacteria 716
175 Ga0068866_10130748 3300005718 Bacteria 1427
176 Ga0068861_101260795 3300005719 Bacteria 717
177 Ga0068851_10017478 3300005834 Bacteria 3445
178 Ga0068851_10034050 3300005834 Bacteria 2541
179 Ga0068851_10106175 3300005834 Bacteria 1495
180 Ga0068851_10121637 3300005834 Bacteria 1403
181 Ga0068851_10605533 3300005834 Unclassified 667
182 Ga0068870_10046369 3300005840 Bacteria 2279
183 Ga0068863_100001823 3300005841 Bacteria 21161
184 Ga0068863_100979529 3300005841 Unclassified 848
185 Ga0068858_100056661 3300005842 Bacteria 3621
186 Ga0068862_100196674 3300005844 Bacteria 1816
187 Ga0068862_100623825 3300005844 Bacteria 1037
188 Ga0097621_100044460 3300006237 Bacteria 3583
189 Ga0097621_100132636 3300006237 Bacteria 2122
190 Ga0097621_100518651 3300006237 Bacteria 1081
191 Ga0068871_100011911 3300006358 Bacteria 6401
192 Ga0068871_100019581 3300006358 Bacteria 5170
193 Ga0068871_100362997 3300006358 Unclassified 1283
194 Ga0068871_101141597 3300006358 Unclassified 729
195 Ga0075434_100534016 3300006871 Bacteria 1193
196 Ga0068865_100555710 3300006881 Unclassified 964
197 Ga0097620_100009099 3300006931 Bacteria 10029
198 Ga0097620_100020349 3300006931 Bacteria 6661
199 Ga0105240_10029334 3300009093 Bacteria 7170
200 Ga0105240_10085079 3300009093 Bacteria 3876
201 Ga0105240_12136391 3300009093 Bacteria 581
202 Ga0105241_10909418 3300009174 Bacteria 818
203 Ga0105242_12489722 3300009176 Unclassified 566
204 Ga0105248_10254830 3300009177 Bacteria 1975
205 Ga0105248_10448211 3300009177 Bacteria 1454
206 Ga0105237_10160258 3300009545 Bacteria 2248
207 Ga0105249_10058355 3300009553 Bacteria 3537
208 Ga0105239_10402987 3300010375 Bacteria 1548
209 Ga0105246_10234075 3300011119 Bacteria 1448
210 Ga0157373_10004225 3300013100 Bacteria 10838
211 Ga0157373_10026842 3300013100 Bacteria 4156
212 Ga0157373_10122351 3300013100 Bacteria 1829
213 Ga0157373_10227075 3300013100 Bacteria 1318
214 Ga0157373_10242016 3300013100 Bacteria 1275
215 Ga0157373_10353787 3300013100 Unclassified 1048
216 Ga0157373_10906005 3300013100 Bacteria 654
217 Ga0157371_10004463 3300013102 Bacteria 12202
218 Ga0157371_10037671 3300013102 Bacteria 3461
219 Ga0157371_10074720 3300013102 Bacteria 2400
220 Ga0157371_10220391 3300013102 Bacteria 1362
221 Ga0157371_11027247 3300013102 Unclassified 630
222 Ga0157371_11050271 3300013102 Unclassified 623
223 Ga0157371_11261495 3300013102 Bacteria 571
224 Ga0157370_10024230 3300013104 Bacteria 6013
225 Ga0157370_10076923 3300013104 Bacteria 3144
226 Ga0157370_10078132 3300013104 Bacteria 3117
227 Ga0157370_10131157 3300013104 Bacteria 2337
228 Ga0157370_10928008 3300013104 Bacteria 789
229 Ga0157369_10014658 3300013105 Bacteria 8844
230 Ga0157369_10051881 3300013105 Bacteria 4438
231 Ga0157369_10119758 3300013105 Bacteria 2793
232 Ga0157369_10140705 3300013105 Bacteria 2553
233 Ga0157369_10588773 3300013105 Bacteria 1149
234 Ga0157369_10643443 3300013105 Unclassified 1094
235 Ga0157369_10669928 3300013105 Bacteria 1069
236 Ga0157369_11324360 3300013105 Bacteria 734
237 Ga0157369_12453172 3300013105 Unclassified 528
238 Ga0157374_10227396 3300013296 Bacteria 1832
239 Ga0157374_10232290 3300013296 Unclassified 1812
240 Ga0157374_10548198 3300013296 Bacteria 1164
241 Ga0157378_10641711 3300013297 Bacteria 1077
242 Ga0163162_12707160 3300013306 Unclassified 571
243 Ga0157372_10011298 3300013307 Bacteria 9500
244 Ga0157372_10140839 3300013307 Bacteria 2778
245 Ga0157372_10307564 3300013307 Bacteria 1844
246 Ga0157372_10360145 3300013307 Bacteria 1695
247 Ga0157372_10396768 3300013307 Bacteria 1608
248 Ga0157372_10816266 3300013307 Unclassified 1083
249 Ga0157372_11395098 3300013307 Unclassified 808
250 Ga0157372_13369572 3300013307 Bacteria 509
251 Ga0163163_10368326 3300014325 Bacteria 1494
252 Ga0182008_10183488 3300014497 Unclassified 1059
253 Ga0157379_10016410 3300014968 Bacteria 6515
254 Ga0157376_10225552 3300014969 Bacteria 1738
255 Ga0197907_10880863 3300020069 Bacteria 2926
256 Ga0206356_10074930 3300020070 Bacteria 937
257 Ga0206356_10442977 3300020070 Bacteria 650
258 Ga0206356_11429053 3300020070 Bacteria 1402
259 Ga0206354_10572344 3300020081 Bacteria 1430
260 Ga0206354_11234450 3300020081 Bacteria 1529
261 Ga0206353_10400680 3300020082 Bacteria 2250
262 Ga0206353_10819729 3300020082 Bacteria 1961
263 Ga0206353_11156649 3300020082 Bacteria 785
264 Ga0224712_10189689 3300022467 Bacteria 930
265 Ga0207697_10077675 3300025315 Bacteria 1396
266 Ga0207656_10023804 3300025321 Bacteria 2470
267 Ga0207656_10103501 3300025321 Bacteria 1308
268 Ga0207688_10050036 3300025901 Bacteria 2338
269 Ga0207680_10669736 3300025903 Bacteria 743
270 Ga0207647_10012436 3300025904 Bacteria 5925
271 Ga0207647_10122538 3300025904 Bacteria 1532
272 Ga0207647_10155821 3300025904 Bacteria 1334
273 Ga0207645_10007154 3300025907 Bacteria 7916
274 Ga0207645_10038322 3300025907 Bacteria 3074
275 Ga0207643_10031141 3300025908 Bacteria 2972
276 Ga0207705_10015545 3300025909 Bacteria 5461
277 Ga0207705_10040220 3300025909 Bacteria 3352
278 Ga0207705_10087733 3300025909 Bacteria 2275
279 Ga0207705_10112102 3300025909 Bacteria 2016
280 Ga0207705_10214224 3300025909 Bacteria 1461
281 Ga0207705_10336644 3300025909 Bacteria 1161
282 Ga0207705_10348029 3300025909 Unclassified 1141
283 Ga0207705_10352951 3300025909 Unclassified 1133
284 Ga0207654_10290485 3300025911 Bacteria 1108
285 Ga0207707_10004057 3300025912 Bacteria 12978
286 Ga0207707_10027976 3300025912 Bacteria 4930
287 Ga0207707_10126358 3300025912 Bacteria 2236
288 Ga0207707_10951573 3300025912 Bacteria 707
289 Ga0207695_10363919 3300025913 Bacteria 1333
290 Ga0207695_10490288 3300025913 Unclassified 1111
291 Ga0207671_10276166 3300025914 Bacteria 1325
292 Ga0207660_10000622 3300025917 Bacteria 23918
293 Ga0207660_10002987 3300025917 Bacteria 11076
294 Ga0207660_10024479 3300025917 Bacteria 4088
295 Ga0207660_10058400 3300025917 Bacteria 2766
296 Ga0207660_10278696 3300025917 Bacteria 1326
297 Ga0207660_10359371 3300025917 Unclassified 1168
298 Ga0207660_10916118 3300025917 Unclassified 715
299 Ga0207657_10002388 3300025919 Bacteria 20300
300 Ga0207657_10007776 3300025919 Bacteria 10945
301 Ga0207657_10012889 3300025919 Bacteria 8221
302 Ga0207657_10058035 3300025919 Bacteria 3332
303 Ga0207657_11368546 3300025919 Unclassified 532
304 Ga0207649_10002366 3300025920 Bacteria 10569
305 Ga0207649_10032012 3300025920 Bacteria 3131
306 Ga0207649_10074659 3300025920 Bacteria 2176
307 Ga0207649_10101994 3300025920 Bacteria 1901
308 Ga0207649_10469934 3300025920 Bacteria 952
309 Ga0207652_10008999 3300025921 Bacteria 8047
310 Ga0207652_10074636 3300025921 Bacteria 2953
311 Ga0207652_10106544 3300025921 Bacteria 2481
312 Ga0207652_10239392 3300025921 Bacteria 1636
313 Ga0207652_10327154 3300025921 Bacteria 1384
314 Ga0207652_10334786 3300025921 Unclassified 1367
315 Ga0207652_10526317 3300025921 Bacteria 1063
316 Ga0207652_10905227 3300025921 Bacteria 779
317 Ga0207652_10969690 3300025921 Unclassified 748
318 Ga0207681_10039278 3300025923 Bacteria 3141
319 Ga0207681_10842074 3300025923 Unclassified 767
320 Ga0207650_10155111 3300025925 Unclassified 1810
321 Ga0207650_10584038 3300025925 Bacteria 938
322 Ga0207700_10822706 3300025928 Bacteria 831
323 Ga0207664_10130267 3300025929 Bacteria 2117
324 Ga0207664_10497144 3300025929 Bacteria 1092
325 Ga0207644_10026343 3300025931 Bacteria 4005
326 Ga0207644_10027403 3300025931 Bacteria 3935
327 Ga0207644_10343075 3300025931 Bacteria 1211
328 Ga0207644_10742397 3300025931 Bacteria 820
329 Ga0207690_10001958 3300025932 Bacteria 12634
330 Ga0207690_10016729 3300025932 Bacteria 4468
331 Ga0207690_10030418 3300025932 Bacteria 3444
332 Ga0207690_10044034 3300025932 Bacteria 2940
333 Ga0207690_10149475 3300025932 Bacteria 1730
334 Ga0207690_10457910 3300025932 Bacteria 1026
335 Ga0207690_10491332 3300025932 Unclassified 992
336 Ga0207706_10001598 3300025933 Bacteria 22482
337 Ga0207706_10034355 3300025933 Bacteria 4511
338 Ga0207706_10050362 3300025933 Bacteria 3681
339 Ga0207706_11365858 3300025933 Bacteria 583
340 Ga0207669_10342741 3300025937 Bacteria 1151
341 Ga0207704_10544617 3300025938 Bacteria 942
342 Ga0207691_10103064 3300025940 Bacteria 2545
343 Ga0207691_10414698 3300025940 Bacteria 1148
344 Ga0207691_10501231 3300025940 Bacteria 1031
345 Ga0207711_10338676 3300025941 Bacteria 1392
346 Ga0207689_10065498 3300025942 Bacteria 2988
347 Ga0207689_10511732 3300025942 Unclassified 1006
348 Ga0207689_10595466 3300025942 Bacteria 930
349 Ga0207661_10134979 3300025944 Bacteria 2118
350 Ga0207661_10660041 3300025944 Bacteria 961
351 Ga0207679_10016090 3300025945 Bacteria 4961
352 Ga0207679_10017478 3300025945 Bacteria 4785
353 Ga0207679_10022123 3300025945 Bacteria 4324
354 Ga0207679_10141460 3300025945 Bacteria 1945
355 Ga0207679_10166134 3300025945 Bacteria 1812
356 Ga0207679_10525180 3300025945 Bacteria 1059
357 Ga0207667_10025662 3300025949 Bacteria 6448
358 Ga0207667_10049052 3300025949 Bacteria 4461
359 Ga0207667_10128071 3300025949 Bacteria 2615
360 Ga0207667_10133735 3300025949 Bacteria 2554
361 Ga0207667_10157366 3300025949 Bacteria 2338
362 Ga0207667_10218803 3300025949 Bacteria 1951
363 Ga0207651_10028011 3300025960 Bacteria 3547
364 Ga0207668_10000610 3300025972 Bacteria 22233
365 Ga0207668_10063351 3300025972 Bacteria 2608
366 Ga0207668_12152770 3300025972 Unclassified 502
367 Ga0207640_10016828 3300025981 Bacteria 4263
368 Ga0207640_10074769 3300025981 Bacteria 2294
369 Ga0207640_10174742 3300025981 Bacteria 1604
370 Ga0207640_11076922 3300025981 Bacteria 710
371 Ga0207640_11823035 3300025981 Unclassified 550
372 Ga0207658_10030462 3300025986 Bacteria 3820
373 Ga0207658_10059665 3300025986 Bacteria 2843
374 Ga0207658_10615517 3300025986 Bacteria 976
375 Ga0207703_10819373 3300026035 Bacteria 889
376 Ga0207639_10006163 3300026041 Bacteria 8141
377 Ga0207639_10373231 3300026041 Bacteria 1279
378 Ga0207639_10960861 3300026041 Bacteria 800
379 Ga0207639_11636546 3300026041 Bacteria 604
380 Ga0207639_11845499 3300026041 Unclassified 565
381 Ga0207678_10019720 3300026067 Bacteria 5931
382 Ga0207678_10032598 3300026067 Bacteria 4540
383 Ga0207678_10164388 3300026067 Bacteria 1895
384 Ga0207678_10225451 3300026067 Bacteria 1604
385 Ga0207678_10334178 3300026067 Bacteria 1305
386 Ga0207702_10003225 3300026078 Bacteria 15070
387 Ga0207702_10103553 3300026078 Bacteria 2518
388 Ga0207702_10150793 3300026078 Bacteria 2114
389 Ga0207702_10626244 3300026078 Bacteria 1057
390 Ga0207702_10641307 3300026078 Bacteria 1044
391 Ga0207702_11123577 3300026078 Bacteria 780
392 Ga0207702_11313157 3300026078 Unclassified 717
393 Ga0207702_11628594 3300026078 Bacteria 639
394 Ga0207641_10008053 3300026088 Bacteria 8732
395 Ga0207648_10049455 3300026089 Bacteria 3678
396 Ga0207648_10071799 3300026089 Bacteria 3017
397 Ga0207676_10056428 3300026095 Bacteria 3088
398 Ga0207676_10060447 3300026095 Bacteria 2997
399 Ga0207674_10002193 3300026116 Bacteria 24722
400 Ga0207674_10004629 3300026116 Bacteria 16511
401 Ga0207674_10018921 3300026116 Bacteria 7467
402 Ga0207674_10079820 3300026116 Bacteria 3275
403 Ga0207674_10102891 3300026116 Bacteria 2836
404 Ga0207674_10328278 3300026116 Bacteria 1479
405 Ga0207674_10520676 3300026116 Unclassified 1149
406 Ga0207675_100074914 3300026118 Bacteria 3167
407 Ga0207675_100922068 3300026118 Bacteria 890
408 Ga0207683_10150581 3300026121 Bacteria 2100
409 Ga0207698_10009736 3300026142 Bacteria 6137
410 Ga0207698_10034836 3300026142 Bacteria 3675
411 Ga0207698_10051147 3300026142 Bacteria 3157
412 Ga0207698_10432094 3300026142 Bacteria 1266
413 Ga0207698_10960267 3300026142 Bacteria 864
414 Ga0207698_11010144 3300026142 Bacteria 843
415 Ga0207698_12224256 3300026142 Bacteria 561
416 Ga0268266_10026865 3300028379 Bacteria 4897
417 Ga0268266_10279807 3300028379 Bacteria 1551
418 Ga0268266_10794200 3300028379 Bacteria 914
419 Ga0268266_11231896 3300028379 Bacteria 723
420 Ga0268265_10012360 3300028380 Bacteria 5785
421 Ga0268265_10609447 3300028380 Bacteria 1044
422 Ga0268264_10633869 3300028381 Bacteria 1056
423 Ga0307408_100009381 3300031548 Bacteria 6450
424 Ga0307405_10790090 3300031731 Bacteria 794
425 Ga0307405_10853986 3300031731 Unclassified 767
426 Ga0307413_10204662 3300031824 Bacteria 1428
427 Ga0307413_11821245 3300031824 Bacteria 545
428 Ga0307410_10025668 3300031852 Bacteria 3700
429 Ga0307410_10028591 3300031852 Bacteria 3539
430 Ga0307410_10206301 3300031852 Bacteria 1503
431 Ga0307410_10363833 3300031852 Bacteria 1159
432 Ga0307406_10045392 3300031901 Bacteria 2758
433 Ga0307406_10045616 3300031901 Bacteria 2753
434 Ga0307406_10814692 3300031901 Bacteria 789
435 Ga0307407_10057443 3300031903 Bacteria 2257
436 Ga0307407_10140119 3300031903 Bacteria 1559
437 Ga0307412_10877884 3300031911 Bacteria 784
438 Ga0307409_100006396 3300031995 Bacteria 6918
439 Ga0307409_100021628 3300031995 Bacteria 4414
440 Ga0307409_100088176 3300031995 Bacteria 2532
441 Ga0307409_100341413 3300031995 Bacteria 1409
442 Ga0307416_100777825 3300032002 Bacteria 1052
443 Ga0307414_10170791 3300032004 Bacteria 1738
444 Ga0307414_10259852 3300032004 Bacteria 1448
445 Ga0307414_11789667 3300032004 Unclassified 573
446 Ga0307411_10022370 3300032005 Bacteria 3721
447 Ga0307411_10039228 3300032005 Bacteria 2994
448 Ga0307411_10069882 3300032005 Bacteria 2373
449 Ga0307411_10918220 3300032005 Bacteria 779
450 Ga0307415_100128568 3300032126 Bacteria 1913
451 Ga0307415_100372833 3300032126 Bacteria 1209
452 Ga0373923_0007699 3300035111 Bacteria 3803
453 Ga0373954_0017102 3300035118 Bacteria 3253
454 Ga0373956_0572037 3300035119 Bacteria 539
455 Ga0373955_0003964 3300035172 Bacteria 6536
456 Ga0373937_0177188 3300036401 Bacteria 2001
457 Ga0395899_0040173 3300037312 Bacteria 3499
458 Ga0395899_0102397 3300037312 Bacteria 2066
459 Ga0395899_0121709 3300037312 Bacteria 1868
460 Ga0395899_0978286 3300037312 Unclassified 511
461 Ga0395900_0013430 3300037418 Bacteria 8369
462 Ga0395900_0034591 3300037418 Bacteria 5204
463 Ga0395900_0043473 3300037418 Bacteria 4631
464 Ga0395900_0047190 3300037418 Bacteria 4435
465 Ga0395900_0067325 3300037418 Bacteria 3679
466 Ga0395900_0111452 3300037418 Bacteria 2810
467 Ga0395900_0112921 3300037418 Bacteria 2789
468 Ga0395900_0113558 3300037418 Bacteria 2780
469 Ga0395900_0305536 3300037418 Bacteria 1575
470 Ga0395900_0375428 3300037418 Bacteria 1391
471 Ga0395900_0437136 3300037418 Bacteria 1267
472 Ga0395900_0559056 3300037418 Unclassified 1088
473 Ga0395900_0710842 3300037418 Unclassified 938
474 Ga0395900_0749935 3300037418 Unclassified 906
475 Ga0395900_0787927 3300037418 Bacteria 879
476 Ga0395900_0909009 3300037418 Bacteria 803
477 Ga0395898_0107091 3300037466 Bacteria 2681
478 Ga0395898_0200048 3300037466 Bacteria 1908
479 Ga0395898_0203496 3300037466 Bacteria 1889
480 Ga0395898_0279128 3300037466 Bacteria 1593
481 Ga0395898_0511097 3300037466 Bacteria 1142
482 Ga0395898_0702791 3300037466 Bacteria 953
483 Ga0395898_0772187 3300037466 Unclassified 902
484 Ga0395898_0853866 3300037466 Bacteria 849
485 Ga0395898_1011973 3300037466 Unclassified 766
486 Ga0395905_0009909 3300037471 Bacteria 9286
487 Ga0395905_0019968 3300037471 Bacteria 6349
488 Ga0395905_0048156 3300037471 Bacteria 3995
489 Ga0395905_0063892 3300037471 Bacteria 3444
490 Ga0395905_0078376 3300037471 Bacteria 3097
491 Ga0395905_0082702 3300037471 Bacteria 3008
492 Ga0395905_0088817 3300037471 Bacteria 2896
493 Ga0395905_0122668 3300037471 Bacteria 2443
494 Ga0395905_0139287 3300037471 Bacteria 2283
495 Ga0395905_0140125 3300037471 Bacteria 2275
496 Ga0395905_0161298 3300037471 Bacteria 2107
497 Ga0395905_0250203 3300037471 Bacteria 1655
498 Ga0395905_0298888 3300037471 Bacteria 1497
499 Ga0395905_0329314 3300037471 Unclassified 1417
500 Ga0395905_0448702 3300037471 Bacteria 1188
501 Ga0395905_0450864 3300037471 Unclassified 1184
502 Ga0395905_0499716 3300037471 Bacteria 1116
503 Ga0395905_0500778 3300037471 Bacteria 1115
504 Ga0395905_0529913 3300037471 Bacteria 1078
505 Ga0395905_0535081 3300037471 Bacteria 1072
506 Ga0395905_0742859 3300037471 Bacteria 884
507 Ga0395905_0857353 3300037471 Bacteria 811
508 Ga0395905_0943082 3300037471 Bacteria 766
509 Ga0395905_1333259 3300037471 Unclassified 621
510 Ga0395905_1453428 3300037471 Bacteria 590
511 Ga0395901_0061898 3300038443 Bacteria 3894
512 Ga0395901_0081444 3300038443 Bacteria 3381
513 Ga0395901_0083868 3300038443 Bacteria 3331
514 Ga0395901_0254337 3300038443 Unclassified 1829
515 Ga0395901_0292388 3300038443 Bacteria 1690
516 Ga0395901_0306223 3300038443 Bacteria 1646
517 Ga0395901_0433692 3300038443 Bacteria 1346
518 Ga0395901_0536118 3300038443 Bacteria 1187
519 Ga0395901_0550252 3300038443 Bacteria 1169
520 Ga0395901_0644521 3300038443 Bacteria 1063
521 Ga0395901_0688108 3300038443 Bacteria 1022
522 Ga0395901_0700898 3300038443 Unclassified 1010
523 Ga0395901_0853239 3300038443 Bacteria 896
524 Ga0395901_0912553 3300038443 Bacteria 859
525 Ga0395901_1612133 3300038443 Bacteria 602
526 Ga0466969_0369411 3300044656 Unclassified 650
527 Ga0466969_0504522 3300044656 Unclassified 552
528 Ga0466965_0516906 3300044683 Bacteria 671
529 Ga0466966_0014341 3300044684 Bacteria 5246
530 Ga0466966_0017572 3300044684 Bacteria 4726
531 Ga0466966_0030506 3300044684 Bacteria 3501
532 Ga0466961_0071764 3300044693 Bacteria 2197
533 Ga0466961_0082654 3300044693 Bacteria 2031
534 Ga0466961_0801340 3300044693 Unclassified 562
535 Ga0466963_0031731 3300044694 Bacteria 3416
536 Ga0466963_0038523 3300044694 Bacteria 3126
537 Ga0466963_0392527 3300044694 Bacteria 978
538 Ga0466963_0395597 3300044694 Unclassified 974
539 Ga0466970_0051848 3300044765 Bacteria 2190
540 Ga0466957_0140557 3300044842 Bacteria 1555
541 Ga0466960_0182447 3300044901 Bacteria 1138
542 Ga0466959_0045158 3300045049 Bacteria 3245
543 Ga0466959_0046270 3300045049 Bacteria 3202
544 Ga0466959_0050742 3300045049 Bacteria 3045
545 Ga0466958_0101437 3300045836 Bacteria 1790
546 Ga0466967_0034537 3300045976 Bacteria 4293
547 Ga0466967_0079548 3300045976 Bacteria 2955
548 Ga0466967_0346499 3300045976 Bacteria 1437
549 Ga0495584_0629958 3300046491 Unclassified 547
550 Ga0495663_0122004 3300046525 Unclassified 873
551 Ga0495668_0029503 3300046616 Bacteria 3099
552 Ga0495668_0191277 3300046616 Bacteria 1121
553 Ga0495669_0064004 3300046684 Bacteria 1669
554 Ga0495669_0066943 3300046684 Bacteria 1632
555 Ga0495669_0193778 3300046684 Bacteria 970
556 Ga0495675_0404949 3300047444 Unclassified 795
557 Ga0495677_0135505 3300047445 Bacteria 944
558 Ga0495602_0027889 3300048088 Bacteria 5416
559 Ga0496100_0440206 3300048903 Bacteria 998
560 Ga0496100_0443865 3300048903 Bacteria 994
561 Ga0496101_0694136 3300048904 Unclassified 804
562 Ga0496102_0098876 3300048905 Bacteria 2708
563 Ga0496102_0907707 3300048905 Bacteria 802
564 Ga0496103_0078588 3300048906 Bacteria 2072
565 Ga0496103_0159661 3300048906 Bacteria 1446
566 Ga0496104_0258782 3300048907 Bacteria 1653
567 Ga0496104_0776563 3300048907 Bacteria 865
568 Ga0496104_1677492 3300048907 Unclassified 538
569 Ga0496105_0125657 3300048908 Bacteria 2114
570 Ga0496106_0008916 3300048909 Bacteria 7416
571 Ga0496107_0104909 3300048910 Bacteria 2074
572 Ga0496107_0185793 3300048910 Bacteria 1544
573 Ga0496107_1002359 3300048910 Bacteria 606
574 Ga0496108_0001167 3300048911 Bacteria 20498
575 Ga0496108_0199654 3300048911 Bacteria 1735
576 Ga0496108_0939167 3300048911 Bacteria 741
577 Ga0496109_0010591 3300048912 Bacteria 7886
578 Ga0496109_0031388 3300048912 Bacteria 4767
579 Ga0496109_1551043 3300048912 Unclassified 597
580 Ga0496110_0085533 3300048913 Bacteria 2814
581 Ga0496110_0117747 3300048913 Bacteria 2392
582 Ga0496110_0873301 3300048913 Unclassified 805
583 Ga0496111_0003733 3300048914 Bacteria 9482
584 Ga0496111_0004258 3300048914 Bacteria 9018
585 Ga0496111_0297046 3300048914 Bacteria 1197
586 Ga0496112_0012510 3300048915 Bacteria 7798
587 Ga0496112_0025540 3300048915 Bacteria 5672
588 Ga0496112_0028158 3300048915 Bacteria 5421
589 Ga0496112_0155086 3300048915 Bacteria 2257
590 Ga0496112_0201849 3300048915 Bacteria 1947
591 Ga0496113_0015303 3300048916 Bacteria 5268
592 Ga0496113_0787893 3300048916 Bacteria 756
593 Ga0496114_0058308 3300048917 Bacteria 3224
594 Ga0496115_0047536 3300048918 Bacteria 3431
595 Ga0501070_1147854 3300049586 Bacteria 598
596 Ga0587073_0091576 3300059492 Unclassified 774
597 Ga0466962_0141200 3300061719 Bacteria 1167
598 Ga0530510_1251667 3300061734 Bacteria 569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10105094 Ga0070658_101050945 94
2 3300005339 Ga0070660_101449531 Ga0070660_1014495312 94
3 3300005455 Ga0070663_100082579 Ga0070663_1000825794 94
4 3300005577 Ga0068857_100289642 Ga0068857_1002896423 94
5 3300013307 Ga0157372_13369572 Ga0157372_133695721 97
6 3300049586 Ga0501070_1147854 Ga0501070_1147854_101_442 97
7 3300038443 Ga0395901_1612133 Ga0395901_1612133_13_321 100
8 3300005329 Ga0070683_101626675 Ga0070683_1016266751 101
9 3300005344 Ga0070661_100054103 Ga0070661_1000541036 102
10 3300005564 Ga0070664_100021333 Ga0070664_1000213334 102
11 3300025945 Ga0207679_10141460 Ga0207679_101414603 102
12 3300048915 Ga0496112_0155086 Ga0496112_0155086_26_340 102
13 3300014969 Ga0157376_10225552 Ga0157376_102255523 104
14 3300028379 Ga0268266_10279807 Ga0268266_102798072 104
15 3300005530 Ga0070679_100542212 Ga0070679_1005422122 105
16 3300025921 Ga0207652_10526317 Ga0207652_105263171 105
17 3300031824 Ga0307413_10204662 Ga0307413_102046623 105
18 3300031852 Ga0307410_10025668 Ga0307410_100256684 105
19 3300031901 Ga0307406_10045616 Ga0307406_100456164 105
20 3300031903 Ga0307407_10140119 Ga0307407_101401193 105
21 3300031911 Ga0307412_10877884 Ga0307412_108778842 105
22 3300031995 Ga0307409_100341413 Ga0307409_1003414133 105
23 3300032004 Ga0307414_10170791 Ga0307414_101707913 105
24 3300032005 Ga0307411_10039228 Ga0307411_100392283 105
25 3300032126 Ga0307415_100128568 Ga0307415_1001285684 105
26 3300005328 Ga0070676_10006095 Ga0070676_100060953 106
27 3300005333 Ga0070677_10335555 Ga0070677_103355551 106
28 3300005334 Ga0068869_100038985 Ga0068869_1000389855 106
29 3300005340 Ga0070689_100811878 Ga0070689_1008118781 106
30 3300005347 Ga0070668_100002885 Ga0070668_10000288511 106
31 3300005355 Ga0070671_100741270 Ga0070671_1007412702 106
32 3300005356 Ga0070674_100174267 Ga0070674_1001742673 106
33 3300005364 Ga0070673_100140358 Ga0070673_1001403583 106
34 3300005364 Ga0070673_101761435 Ga0070673_1017614352 106
35 3300005456 Ga0070678_100468433 Ga0070678_1004684332 106
36 3300005459 Ga0068867_100052204 Ga0068867_1000522043 106
37 3300005543 Ga0070672_100036975 Ga0070672_1000369754 106
38 3300005547 Ga0070693_100135056 Ga0070693_1001350562 106
39 3300005548 Ga0070665_100031834 Ga0070665_1000318345 106
40 3300005617 Ga0068859_100020350 Ga0068859_1000203503 106
41 3300005718 Ga0068866_10130748 Ga0068866_101307483 106
42 3300005840 Ga0068870_10046369 Ga0068870_100463694 106
43 3300005841 Ga0068863_100979529 Ga0068863_1009795292 106
44 3300005844 Ga0068862_100623825 Ga0068862_1006238252 106
45 3300006237 Ga0097621_100518651 Ga0097621_1005186512 106
46 3300006358 Ga0068871_101141597 Ga0068871_1011415971 106
47 3300006881 Ga0068865_100555710 Ga0068865_1005557103 106
48 3300006931 Ga0097620_100020349 Ga0097620_1000203493 106
49 3300009176 Ga0105242_12489722 Ga0105242_124897221 106
50 3300013297 Ga0157378_10641711 Ga0157378_106417111 106
51 3300013306 Ga0163162_12707160 Ga0163162_127071601 106
52 3300025315 Ga0207697_10077675 Ga0207697_100776752 106
53 3300025901 Ga0207688_10050036 Ga0207688_100500363 106
54 3300025907 Ga0207645_10007154 Ga0207645_100071547 106
55 3300025908 Ga0207643_10031141 Ga0207643_100311415 106
56 3300025923 Ga0207681_10039278 Ga0207681_100392783 106
57 3300025937 Ga0207669_10342741 Ga0207669_103427412 106
58 3300025938 Ga0207704_10544617 Ga0207704_105446171 106
59 3300025940 Ga0207691_10103064 Ga0207691_101030644 106
60 3300025942 Ga0207689_10065498 Ga0207689_100654984 106
61 3300025942 Ga0207689_10595466 Ga0207689_105954661 106
62 3300025960 Ga0207651_10028011 Ga0207651_100280114 106
63 3300025972 Ga0207668_10000610 Ga0207668_1000061015 106
64 3300025981 Ga0207640_11823035 Ga0207640_118230351 106
65 3300025986 Ga0207658_10615517 Ga0207658_106155171 106
66 3300026089 Ga0207648_10071799 Ga0207648_100717993 106
67 3300026118 Ga0207675_100074914 Ga0207675_1000749144 106
68 3300026121 Ga0207683_10150581 Ga0207683_101505814 106
69 3300028379 Ga0268266_10026865 Ga0268266_100268656 106
70 3300028380 Ga0268265_10012360 Ga0268265_100123606 106
71 3300028381 Ga0268264_10633869 Ga0268264_106338692 106
72 3300031548 Ga0307408_100009381 Ga0307408_1000093813 106
73 3300031901 Ga0307406_10045392 Ga0307406_100453926 106
74 3300037418 Ga0395900_0047190 Ga0395900_0047190_369_701 106
75 3300037466 Ga0395898_0702791 Ga0395898_0702791_104_436 106
76 3300037471 Ga0395905_0009909 Ga0395905_0009909_3872_4204 106
77 3300037471 Ga0395905_0139287 Ga0395905_0139287_54_392 106
78 3300037471 Ga0395905_0857353 Ga0395905_0857353_475_798 106
79 3300005614 Ga0068856_100571685 Ga0068856_1005716852 107
80 3300044694 Ga0466963_0038523 Ga0466963_0038523_2084_2416 108
81 3300005339 Ga0070660_100158201 Ga0070660_1001582012 109
82 3300005366 Ga0070659_100225855 Ga0070659_1002258555 109
83 3300005458 Ga0070681_10038221 Ga0070681_100382213 109
84 3300005530 Ga0070679_100137597 Ga0070679_1001375976 109
85 3300005547 Ga0070693_100017098 Ga0070693_1000170983 109
86 3300013100 Ga0157373_10004225 Ga0157373_100042256 109
87 3300013104 Ga0157370_10024230 Ga0157370_100242303 109
88 3300013105 Ga0157369_10588773 Ga0157369_105887732 109
89 3300025920 Ga0207649_10032012 Ga0207649_100320126 109
90 3300048903 Ga0496100_0440206 Ga0496100_0440206_333_668 109
91 3300048905 Ga0496102_0098876 Ga0496102_0098876_1241_1576 109
92 3300048906 Ga0496103_0159661 Ga0496103_0159661_486_821 109
93 3300048907 Ga0496104_1677492 Ga0496104_1677492_42_377 109
94 3300048913 Ga0496110_0873301 Ga0496110_0873301_102_437 109
95 3300048914 Ga0496111_0297046 Ga0496111_0297046_128_463 109
96 3300048915 Ga0496112_0012510 Ga0496112_0012510_2361_2696 109
97 3300003323 rootH1_10046825 rootH1_100468252 110
98 3300005564 Ga0070664_101356782 Ga0070664_1013567822 110
99 3300006237 Ga0097621_100044460 Ga0097621_1000444603 110
100 3300006358 Ga0068871_100011911 Ga0068871_1000119113 110
101 3300009177 Ga0105248_10254830 Ga0105248_102548302 110
102 3300025931 Ga0207644_10343075 Ga0207644_103430751 110
103 3300025941 Ga0207711_10338676 Ga0207711_103386762 110
104 3300031731 Ga0307405_10790090 Ga0307405_107900902 110
105 3300031824 Ga0307413_11821245 Ga0307413_118212451 110
106 3300031852 Ga0307410_10363833 Ga0307410_103638332 110
107 3300031995 Ga0307409_100006396 Ga0307409_1000063968 110
108 3300032002 Ga0307416_100777825 Ga0307416_1007778252 110
109 3300037418 Ga0395900_0305536 Ga0395900_0305536_1004_1354 110
110 3300037418 Ga0395900_0437136 Ga0395900_0437136_602_940 110
111 3300037418 Ga0395900_0559056 Ga0395900_0559056_281_628 110
112 3300037418 Ga0395900_0749935 Ga0395900_0749935_254_604 110
113 3300037466 Ga0395898_0853866 Ga0395898_0853866_68_418 110
114 3300037471 Ga0395905_0019968 Ga0395905_0019968_5697_6047 110
115 3300037471 Ga0395905_0082702 Ga0395905_0082702_2217_2567 110
116 3300037471 Ga0395905_0140125 Ga0395905_0140125_1564_1914 110
117 3300037471 Ga0395905_0500778 Ga0395905_0500778_618_956 110
118 3300037471 Ga0395905_0742859 Ga0395905_0742859_268_606 110
119 3300037471 Ga0395905_1333259 Ga0395905_1333259_10_348 110
120 3300038443 Ga0395901_0292388 Ga0395901_0292388_178_528 110
121 3300038443 Ga0395901_0433692 Ga0395901_0433692_72_419 110
122 3300038443 Ga0395901_0644521 Ga0395901_0644521_694_1041 110
123 3300038443 Ga0395901_0912553 Ga0395901_0912553_236_586 110
124 3300044683 Ga0466965_0516906 Ga0466965_0516906_272_625 110
125 3300044842 Ga0466957_0140557 Ga0466957_0140557_921_1259 110
126 3300048911 Ga0496108_0939167 Ga0496108_0939167_185_535 110
127 3300048915 Ga0496112_0028158 Ga0496112_0028158_1100_1450 110
128 3300048916 Ga0496113_0787893 Ga0496113_0787893_205_555 110
129 3300061719 Ga0466962_0141200 Ga0466962_0141200_86_436 110
130 3300005327 Ga0070658_10011479 Ga0070658_100114793 111
131 3300005327 Ga0070658_10131206 Ga0070658_101312062 111
132 3300005328 Ga0070676_10020828 Ga0070676_100208287 111
133 3300005331 Ga0070670_100448384 Ga0070670_1004483843 111
134 3300005331 Ga0070670_100535250 Ga0070670_1005352501 111
135 3300005334 Ga0068869_100158502 Ga0068869_1001585022 111
136 3300005335 Ga0070666_10416248 Ga0070666_104162482 111
137 3300005337 Ga0070682_100301049 Ga0070682_1003010493 111
138 3300005338 Ga0068868_100248787 Ga0068868_1002487873 111
139 3300005339 Ga0070660_100431726 Ga0070660_1004317262 111
140 3300005344 Ga0070661_100077562 Ga0070661_1000775623 111
141 3300005344 Ga0070661_100206329 Ga0070661_1002063293 111
142 3300005344 Ga0070661_100752039 Ga0070661_1007520392 111
143 3300005345 Ga0070692_11077572 Ga0070692_110775721 111
144 3300005347 Ga0070668_100038698 Ga0070668_1000386983 111
145 3300005355 Ga0070671_100021979 Ga0070671_1000219794 111
146 3300005355 Ga0070671_100025268 Ga0070671_1000252687 111
147 3300005355 Ga0070671_100069229 Ga0070671_1000692296 111
148 3300005364 Ga0070673_100296893 Ga0070673_1002968932 111
149 3300005364 Ga0070673_100536262 Ga0070673_1005362622 111
150 3300005366 Ga0070659_100363391 Ga0070659_1003633913 111
151 3300005367 Ga0070667_100057107 Ga0070667_1000571073 111
152 3300005367 Ga0070667_100244397 Ga0070667_1002443974 111
153 3300005456 Ga0070678_102156415 Ga0070678_1021564151 111
154 3300005457 Ga0070662_100164105 Ga0070662_1001641053 111
155 3300005459 Ga0068867_100231959 Ga0068867_1002319593 111
156 3300005530 Ga0070679_100422933 Ga0070679_1004229332 111
157 3300005530 Ga0070679_100817588 Ga0070679_1008175882 111
158 3300005539 Ga0068853_102366817 Ga0068853_1023668171 111
159 3300005543 Ga0070672_100536056 Ga0070672_1005360562 111
160 3300005543 Ga0070672_101424316 Ga0070672_1014243162 111
161 3300005544 Ga0070686_100702108 Ga0070686_1007021082 111
162 3300005546 Ga0070696_100254288 Ga0070696_1002542883 111
163 3300005547 Ga0070693_100404387 Ga0070693_1004043872 111
164 3300005548 Ga0070665_100271570 Ga0070665_1002715702 111
165 3300005564 Ga0070664_100013494 Ga0070664_1000134944 111
166 3300005577 Ga0068857_100431390 Ga0068857_1004313902 111
167 3300005578 Ga0068854_100022213 Ga0068854_1000222137 111
168 3300005614 Ga0068856_100125416 Ga0068856_1001254164 111
169 3300005614 Ga0068856_100667865 Ga0068856_1006678652 111
170 3300005615 Ga0070702_100207006 Ga0070702_1002070062 111
171 3300005616 Ga0068852_100070701 Ga0068852_1000707018 111
172 3300005618 Ga0068864_100015503 Ga0068864_1000155036 111
173 3300005618 Ga0068864_101342296 Ga0068864_1013422962 111
174 3300005719 Ga0068861_101260795 Ga0068861_1012607952 111
175 3300005834 Ga0068851_10017478 Ga0068851_100174783 111
176 3300005834 Ga0068851_10034050 Ga0068851_100340506 111
177 3300005844 Ga0068862_100196674 Ga0068862_1001966744 111
178 3300006358 Ga0068871_100362997 Ga0068871_1003629972 111
179 3300009553 Ga0105249_10058355 Ga0105249_100583552 111
180 3300013100 Ga0157373_10906005 Ga0157373_109060051 111
181 3300013102 Ga0157371_11050271 Ga0157371_110502712 111
182 3300013105 Ga0157369_10669928 Ga0157369_106699281 111
183 3300013296 Ga0157374_10227396 Ga0157374_102273962 111
184 3300013296 Ga0157374_10232290 Ga0157374_102322903 111
185 3300013307 Ga0157372_10396768 Ga0157372_103967681 111
186 3300025321 Ga0207656_10023804 Ga0207656_100238043 111
187 3300025903 Ga0207680_10669736 Ga0207680_106697362 111
188 3300025904 Ga0207647_10155821 Ga0207647_101558214 111
189 3300025907 Ga0207645_10038322 Ga0207645_100383223 111
190 3300025909 Ga0207705_10040220 Ga0207705_100402204 111
191 3300025909 Ga0207705_10214224 Ga0207705_102142244 111
192 3300025909 Ga0207705_10336644 Ga0207705_103366442 111
193 3300025912 Ga0207707_10951573 Ga0207707_109515731 111
194 3300025919 Ga0207657_10058035 Ga0207657_100580352 111
195 3300025919 Ga0207657_11368546 Ga0207657_113685461 111
196 3300025920 Ga0207649_10074659 Ga0207649_100746593 111
197 3300025920 Ga0207649_10469934 Ga0207649_104699342 111
198 3300025921 Ga0207652_10334786 Ga0207652_103347863 111
199 3300025921 Ga0207652_10905227 Ga0207652_109052272 111
200 3300025925 Ga0207650_10155111 Ga0207650_101551114 111
201 3300025931 Ga0207644_10027403 Ga0207644_100274031 111
202 3300025931 Ga0207644_10742397 Ga0207644_107423972 111
203 3300025932 Ga0207690_10457910 Ga0207690_104579102 111
204 3300025933 Ga0207706_10050362 Ga0207706_100503627 111
205 3300025933 Ga0207706_11365858 Ga0207706_113658581 111
206 3300025940 Ga0207691_10414698 Ga0207691_104146982 111
207 3300025940 Ga0207691_10501231 Ga0207691_105012311 111
208 3300025945 Ga0207679_10016090 Ga0207679_100160904 111
209 3300025945 Ga0207679_10525180 Ga0207679_105251803 111
210 3300025972 Ga0207668_10063351 Ga0207668_100633512 111
211 3300025972 Ga0207668_12152770 Ga0207668_121527701 111
212 3300025981 Ga0207640_11076922 Ga0207640_110769221 111
213 3300025986 Ga0207658_10030462 Ga0207658_100304623 111
214 3300026041 Ga0207639_10373231 Ga0207639_103732312 111
215 3300026067 Ga0207678_10032598 Ga0207678_100325987 111
216 3300026078 Ga0207702_10103553 Ga0207702_101035532 111
217 3300026089 Ga0207648_10049455 Ga0207648_100494554 111
218 3300026095 Ga0207676_10056428 Ga0207676_100564284 111
219 3300026116 Ga0207674_10102891 Ga0207674_101028913 111
220 3300026116 Ga0207674_10328278 Ga0207674_103282782 111
221 3300026118 Ga0207675_100922068 Ga0207675_1009220681 111
222 3300026142 Ga0207698_10432094 Ga0207698_104320942 111
223 3300026142 Ga0207698_12224256 Ga0207698_122242561 111
224 3300028379 Ga0268266_10794200 Ga0268266_107942001 111
225 3300028380 Ga0268265_10609447 Ga0268265_106094472 111
226 3300031852 Ga0307410_10028591 Ga0307410_100285914 111
227 3300031995 Ga0307409_100088176 Ga0307409_1000881763 111
228 3300037418 Ga0395900_0013430 Ga0395900_0013430_2328_2663 111
229 3300037418 Ga0395900_0043473 Ga0395900_0043473_279_620 111
230 3300037418 Ga0395900_0375428 Ga0395900_0375428_665_1006 111
231 3300037418 Ga0395900_0710842 Ga0395900_0710842_563_898 111
232 3300037466 Ga0395898_0200048 Ga0395898_0200048_1357_1692 111
233 3300037471 Ga0395905_0078376 Ga0395905_0078376_49_390 111
234 3300037471 Ga0395905_0088817 Ga0395905_0088817_760_1095 111
235 3300037471 Ga0395905_0298888 Ga0395905_0298888_530_871 111
236 3300037471 Ga0395905_1453428 Ga0395905_1453428_97_438 111
237 3300038443 Ga0395901_0081444 Ga0395901_0081444_2631_2966 111
238 3300038443 Ga0395901_0700898 Ga0395901_0700898_167_508 111
239 3300044656 Ga0466969_0504522 Ga0466969_0504522_199_537 111
240 3300044684 Ga0466966_0030506 Ga0466966_0030506_1925_2263 111
241 3300044693 Ga0466961_0082654 Ga0466961_0082654_1269_1607 111
242 3300045049 Ga0466959_0045158 Ga0466959_0045158_1713_2051 111
243 3300046616 Ga0495668_0029503 Ga0495668_0029503_1590_1943 111
244 3300046684 Ga0495669_0064004 Ga0495669_0064004_785_1120 111
245 3300046684 Ga0495669_0193778 Ga0495669_0193778_339_680 111
246 3300048904 Ga0496101_0694136 Ga0496101_0694136_151_492 111
247 3300048907 Ga0496104_0776563 Ga0496104_0776563_292_633 111
248 3300048910 Ga0496107_0185793 Ga0496107_0185793_1017_1358 111
249 3300048910 Ga0496107_1002359 Ga0496107_1002359_230_565 111
250 3300048911 Ga0496108_0199654 Ga0496108_0199654_1008_1349 111
251 3300048912 Ga0496109_0031388 Ga0496109_0031388_809_1150 111
252 3300048912 Ga0496109_1551043 Ga0496109_1551043_175_528 111
253 3300048913 Ga0496110_0117747 Ga0496110_0117747_1198_1539 111
254 3300048914 Ga0496111_0004258 Ga0496111_0004258_5005_5346 111
255 3300048915 Ga0496112_0201849 Ga0496112_0201849_1064_1405 111
256 3300048916 Ga0496113_0015303 Ga0496113_0015303_4872_5213 111
257 3300048917 Ga0496114_0058308 Ga0496114_0058308_2082_2423 111
258 3300048918 Ga0496115_0047536 Ga0496115_0047536_2998_3339 111
259 3300005290 Ga0065712_10117247 Ga0065712_101172472 112
260 3300005327 Ga0070658_10408624 Ga0070658_104086242 112
261 3300005329 Ga0070683_100007324 Ga0070683_1000073243 112
262 3300005329 Ga0070683_100502235 Ga0070683_1005022351 112
263 3300005334 Ga0068869_100268503 Ga0068869_1002685033 112
264 3300005336 Ga0070680_100000949 Ga0070680_10000094914 112
265 3300005336 Ga0070680_100003333 Ga0070680_1000033339 112
266 3300005336 Ga0070680_100067464 Ga0070680_1000674643 112
267 3300005336 Ga0070680_100096040 Ga0070680_1000960403 112
268 3300005336 Ga0070680_100146829 Ga0070680_1001468293 112
269 3300005337 Ga0070682_101186002 Ga0070682_1011860022 112
270 3300005339 Ga0070660_100067266 Ga0070660_1000672667 112
271 3300005339 Ga0070660_100450873 Ga0070660_1004508732 112
272 3300005341 Ga0070691_10402856 Ga0070691_104028562 112
273 3300005345 Ga0070692_10016712 Ga0070692_100167125 112
274 3300005345 Ga0070692_10073536 Ga0070692_100735363 112
275 3300005345 Ga0070692_10085163 Ga0070692_100851634 112
276 3300005353 Ga0070669_101912144 Ga0070669_1019121441 112
277 3300005355 Ga0070671_100017905 Ga0070671_1000179057 112
278 3300005366 Ga0070659_100020141 Ga0070659_1000201414 112
279 3300005366 Ga0070659_100322285 Ga0070659_1003222852 112
280 3300005366 Ga0070659_101400549 Ga0070659_1014005491 112
281 3300005367 Ga0070667_100051050 Ga0070667_1000510504 112
282 3300005435 Ga0070714_100032130 Ga0070714_1000321305 112
283 3300005435 Ga0070714_100273561 Ga0070714_1002735612 112
284 3300005435 Ga0070714_100773482 Ga0070714_1007734822 112
285 3300005435 Ga0070714_100788668 Ga0070714_1007886682 112
286 3300005436 Ga0070713_101354120 Ga0070713_1013541201 112
287 3300005455 Ga0070663_100121184 Ga0070663_1001211842 112
288 3300005455 Ga0070663_100417742 Ga0070663_1004177423 112
289 3300005457 Ga0070662_100032110 Ga0070662_1000321107 112
290 3300005458 Ga0070681_10062316 Ga0070681_100623164 112
291 3300005467 Ga0070706_101676158 Ga0070706_1016761581 112
292 3300005530 Ga0070679_100046021 Ga0070679_1000460215 112
293 3300005530 Ga0070679_100415477 Ga0070679_1004154772 112
294 3300005535 Ga0070684_100002908 Ga0070684_1000029083 112
295 3300005539 Ga0068853_100871950 Ga0068853_1008719502 112
296 3300005546 Ga0070696_100265131 Ga0070696_1002651312 112
297 3300005547 Ga0070693_100040989 Ga0070693_1000409895 112
298 3300005563 Ga0068855_100035866 Ga0068855_1000358667 112
299 3300005563 Ga0068855_100061726 Ga0068855_1000617264 112
300 3300005563 Ga0068855_100131289 Ga0068855_1001312895 112
301 3300005563 Ga0068855_100184946 Ga0068855_1001849463 112
302 3300005563 Ga0068855_100241658 Ga0068855_1002416583 112
303 3300005563 Ga0068855_101550478 Ga0068855_1015504781 112
304 3300005563 Ga0068855_101686678 Ga0068855_1016866782 112
305 3300005564 Ga0070664_100121298 Ga0070664_1001212984 112
306 3300005577 Ga0068857_100012761 Ga0068857_1000127619 112
307 3300005577 Ga0068857_100030244 Ga0068857_1000302446 112
308 3300005577 Ga0068857_100539462 Ga0068857_1005394623 112
309 3300005577 Ga0068857_101270250 Ga0068857_1012702502 112
310 3300005614 Ga0068856_100056122 Ga0068856_1000561221 112
311 3300005614 Ga0068856_100112010 Ga0068856_1001120106 112
312 3300005614 Ga0068856_100170768 Ga0068856_1001707681 112
313 3300005614 Ga0068856_100231203 Ga0068856_1002312033 112
314 3300005614 Ga0068856_100291769 Ga0068856_1002917691 112
315 3300005614 Ga0068856_100432367 Ga0068856_1004323672 112
316 3300005616 Ga0068852_100005692 Ga0068852_1000056925 112
317 3300005616 Ga0068852_100031780 Ga0068852_1000317804 112
318 3300005616 Ga0068852_100778676 Ga0068852_1007786763 112
319 3300005617 Ga0068859_100009099 Ga0068859_1000090999 112
320 3300005618 Ga0068864_100025133 Ga0068864_1000251331 112
321 3300005834 Ga0068851_10605533 Ga0068851_106055331 112
322 3300005841 Ga0068863_100001823 Ga0068863_10000182319 112
323 3300005842 Ga0068858_100056661 Ga0068858_1000566614 112
324 3300006237 Ga0097621_100132636 Ga0097621_1001326363 112
325 3300006358 Ga0068871_100019581 Ga0068871_1000195816 112
326 3300006871 Ga0075434_100534016 Ga0075434_1005340163 112
327 3300006931 Ga0097620_100009099 Ga0097620_1000090997 112
328 3300009093 Ga0105240_10029334 Ga0105240_100293346 112
329 3300009093 Ga0105240_10085079 Ga0105240_100850797 112
330 3300009093 Ga0105240_12136391 Ga0105240_121363912 112
331 3300009174 Ga0105241_10909418 Ga0105241_109094182 112
332 3300009177 Ga0105248_10448211 Ga0105248_104482112 112
333 3300009545 Ga0105237_10160258 Ga0105237_101602586 112
334 3300010375 Ga0105239_10402987 Ga0105239_104029872 112
335 3300011119 Ga0105246_10234075 Ga0105246_102340752 112
336 3300013100 Ga0157373_10026842 Ga0157373_100268424 112
337 3300013100 Ga0157373_10227075 Ga0157373_102270754 112
338 3300013100 Ga0157373_10242016 Ga0157373_102420162 112
339 3300013100 Ga0157373_10353787 Ga0157373_103537871 112
340 3300013102 Ga0157371_10004463 Ga0157371_100044639 112
341 3300013102 Ga0157371_10074720 Ga0157371_100747205 112
342 3300013102 Ga0157371_10220391 Ga0157371_102203913 112
343 3300013102 Ga0157371_11027247 Ga0157371_110272471 112
344 3300013104 Ga0157370_10076923 Ga0157370_100769233 112
345 3300013104 Ga0157370_10078132 Ga0157370_100781325 112
346 3300013104 Ga0157370_10131157 Ga0157370_101311571 112
347 3300013104 Ga0157370_10928008 Ga0157370_109280082 112
348 3300013105 Ga0157369_10014658 Ga0157369_1001465810 112
349 3300013105 Ga0157369_10051881 Ga0157369_100518814 112
350 3300013105 Ga0157369_10119758 Ga0157369_101197585 112
351 3300013105 Ga0157369_10140705 Ga0157369_101407054 112
352 3300013105 Ga0157369_10643443 Ga0157369_106434433 112
353 3300013105 Ga0157369_12453172 Ga0157369_124531722 112
354 3300013296 Ga0157374_10548198 Ga0157374_105481982 112
355 3300013307 Ga0157372_10140839 Ga0157372_101408392 112
356 3300013307 Ga0157372_10307564 Ga0157372_103075645 112
357 3300013307 Ga0157372_10360145 Ga0157372_103601452 112
358 3300013307 Ga0157372_10816266 Ga0157372_108162662 112
359 3300013307 Ga0157372_11395098 Ga0157372_113950981 112
360 3300014325 Ga0163163_10368326 Ga0163163_103683262 112
361 3300014497 Ga0182008_10183488 Ga0182008_101834882 112
362 3300014968 Ga0157379_10016410 Ga0157379_100164102 112
363 3300020069 Ga0197907_10880863 Ga0197907_108808634 112
364 3300020070 Ga0206356_10074930 Ga0206356_100749302 112
365 3300020070 Ga0206356_10442977 Ga0206356_104429771 112
366 3300020070 Ga0206356_11429053 Ga0206356_114290531 112
367 3300020081 Ga0206354_10572344 Ga0206354_105723442 112
368 3300020081 Ga0206354_11234450 Ga0206354_112344503 112
369 3300020082 Ga0206353_10400680 Ga0206353_104006804 112
370 3300020082 Ga0206353_10819729 Ga0206353_108197295 112
371 3300020082 Ga0206353_11156649 Ga0206353_111566492 112
372 3300022467 Ga0224712_10189689 Ga0224712_101896892 112
373 3300025904 Ga0207647_10012436 Ga0207647_100124363 112
374 3300025904 Ga0207647_10122538 Ga0207647_101225383 112
375 3300025909 Ga0207705_10348029 Ga0207705_103480292 112
376 3300025909 Ga0207705_10352951 Ga0207705_103529513 112
377 3300025911 Ga0207654_10290485 Ga0207654_102904852 112
378 3300025912 Ga0207707_10126358 Ga0207707_101263583 112
379 3300025913 Ga0207695_10363919 Ga0207695_103639193 112
380 3300025913 Ga0207695_10490288 Ga0207695_104902883 112
381 3300025914 Ga0207671_10276166 Ga0207671_102761663 112
382 3300025917 Ga0207660_10000622 Ga0207660_100006229 112
383 3300025917 Ga0207660_10002987 Ga0207660_100029875 112
384 3300025917 Ga0207660_10024479 Ga0207660_100244793 112
385 3300025917 Ga0207660_10359371 Ga0207660_103593711 112
386 3300025917 Ga0207660_10916118 Ga0207660_109161182 112
387 3300025919 Ga0207657_10012889 Ga0207657_100128895 112
388 3300025921 Ga0207652_10074636 Ga0207652_100746364 112
389 3300025921 Ga0207652_10239392 Ga0207652_102393923 112
390 3300025921 Ga0207652_10327154 Ga0207652_103271544 112
391 3300025923 Ga0207681_10842074 Ga0207681_108420741 112
392 3300025925 Ga0207650_10584038 Ga0207650_105840382 112
393 3300025928 Ga0207700_10822706 Ga0207700_108227061 112
394 3300025929 Ga0207664_10130267 Ga0207664_101302671 112
395 3300025929 Ga0207664_10497144 Ga0207664_104971442 112
396 3300025931 Ga0207644_10026343 Ga0207644_100263433 112
397 3300025932 Ga0207690_10030418 Ga0207690_100304185 112
398 3300025932 Ga0207690_10149475 Ga0207690_101494753 112
399 3300025932 Ga0207690_10491332 Ga0207690_104913321 112
400 3300025933 Ga0207706_10034355 Ga0207706_100343557 112
401 3300025942 Ga0207689_10511732 Ga0207689_105117323 112
402 3300025944 Ga0207661_10660041 Ga0207661_106600411 112
403 3300025945 Ga0207679_10022123 Ga0207679_100221233 112
404 3300025949 Ga0207667_10025662 Ga0207667_100256625 112
405 3300025949 Ga0207667_10049052 Ga0207667_100490526 112
406 3300025949 Ga0207667_10128071 Ga0207667_101280713 112
407 3300025949 Ga0207667_10133735 Ga0207667_101337352 112
408 3300025949 Ga0207667_10157366 Ga0207667_101573663 112
409 3300025981 Ga0207640_10174742 Ga0207640_101747422 112
410 3300025986 Ga0207658_10059665 Ga0207658_100596653 112
411 3300026035 Ga0207703_10819373 Ga0207703_108193732 112
412 3300026041 Ga0207639_11636546 Ga0207639_116365462 112
413 3300026041 Ga0207639_11845499 Ga0207639_118454991 112
414 3300026067 Ga0207678_10164388 Ga0207678_101643882 112
415 3300026067 Ga0207678_10225451 Ga0207678_102254514 112
416 3300026078 Ga0207702_10150793 Ga0207702_101507935 112
417 3300026078 Ga0207702_10626244 Ga0207702_106262442 112
418 3300026078 Ga0207702_10641307 Ga0207702_106413072 112
419 3300026078 Ga0207702_11123577 Ga0207702_111235771 112
420 3300026078 Ga0207702_11313157 Ga0207702_113131571 112
421 3300026088 Ga0207641_10008053 Ga0207641_100080534 112
422 3300026095 Ga0207676_10060447 Ga0207676_100604474 112
423 3300026116 Ga0207674_10002193 Ga0207674_1000219310 112
424 3300026116 Ga0207674_10018921 Ga0207674_100189219 112
425 3300026116 Ga0207674_10520676 Ga0207674_105206762 112
426 3300026142 Ga0207698_10009736 Ga0207698_100097364 112
427 3300026142 Ga0207698_10034836 Ga0207698_100348366 112
428 3300026142 Ga0207698_10051147 Ga0207698_100511473 112
429 3300026142 Ga0207698_10960267 Ga0207698_109602672 112
430 3300028379 Ga0268266_11231896 Ga0268266_112318961 112
431 3300031731 Ga0307405_10853986 Ga0307405_108539862 112
432 3300031852 Ga0307410_10206301 Ga0307410_102063013 112
433 3300031901 Ga0307406_10814692 Ga0307406_108146922 112
434 3300031903 Ga0307407_10057443 Ga0307407_100574433 112
435 3300031995 Ga0307409_100021628 Ga0307409_1000216281 112
436 3300032004 Ga0307414_10259852 Ga0307414_102598523 112
437 3300032004 Ga0307414_11789667 Ga0307414_117896671 112
438 3300032005 Ga0307411_10022370 Ga0307411_100223706 112
439 3300032005 Ga0307411_10069882 Ga0307411_100698823 112
440 3300032005 Ga0307411_10918220 Ga0307411_109182202 112
441 3300032126 Ga0307415_100372833 Ga0307415_1003728332 112
442 3300035111 Ga0373923_0007699 Ga0373923_0007699_1281_1622 112
443 3300035118 Ga0373954_0017102 Ga0373954_0017102_1981_2322 112
444 3300035119 Ga0373956_0572037 Ga0373956_0572037_45_386 112
445 3300035172 Ga0373955_0003964 Ga0373955_0003964_5723_6064 112
446 3300036401 Ga0373937_0177188 Ga0373937_0177188_249_590 112
447 3300037312 Ga0395899_0040173 Ga0395899_0040173_2367_2717 112
448 3300037312 Ga0395899_0102397 Ga0395899_0102397_351_701 112
449 3300037312 Ga0395899_0121709 Ga0395899_0121709_1157_1507 112
450 3300037312 Ga0395899_0978286 Ga0395899_0978286_42_392 112
451 3300037418 Ga0395900_0034591 Ga0395900_0034591_1148_1498 112
452 3300037418 Ga0395900_0067325 Ga0395900_0067325_1609_1959 112
453 3300037418 Ga0395900_0111452 Ga0395900_0111452_1016_1366 112
454 3300037418 Ga0395900_0112921 Ga0395900_0112921_1616_1966 112
455 3300037418 Ga0395900_0113558 Ga0395900_0113558_1255_1605 112
456 3300037418 Ga0395900_0787927 Ga0395900_0787927_473_823 112
457 3300037418 Ga0395900_0909009 Ga0395900_0909009_33_389 112
458 3300037466 Ga0395898_0203496 Ga0395898_0203496_1141_1494 112
459 3300037466 Ga0395898_0279128 Ga0395898_0279128_271_621 112
460 3300037466 Ga0395898_0511097 Ga0395898_0511097_713_1063 112
461 3300037466 Ga0395898_0772187 Ga0395898_0772187_83_433 112
462 3300037466 Ga0395898_1011973 Ga0395898_1011973_72_422 112
463 3300037471 Ga0395905_0048156 Ga0395905_0048156_3381_3731 112
464 3300037471 Ga0395905_0063892 Ga0395905_0063892_270_620 112
465 3300037471 Ga0395905_0122668 Ga0395905_0122668_1168_1524 112
466 3300037471 Ga0395905_0161298 Ga0395905_0161298_137_487 112
467 3300037471 Ga0395905_0250203 Ga0395905_0250203_1268_1621 112
468 3300037471 Ga0395905_0329314 Ga0395905_0329314_412_762 112
469 3300037471 Ga0395905_0448702 Ga0395905_0448702_638_988 112
470 3300037471 Ga0395905_0450864 Ga0395905_0450864_11_361 112
471 3300037471 Ga0395905_0499716 Ga0395905_0499716_736_1086 112
472 3300037471 Ga0395905_0529913 Ga0395905_0529913_310_663 112
473 3300037471 Ga0395905_0535081 Ga0395905_0535081_17_370 112
474 3300037471 Ga0395905_0943082 Ga0395905_0943082_288_638 112
475 3300038443 Ga0395901_0061898 Ga0395901_0061898_2505_2855 112
476 3300038443 Ga0395901_0083868 Ga0395901_0083868_1070_1420 112
477 3300038443 Ga0395901_0254337 Ga0395901_0254337_1016_1366 112
478 3300038443 Ga0395901_0306223 Ga0395901_0306223_990_1340 112
479 3300038443 Ga0395901_0536118 Ga0395901_0536118_265_618 112
480 3300038443 Ga0395901_0550252 Ga0395901_0550252_362_712 112
481 3300038443 Ga0395901_0688108 Ga0395901_0688108_24_374 112
482 3300038443 Ga0395901_0853239 Ga0395901_0853239_41_391 112
483 3300044656 Ga0466969_0369411 Ga0466969_0369411_94_444 112
484 3300044684 Ga0466966_0014341 Ga0466966_0014341_1542_1892 112
485 3300044684 Ga0466966_0017572 Ga0466966_0017572_4105_4455 112
486 3300044693 Ga0466961_0071764 Ga0466961_0071764_1382_1732 112
487 3300044693 Ga0466961_0801340 Ga0466961_0801340_155_505 112
488 3300044694 Ga0466963_0031731 Ga0466963_0031731_1543_1896 112
489 3300044694 Ga0466963_0392527 Ga0466963_0392527_294_632 112
490 3300044694 Ga0466963_0395597 Ga0466963_0395597_127_471 112
491 3300044765 Ga0466970_0051848 Ga0466970_0051848_1766_2116 112
492 3300044901 Ga0466960_0182447 Ga0466960_0182447_220_570 112
493 3300045049 Ga0466959_0046270 Ga0466959_0046270_744_1094 112
494 3300045049 Ga0466959_0050742 Ga0466959_0050742_1080_1430 112
495 3300045836 Ga0466958_0101437 Ga0466958_0101437_276_626 112
496 3300045976 Ga0466967_0034537 Ga0466967_0034537_2872_3210 112
497 3300045976 Ga0466967_0346499 Ga0466967_0346499_868_1206 112
498 3300046491 Ga0495584_0629958 Ga0495584_0629958_174_512 112
499 3300046525 Ga0495663_0122004 Ga0495663_0122004_171_509 112
500 3300046616 Ga0495668_0191277 Ga0495668_0191277_157_495 112
501 3300046684 Ga0495669_0066943 Ga0495669_0066943_1177_1515 112
502 3300047444 Ga0495675_0404949 Ga0495675_0404949_435_776 112
503 3300047445 Ga0495677_0135505 Ga0495677_0135505_346_684 112
504 3300048088 Ga0495602_0027889 Ga0495602_0027889_4716_5057 112
505 3300048903 Ga0496100_0443865 Ga0496100_0443865_341_691 112
506 3300048905 Ga0496102_0907707 Ga0496102_0907707_106_456 112
507 3300048906 Ga0496103_0078588 Ga0496103_0078588_837_1187 112
508 3300048907 Ga0496104_0258782 Ga0496104_0258782_452_802 112
509 3300048908 Ga0496105_0125657 Ga0496105_0125657_305_655 112
510 3300048909 Ga0496106_0008916 Ga0496106_0008916_367_717 112
511 3300048910 Ga0496107_0104909 Ga0496107_0104909_886_1236 112
512 3300048911 Ga0496108_0001167 Ga0496108_0001167_7182_7532 112
513 3300048912 Ga0496109_0010591 Ga0496109_0010591_6441_6791 112
514 3300048913 Ga0496110_0085533 Ga0496110_0085533_2085_2435 112
515 3300048914 Ga0496111_0003733 Ga0496111_0003733_6151_6501 112
516 3300048915 Ga0496112_0025540 Ga0496112_0025540_146_496 112
517 3300059492 Ga0587073_0091576 Ga0587073_0091576_139_489 112
518 3300061734 Ga0530510_1251667 Ga0530510_1251667_24_374 112
519 3300001915 JGI24741J21665_1007216 JGI24741J21665_10072163 113
520 3300001979 JGI24740J21852_10001231 JGI24740J21852_100012316 113
521 3300001989 JGI24739J22299_10005727 JGI24739J22299_100057276 113
522 3300001990 JGI24737J22298_10021697 JGI24737J22298_100216972 113
523 3300002067 JGI24735J21928_10008775 JGI24735J21928_100087757 113
524 3300005327 Ga0070658_10053423 Ga0070658_100534233 113
525 3300005329 Ga0070683_100094910 Ga0070683_1000949103 113
526 3300005329 Ga0070683_101925339 Ga0070683_1019253391 113
527 3300005336 Ga0070680_100010364 Ga0070680_1000103645 113
528 3300005336 Ga0070680_100065654 Ga0070680_1000656546 113
529 3300005337 Ga0070682_100049596 Ga0070682_1000495963 113
530 3300005339 Ga0070660_100191803 Ga0070660_1001918032 113
531 3300005344 Ga0070661_100013498 Ga0070661_1000134985 113
532 3300005344 Ga0070661_100117780 Ga0070661_1001177805 113
533 3300005345 Ga0070692_10404006 Ga0070692_104040061 113
534 3300005366 Ga0070659_100011702 Ga0070659_1000117025 113
535 3300005366 Ga0070659_100278807 Ga0070659_1002788073 113
536 3300005455 Ga0070663_100041297 Ga0070663_1000412976 113
537 3300005455 Ga0070663_100314404 Ga0070663_1003144043 113
538 3300005457 Ga0070662_100009290 Ga0070662_1000092906 113
539 3300005458 Ga0070681_10125312 Ga0070681_101253125 113
540 3300005458 Ga0070681_10128067 Ga0070681_101280674 113
541 3300005530 Ga0070679_100071466 Ga0070679_1000714663 113
542 3300005530 Ga0070679_100374568 Ga0070679_1003745683 113
543 3300005535 Ga0070684_100382198 Ga0070684_1003821983 113
544 3300005539 Ga0068853_100344343 Ga0068853_1003443432 113
545 3300005547 Ga0070693_100026295 Ga0070693_1000262954 113
546 3300005563 Ga0068855_100060775 Ga0068855_1000607752 113
547 3300005564 Ga0070664_100225338 Ga0070664_1002253384 113
548 3300005564 Ga0070664_100639941 Ga0070664_1006399412 113
549 3300005577 Ga0068857_100063999 Ga0068857_1000639994 113
550 3300005577 Ga0068857_100149899 Ga0068857_1001498996 113
551 3300005578 Ga0068854_100010744 Ga0068854_1000107446 113
552 3300005578 Ga0068854_100020503 Ga0068854_1000205038 113
553 3300005614 Ga0068856_100025471 Ga0068856_1000254715 113
554 3300005614 Ga0068856_102319905 Ga0068856_1023199052 113
555 3300005616 Ga0068852_101157837 Ga0068852_1011578371 113
556 3300005834 Ga0068851_10106175 Ga0068851_101061753 113
557 3300005834 Ga0068851_10121637 Ga0068851_101216371 113
558 3300013100 Ga0157373_10122351 Ga0157373_101223514 113
559 3300013102 Ga0157371_10037671 Ga0157371_100376712 113
560 3300013102 Ga0157371_11261495 Ga0157371_112614951 113
561 3300013105 Ga0157369_11324360 Ga0157369_113243602 113
562 3300013307 Ga0157372_10011298 Ga0157372_100112987 113
563 3300025321 Ga0207656_10103501 Ga0207656_101035012 113
564 3300025909 Ga0207705_10015545 Ga0207705_100155454 113
565 3300025909 Ga0207705_10087733 Ga0207705_100877334 113
566 3300025909 Ga0207705_10112102 Ga0207705_101121022 113
567 3300025912 Ga0207707_10004057 Ga0207707_1000405711 113
568 3300025912 Ga0207707_10027976 Ga0207707_100279768 113
569 3300025917 Ga0207660_10058400 Ga0207660_100584004 113
570 3300025917 Ga0207660_10278696 Ga0207660_102786962 113
571 3300025919 Ga0207657_10002388 Ga0207657_100023885 113
572 3300025919 Ga0207657_10007776 Ga0207657_100077764 113
573 3300025920 Ga0207649_10002366 Ga0207649_100023667 113
574 3300025920 Ga0207649_10101994 Ga0207649_101019942 113
575 3300025921 Ga0207652_10008999 Ga0207652_100089994 113
576 3300025921 Ga0207652_10106544 Ga0207652_101065444 113
577 3300025921 Ga0207652_10969690 Ga0207652_109696901 113
578 3300025932 Ga0207690_10001958 Ga0207690_1000195811 113
579 3300025932 Ga0207690_10016729 Ga0207690_100167291 113
580 3300025932 Ga0207690_10044034 Ga0207690_100440341 113
581 3300025933 Ga0207706_10001598 Ga0207706_1000159813 113
582 3300025944 Ga0207661_10134979 Ga0207661_101349795 113
583 3300025945 Ga0207679_10017478 Ga0207679_1001747810 113
584 3300025945 Ga0207679_10166134 Ga0207679_101661341 113
585 3300025949 Ga0207667_10218803 Ga0207667_102188035 113
586 3300025981 Ga0207640_10016828 Ga0207640_100168283 113
587 3300025981 Ga0207640_10074769 Ga0207640_100747692 113
588 3300026041 Ga0207639_10006163 Ga0207639_100061633 113
589 3300026041 Ga0207639_10960861 Ga0207639_109608612 113
590 3300026067 Ga0207678_10019720 Ga0207678_100197205 113
591 3300026067 Ga0207678_10334178 Ga0207678_103341781 113
592 3300026078 Ga0207702_10003225 Ga0207702_1000322513 113
593 3300026078 Ga0207702_11628594 Ga0207702_116285941 113
594 3300026116 Ga0207674_10004629 Ga0207674_1000462916 113
595 3300026116 Ga0207674_10079820 Ga0207674_100798205 113
596 3300026142 Ga0207698_11010144 Ga0207698_110101441 113
597 3300037466 Ga0395898_0107091 Ga0395898_0107091_2093_2446 113
598 3300045976 Ga0466967_0079548 Ga0466967_0079548_2241_2591 113

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hcz-assembly1.cif.gz_X crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize 0.6661 35 96
4s3q-assembly1.cif.gz_A amylomaltase malq from escherichia coli in complex with maltose 0.646 24 85
2mca-assembly1.cif.gz_A nmr structure of the protein yp_002937094.1 from eubacterium rectale 0.6428 15 113
2mca-assembly1.cif.gz_A nmr structure of the protein yp_002937094.1 from eubacterium rectale 0.6116 15 113
1whp-assembly1.cif.gz_A allergen phl p 2 0.6051 23 93
ID Description Score Start End Superfamily
af_Q8WZ42_28387_28483_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6555 38 93 2.60.40.10
af_Q9U308_313_421_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6538 38 92 2.60.40.10
af_K7WCA0_176_274_2.60.40.760 Mainly Beta;Sandwich;Immunoglobulin-like;Expansin, cellulose-binding-like domain 0.653 34 85 2.60.40.760
af_A0A1D6KX41_173_268_2.60.40.760 Mainly Beta;Sandwich;Immunoglobulin-like;Expansin, cellulose-binding-like domain 0.6497 32 96 2.60.40.760
af_Q54C80_134_485_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6439 22 95 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A839YZS5-F1-model_v4 Uncharacterized protein 0.9397 15 112
AF-A0A839YZS5-F1-model_v4 Uncharacterized protein 0.9214 15 112
AF-A0A7H0GDD9-F1-model_v4 deleted 0.8659 1 112
AF-A0A7H0GDD9-F1-model_v4 deleted 0.8512 1 112
AF-A0A6G7YMJ7-F1-model_v4 Uncharacterized protein 0.8495 1 112

Feature Viewer

pLDDT pTM Quality
89.1 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map