F467721

General Info

Members Datasets Scaffolds Average Seq Length
597 247 595 561

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0002710|Ga0500641_0002710_45_1976
Length 636
Sequence MCRDRTAVEFPLHFASGLSSRVHWREGRPVFISISESFLISGANMGRSSVVSAARAVLSRGRASLPLSVLMSALTVGIALSSSLTAASAGTPRVPFNVVEKTIPEMRKAMEDGRVTSRELVVQYLTRIALYEERLNGVMNVNPKALEIAEQLDRERAQGKIRGPLHGIPIALKDNIHTTELPTTGGAMAFEGFTPPYEATLTKHLRDAGAIIIAKTVLTELANFVAGAPTPMPGNYSALGGFGMNPYDPRHDPRPETDDGRPALFTGGSSSGIGTSANFWAGNVGTETSGSILSPANWNMVVGIKPTVGLISRYGVIPITADQDTPGPMAKTVTDAAIMLGVLEGTAPDPQDAATKTCTAPPNGDYTPHLKREGLKGARIGIPRAFFYDKFTAPGDKEARGGLNAEQAKVMADAIAELKAEGAVIVDPADIPSVIDPDPKQNFLVWRTCSGADNAKGKDEDCSTVLKYGMKRDFNAWIATLGPSAPVKSLTELRTFNQAHMARLAIKYGQSLLDISDEMDVEKDRARYEADRKKDIALAGTHGIDEVMKANKLDAILFPASTGAAIAAKPGYPTLVVPFGFVPNAPKPDFPKGFDAKPSPYGVSFAGMACSEGRLIELAYAFEQATRRRVPPASAP

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 1.84
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000121 3300003203 Bacteria 34339
2 JGI25406J46586_10000215 3300003203 Bacteria 25512
3 Ga0065712_10086893 3300005290 Bacteria 2605
4 Ga0070683_100000110 3300005329 Bacteria 54037
5 Ga0070683_100005131 3300005329 Bacteria 10889
6 Ga0070683_100010859 3300005329 Bacteria 7841
7 Ga0070683_100015811 3300005329 Bacteria 6635
8 Ga0070683_100017147 3300005329 Bacteria 6396
9 Ga0070670_100000094 3300005331 Bacteria 84268
10 Ga0070670_100001330 3300005331 Bacteria 19746
11 Ga0068869_100000639 3300005334 Bacteria 19709
12 Ga0070680_100005751 3300005336 Bacteria 9406
13 Ga0070680_100050549 3300005336 Bacteria 3391
14 Ga0070682_100000035 3300005337 Bacteria 150016
15 Ga0070682_100003006 3300005337 Bacteria 9360
16 Ga0068868_100000131 3300005338 Bacteria 48140
17 Ga0068868_100013318 3300005338 Bacteria 6028
18 Ga0068868_100027763 3300005338 Bacteria 4319
19 Ga0070689_100000748 3300005340 Bacteria 19835
20 Ga0070689_100070622 3300005340 Bacteria 2727
21 Ga0070691_10000199 3300005341 Bacteria 20149
22 Ga0070687_100005194 3300005343 Bacteria 5255
23 Ga0070687_100044407 3300005343 Bacteria 2263
24 Ga0070661_100002337 3300005344 Bacteria 12999
25 Ga0070661_100013586 3300005344 Bacteria 5717
26 Ga0070661_100036574 3300005344 Bacteria 3568
27 Ga0070692_10023313 3300005345 Bacteria 3032
28 Ga0070692_10024729 3300005345 Bacteria 2955
29 Ga0070668_100015664 3300005347 Bacteria 5669
30 Ga0070668_100028073 3300005347 Bacteria 4272
31 Ga0070668_100049966 3300005347 Bacteria 3218
32 Ga0070669_100006815 3300005353 Bacteria 8220
33 Ga0070669_100020167 3300005353 Bacteria 4760
34 Ga0070669_100055908 3300005353 Bacteria 2892
35 Ga0070669_100101107 3300005353 Bacteria 2175
36 Ga0070669_100140648 3300005353 Bacteria 1860
37 Ga0070675_100000188 3300005354 Bacteria 38673
38 Ga0070675_100017547 3300005354 Bacteria 5689
39 Ga0070675_100033578 3300005354 Bacteria 4161
40 Ga0070675_100075355 3300005354 Bacteria 2805
41 Ga0070671_100046812 3300005355 Bacteria 3597
42 Ga0070674_100001138 3300005356 Bacteria 13986
43 Ga0070674_100010306 3300005356 Bacteria 5645
44 Ga0070674_100014695 3300005356 Bacteria 4870
45 Ga0070674_100052205 3300005356 Bacteria 2820
46 Ga0070673_100019424 3300005364 Bacteria 4877
47 Ga0070688_100018032 3300005365 Bacteria 4065
48 Ga0070688_100038027 3300005365 Bacteria 2936
49 Ga0070659_100007695 3300005366 Bacteria 7836
50 Ga0070703_10000056 3300005406 Bacteria 55313
51 Ga0070709_10000001 3300005434 Bacteria 412391
52 Ga0070713_100005222 3300005436 Bacteria 8849
53 Ga0070713_100065026 3300005436 Unclassified 3063
54 Ga0070713_100066702 3300005436 Archaea 3027
55 Ga0070701_10016265 3300005438 Bacteria 3454
56 Ga0070701_10034922 3300005438 Bacteria 2522
57 Ga0070711_100000074 3300005439 Bacteria 56976
58 Ga0070705_100001294 3300005440 Bacteria 13415
59 Ga0070705_100006824 3300005440 Bacteria 5613
60 Ga0070708_100000082 3300005445 Bacteria 61560
61 Ga0070681_10003801 3300005458 Bacteria 14187
62 Ga0070681_10005948 3300005458 Bacteria 11812
63 Ga0070681_10026838 3300005458 Bacteria 5789
64 Ga0070681_10039024 3300005458 Bacteria 4761
65 Ga0068867_100011660 3300005459 Bacteria 6207
66 Ga0068867_100049330 3300005459 Unclassified 3099
67 Ga0070706_100000332 3300005467 Bacteria 57528
68 Ga0070706_100013339 3300005467 Bacteria 7599
69 Ga0070706_100027752 3300005467 Bacteria 5206
70 Ga0070707_100000979 3300005468 Bacteria 28257
71 Ga0070707_100003889 3300005468 Bacteria 14059
72 Ga0070707_100006343 3300005468 Bacteria 10995
73 Ga0070707_100025577 3300005468 Bacteria 5602
74 Ga0070698_100077105 3300005471 Bacteria 3334
75 Ga0070699_100000005 3300005518 Bacteria 384287
76 Ga0070699_100000522 3300005518 Bacteria 36360
77 Ga0070699_100012292 3300005518 Bacteria 7386
78 Ga0070679_100001228 3300005530 Bacteria 22505
79 Ga0070684_100001363 3300005535 Bacteria 17522
80 Ga0070684_100002237 3300005535 Bacteria 14247
81 Ga0070684_100002543 3300005535 Bacteria 13466
82 Ga0070684_100010650 3300005535 Bacteria 7293
83 Ga0070684_100017507 3300005535 Bacteria 5884
84 Ga0070684_100025187 3300005535 Bacteria 4999
85 Ga0070684_100068302 3300005535 Bacteria 3123
86 Ga0070697_100003884 3300005536 Bacteria 11472
87 Ga0070697_100010874 3300005536 Bacteria 7107
88 Ga0068853_100022638 3300005539 Bacteria 5251
89 Ga0068853_100040809 3300005539 Unclassified 3961
90 Ga0070672_100006375 3300005543 Bacteria 7923
91 Ga0070672_100037595 3300005543 Unclassified 3694
92 Ga0070695_100000345 3300005545 Bacteria 23795
93 Ga0070695_100002602 3300005545 Bacteria 10423
94 Ga0070696_100000201 3300005546 Bacteria 35453
95 Ga0070696_100005808 3300005546 Bacteria 8240
96 Ga0070696_100030188 3300005546 Bacteria 3710
97 Ga0070693_100001505 3300005547 Bacteria 10498
98 Ga0070693_100006317 3300005547 Bacteria 5743
99 Ga0070665_100008876 3300005548 Bacteria 10180
100 Ga0070665_100026189 3300005548 Bacteria 5872
101 Ga0070704_100011473 3300005549 Bacteria 5431
102 Ga0070704_100044829 3300005549 Bacteria 3076
103 Ga0068855_100050378 3300005563 Bacteria 4907
104 Ga0068857_100001097 3300005577 Bacteria 21003
105 Ga0068857_100015282 3300005577 Bacteria 6701
106 Ga0068857_100033263 3300005577 Bacteria 4560
107 Ga0068857_100060069 3300005577 Bacteria 3377
108 Ga0068856_100004353 3300005614 Bacteria 14111
109 Ga0070702_100001939 3300005615 Bacteria 8706
110 Ga0070702_100005176 3300005615 Bacteria 6041
111 Ga0068859_100000359 3300005617 Bacteria 45467
112 Ga0068859_100012014 3300005617 Bacteria 8699
113 Ga0068859_100142322 3300005617 Bacteria 2472
114 Ga0068864_100000007 3300005618 Bacteria 392187
115 Ga0068864_100000972 3300005618 Bacteria 24025
116 Ga0068864_100048212 3300005618 Bacteria 3661
117 Ga0068866_10007303 3300005718 Bacteria 4625
118 Ga0068866_10017022 3300005718 Bacteria 3263
119 Ga0068861_100035006 3300005719 Bacteria 3717
120 Ga0068861_100039185 3300005719 Bacteria 3535
121 Ga0068863_100002910 3300005841 Bacteria 16973
122 Ga0068863_100063323 3300005841 Unclassified 3497
123 Ga0068863_100107257 3300005841 Bacteria 2658
124 Ga0068863_100126016 3300005841 Bacteria 2443
125 Ga0068858_100003752 3300005842 Bacteria 15037
126 Ga0068858_100014184 3300005842 Bacteria 7513
127 Ga0068858_100022653 3300005842 Bacteria 5858
128 Ga0068858_100100416 3300005842 Bacteria 2699
129 Ga0068860_100033612 3300005843 Bacteria 4920
130 Ga0068860_100089250 3300005843 Bacteria 2935
131 Ga0068860_100089764 3300005843 Bacteria 2926
132 Ga0068862_100006761 3300005844 Bacteria 9507
133 Ga0068862_100041803 3300005844 Bacteria 3902
134 Ga0068862_100060742 3300005844 Bacteria 3248
135 Ga0081455_10000830 3300005937 Bacteria 39759
136 Ga0081455_10002696 3300005937 Bacteria 20981
137 Ga0081538_10001131 3300005981 Bacteria 28183
138 Ga0081539_10000010 3300005985 Bacteria 484386
139 Ga0081539_10001107 3300005985 Bacteria 48837
140 Ga0081539_10002724 3300005985 Bacteria 23904
141 Ga0081539_10009577 3300005985 Bacteria 8059
142 Ga0081539_10020833 3300005985 Bacteria 4406
143 Ga0075366_10047497 3300006195 Bacteria 2544
144 Ga0097621_100002630 3300006237 Bacteria 12297
145 Ga0097621_100007218 3300006237 Bacteria 7930
146 Ga0097621_100019127 3300006237 Bacteria 5250
147 Ga0097621_100035357 3300006237 Bacteria 3992
148 Ga0068871_100003680 3300006358 Bacteria 10536
149 Ga0068871_100016403 3300006358 Bacteria 5577
150 Ga0075428_100000267 3300006844 Bacteria 51547
151 Ga0075428_100002015 3300006844 Bacteria 21915
152 Ga0075428_100004169 3300006844 Bacteria 15907
153 Ga0075428_100068961 3300006844 Bacteria 3868
154 Ga0075430_100001542 3300006846 Bacteria 18812
155 Ga0075430_100033636 3300006846 Bacteria 4350
156 Ga0075431_100002573 3300006847 Bacteria 17520
157 Ga0075431_100009104 3300006847 Bacteria 9957
158 Ga0075431_100084808 3300006847 Bacteria 3270
159 Ga0075431_100138279 3300006847 Bacteria 2511
160 Ga0075433_10023290 3300006852 Bacteria 5211
161 Ga0075434_100000719 3300006871 Bacteria 25910
162 Ga0075434_100014912 3300006871 Bacteria 7435
163 Ga0075434_100020132 3300006871 Bacteria 6466
164 Ga0075434_100050102 3300006871 Bacteria 4148
165 Ga0075434_100061534 3300006871 Bacteria 3735
166 Ga0075434_100064488 3300006871 Bacteria 3647
167 Ga0075434_100068246 3300006871 Bacteria 3542
168 Ga0075434_100072877 3300006871 Bacteria 3426
169 Ga0075434_100089577 3300006871 Bacteria 3078
170 Ga0075434_100099126 3300006871 Unclassified 2919
171 Ga0075434_100137717 3300006871 Bacteria 2460
172 Ga0075429_100003272 3300006880 Bacteria 13808
173 Ga0075429_100038101 3300006880 Bacteria 4185
174 Ga0075429_100042120 3300006880 Bacteria 3975
175 Ga0068865_100009719 3300006881 Bacteria 5967
176 Ga0075436_100000203 3300006914 Bacteria 36662
177 Ga0075436_100000636 3300006914 Bacteria 23119
178 Ga0075436_100001685 3300006914 Bacteria 15101
179 Ga0075436_100011115 3300006914 Bacteria 6173
180 Ga0075436_100027589 3300006914 Bacteria 3907
181 Ga0097620_100000359 3300006931 Bacteria 45467
182 Ga0097620_100012012 3300006931 Bacteria 8699
183 Ga0097620_100142321 3300006931 Bacteria 2472
184 Ga0075435_100000012 3300007076 Bacteria 108852
185 Ga0075435_100000060 3300007076 Bacteria 55995
186 Ga0075435_100011692 3300007076 Bacteria 6471
187 Ga0075435_100018020 3300007076 Bacteria 5356
188 Ga0075435_100051814 3300007076 Bacteria 3306
189 Ga0075435_100097710 3300007076 Bacteria 2430
190 Ga0075435_100114021 3300007076 Bacteria 2250
191 Ga0105240_10006310 3300009093 Bacteria 17447
192 Ga0111539_10000045 3300009094 Bacteria 121986
193 Ga0111539_10000382 3300009094 Bacteria 54624
194 Ga0111539_10001258 3300009094 Bacteria 33783
195 Ga0111539_10002121 3300009094 Bacteria 26502
196 Ga0111539_10005782 3300009094 Bacteria 15985
197 Ga0111539_10044843 3300009094 Bacteria 5295
198 Ga0111539_10058928 3300009094 Bacteria 4555
199 Ga0111539_10150793 3300009094 Bacteria 2721
200 Ga0111539_10166350 3300009094 Bacteria 2578
201 Ga0105245_10000035 3300009098 Bacteria 147165
202 Ga0105245_10000863 3300009098 Bacteria 27512
203 Ga0105245_10004235 3300009098 Bacteria 12727
204 Ga0105245_10005687 3300009098 Bacteria 10951
205 Ga0105245_10006141 3300009098 Bacteria 10570
206 Ga0105245_10008683 3300009098 Bacteria 8861
207 Ga0105245_10010615 3300009098 Bacteria 8014
208 Ga0105245_10034604 3300009098 Bacteria 4482
209 Ga0114129_10000195 3300009147 Bacteria 67681
210 Ga0114129_10000211 3300009147 Bacteria 64797
211 Ga0114129_10000374 3300009147 Bacteria 52129
212 Ga0114129_10001965 3300009147 Bacteria 28123
213 Ga0114129_10005751 3300009147 Bacteria 17567
214 Ga0114129_10006295 3300009147 Bacteria 16826
215 Ga0114129_10016133 3300009147 Bacteria 10628
216 Ga0114129_10019734 3300009147 Bacteria 9594
217 Ga0114129_10020630 3300009147 Bacteria 9369
218 Ga0114129_10033272 3300009147 Bacteria 7285
219 Ga0114129_10035900 3300009147 Bacteria 7000
220 Ga0114129_10103539 3300009147 Unclassified 3935
221 Ga0114129_10148444 3300009147 Bacteria 3210
222 Ga0114129_10152120 3300009147 Bacteria 3166
223 Ga0114129_10152286 3300009147 Bacteria 3164
224 Ga0105242_10001175 3300009176 Bacteria 20607
225 Ga0105242_10001476 3300009176 Bacteria 18511
226 Ga0105242_10005422 3300009176 Bacteria 9867
227 Ga0105242_10006457 3300009176 Bacteria 9030
228 Ga0105242_10027301 3300009176 Bacteria 4531
229 Ga0105242_10135800 3300009176 Bacteria 2128
230 Ga0105248_10022624 3300009177 Bacteria 6975
231 Ga0105248_10042395 3300009177 Bacteria 5103
232 Ga0105237_10005738 3300009545 Bacteria 13943
233 Ga0105238_10000030 3300009551 Bacteria 181972
234 Ga0105238_10008590 3300009551 Bacteria 10219
235 Ga0105249_10014123 3300009553 Bacteria 7060
236 Ga0105249_10027132 3300009553 Bacteria 5166
237 Ga0105239_10019405 3300010375 Bacteria 7507
238 Ga0105239_10020313 3300010375 Bacteria 7327
239 Ga0105239_10073310 3300010375 Unclassified 3764
240 Ga0105239_10317994 3300010375 Bacteria 1755
241 Ga0105246_10009772 3300011119 Bacteria 5913
242 Ga0157371_10043514 3300013102 Bacteria 3199
243 Ga0157369_10000404 3300013105 Bacteria 57448
244 Ga0157369_10023357 3300013105 Bacteria 6888
245 Ga0157374_10000020 3300013296 Bacteria 276902
246 Ga0157374_10010573 3300013296 Bacteria 7944
247 Ga0157374_10063928 3300013296 Bacteria 3452
248 Ga0157378_10000118 3300013297 Bacteria 76565
249 Ga0157378_10009582 3300013297 Bacteria 8433
250 Ga0157378_10010542 3300013297 Bacteria 8076
251 Ga0157378_10027185 3300013297 Bacteria 5048
252 Ga0157372_10004656 3300013307 Bacteria 14581
253 Ga0157372_10022491 3300013307 Bacteria 6823
254 Ga0157372_10029365 3300013307 Bacteria 6003
255 Ga0157375_10000003 3300013308 Bacteria 476325
256 Ga0157375_10000060 3300013308 Bacteria 114761
257 Ga0157375_10000787 3300013308 Bacteria 27686
258 Ga0157375_10026724 3300013308 Bacteria 5385
259 Ga0163163_10000077 3300014325 Bacteria 108755
260 Ga0163163_10000871 3300014325 Bacteria 25708
261 Ga0163163_10025770 3300014325 Bacteria 5609
262 Ga0163163_10038006 3300014325 Bacteria 4687
263 Ga0157380_10002028 3300014326 Bacteria 13524
264 Ga0157380_10002851 3300014326 Bacteria 11737
265 Ga0157380_10047933 3300014326 Bacteria 3363
266 Ga0157380_10048627 3300014326 Bacteria 3341
267 Ga0157380_10135789 3300014326 Bacteria 2105
268 Ga0157377_10000031 3300014745 Bacteria 124109
269 Ga0157377_10000074 3300014745 Bacteria 77443
270 Ga0157377_10002819 3300014745 Bacteria 7753
271 Ga0157377_10017123 3300014745 Bacteria 3743
272 Ga0157379_10041836 3300014968 Bacteria 4090
273 Ga0157376_10000003 3300014969 Bacteria 568634
274 Ga0157376_10002956 3300014969 Bacteria 11661
275 Ga0157376_10097012 3300014969 Unclassified 2567
276 Ga0163161_10048540 3300017792 Unclassified 3066
277 Ga0213873_10000005 3300021358 Bacteria 416778
278 Ga0213876_10000010 3300021384 Bacteria 492549
279 Ga0213876_10000135 3300021384 Bacteria 80441
280 Ga0213876_10020911 3300021384 Bacteria 3460
281 Ga0207653_10000125 3300025885 Bacteria 54304
282 Ga0207699_10000004 3300025906 Bacteria 567333
283 Ga0207645_10001540 3300025907 Bacteria 18848
284 Ga0207645_10002686 3300025907 Bacteria 13855
285 Ga0207645_10072369 3300025907 Bacteria 2206
286 Ga0207643_10009667 3300025908 Bacteria 5177
287 Ga0207705_10015427 3300025909 Bacteria 5483
288 Ga0207705_10090786 3300025909 Unclassified 2237
289 Ga0207684_10000407 3300025910 Bacteria 57689
290 Ga0207684_10003540 3300025910 Bacteria 15213
291 Ga0207684_10030983 3300025910 Bacteria 4552
292 Ga0207684_10035528 3300025910 Bacteria 4232
293 Ga0207684_10065907 3300025910 Bacteria 3075
294 Ga0207707_10008282 3300025912 Bacteria 9023
295 Ga0207707_10009002 3300025912 Bacteria 8672
296 Ga0207707_10009854 3300025912 Bacteria 8282
297 Ga0207707_10044769 3300025912 Bacteria 3857
298 Ga0207707_10071167 3300025912 Unclassified 3030
299 Ga0207695_10007143 3300025913 Bacteria 14292
300 Ga0207671_10072490 3300025914 Bacteria 2571
301 Ga0207663_10000220 3300025916 Bacteria 25503
302 Ga0207660_10008143 3300025917 Bacteria 6781
303 Ga0207660_10044877 3300025917 Bacteria 3111
304 Ga0207662_10004148 3300025918 Bacteria 7581
305 Ga0207662_10009189 3300025918 Bacteria 5434
306 Ga0207649_10023833 3300025920 Bacteria 3549
307 Ga0207652_10005108 3300025921 Bacteria 10653
308 Ga0207652_10013972 3300025921 Bacteria 6501
309 Ga0207646_10001548 3300025922 Bacteria 28193
310 Ga0207646_10003308 3300025922 Bacteria 18332
311 Ga0207681_10018208 3300025923 Bacteria 4423
312 Ga0207681_10024121 3300025923 Bacteria 3900
313 Ga0207681_10028187 3300025923 Bacteria 3636
314 Ga0207681_10048700 3300025923 Bacteria 2861
315 Ga0207681_10062773 3300025923 Bacteria 2559
316 Ga0207681_10091669 3300025923 Bacteria 2171
317 Ga0207694_10000002 3300025924 Bacteria 1165763
318 Ga0207694_10000003 3300025924 Bacteria 1165533
319 Ga0207650_10000101 3300025925 Bacteria 112066
320 Ga0207650_10019217 3300025925 Bacteria 4798
321 Ga0207659_10000168 3300025926 Bacteria 39208
322 Ga0207659_10000901 3300025926 Bacteria 17690
323 Ga0207659_10051462 3300025926 Bacteria 2929
324 Ga0207659_10087151 3300025926 Unclassified 2323
325 Ga0207659_10090270 3300025926 Bacteria 2287
326 Ga0207687_10000009 3300025927 Bacteria 443946
327 Ga0207687_10000527 3300025927 Bacteria 25638
328 Ga0207687_10002303 3300025927 Bacteria 13008
329 Ga0207687_10009935 3300025927 Bacteria 6232
330 Ga0207687_10021858 3300025927 Bacteria 4252
331 Ga0207687_10025682 3300025927 Bacteria 3942
332 Ga0207687_10103022 3300025927 Bacteria 2104
333 Ga0207700_10058752 3300025928 Unclassified 2906
334 Ga0207644_10035263 3300025931 Bacteria 3504
335 Ga0207706_10003451 3300025933 Bacteria 15090
336 Ga0207706_10006248 3300025933 Bacteria 11073
337 Ga0207686_10004576 3300025934 Bacteria 7412
338 Ga0207686_10013407 3300025934 Bacteria 4535
339 Ga0207686_10019304 3300025934 Bacteria 3874
340 Ga0207709_10104760 3300025935 Bacteria 1878
341 Ga0207670_10000459 3300025936 Bacteria 22756
342 Ga0207670_10059608 3300025936 Bacteria 2597
343 Ga0207670_10068669 3300025936 Bacteria 2443
344 Ga0207669_10000288 3300025937 Bacteria 23067
345 Ga0207669_10029876 3300025937 Bacteria 3020
346 Ga0207669_10039954 3300025937 Bacteria 2717
347 Ga0207704_10081179 3300025938 Bacteria 2096
348 Ga0207691_10001373 3300025940 Bacteria 24293
349 Ga0207691_10012292 3300025940 Bacteria 8206
350 Ga0207691_10114730 3300025940 Bacteria 2393
351 Ga0207691_10175512 3300025940 Bacteria 1874
352 Ga0207711_10017911 3300025941 Bacteria 5886
353 Ga0207711_10042296 3300025941 Bacteria 3882
354 Ga0207689_10000317 3300025942 Bacteria 44677
355 Ga0207689_10010729 3300025942 Bacteria 7883
356 Ga0207661_10000022 3300025944 Bacteria 198514
357 Ga0207661_10001815 3300025944 Bacteria 14600
358 Ga0207661_10005472 3300025944 Bacteria 8956
359 Ga0207661_10047065 3300025944 Bacteria 3422
360 Ga0207679_10003366 3300025945 Bacteria 9869
361 Ga0207679_10007208 3300025945 Bacteria 7044
362 Ga0207651_10059301 3300025960 Bacteria 2650
363 Ga0207651_10070992 3300025960 Bacteria 2466
364 Ga0207651_10118297 3300025960 Bacteria 2004
365 Ga0207640_10000659 3300025981 Bacteria 20199
366 Ga0207677_10000001 3300026023 Bacteria 534789
367 Ga0207677_10000132 3300026023 Bacteria 61373
368 Ga0207677_10103259 3300026023 Bacteria 2104
369 Ga0207703_10000599 3300026035 Bacteria 36596
370 Ga0207703_10013894 3300026035 Bacteria 6276
371 Ga0207703_10025146 3300026035 Bacteria 4683
372 Ga0207703_10076026 3300026035 Bacteria 2785
373 Ga0207639_10043126 3300026041 Bacteria 3385
374 Ga0207708_10020543 3300026075 Bacteria 4980
375 Ga0207708_10023021 3300026075 Bacteria 4705
376 Ga0207708_10028662 3300026075 Bacteria 4216
377 Ga0207641_10003075 3300026088 Bacteria 15047
378 Ga0207641_10040492 3300026088 Bacteria 3902
379 Ga0207641_10050983 3300026088 Unclassified 3504
380 Ga0207648_10010564 3300026089 Bacteria 8738
381 Ga0207648_10013095 3300026089 Bacteria 7733
382 Ga0207648_10022198 3300026089 Bacteria 5702
383 Ga0207648_10041192 3300026089 Bacteria 4056
384 Ga0207676_10000015 3300026095 Bacteria 329100
385 Ga0207676_10006192 3300026095 Bacteria 8449
386 Ga0207676_10030993 3300026095 Bacteria 4018
387 Ga0207676_10036032 3300026095 Bacteria 3761
388 Ga0207674_10006101 3300026116 Bacteria 14245
389 Ga0207674_10017768 3300026116 Bacteria 7754
390 Ga0207674_10022426 3300026116 Bacteria 6779
391 Ga0207674_10041123 3300026116 Bacteria 4782
392 Ga0207674_10057086 3300026116 Bacteria 3959
393 Ga0207674_10063214 3300026116 Bacteria 3737
394 Ga0207675_100000848 3300026118 Bacteria 30423
395 Ga0207675_100003134 3300026118 Bacteria 16213
396 Ga0207683_10044385 3300026121 Bacteria 3886
397 Ga0207683_10142923 3300026121 Bacteria 2157
398 Ga0209970_1001969 3300027614 Bacteria 3536
399 Ga0209983_1000178 3300027665 Bacteria 12184
400 Ga0209971_1000111 3300027682 Bacteria 23709
401 Ga0209966_1000497 3300027695 Bacteria 10414
402 Ga0209998_10000193 3300027717 Bacteria 21695
403 Ga0209974_10000805 3300027876 Bacteria 10749
404 Ga0207428_10000010 3300027907 Bacteria 397329
405 Ga0207428_10000486 3300027907 Bacteria 47460
406 Ga0207428_10000899 3300027907 Bacteria 33202
407 Ga0207428_10003434 3300027907 Bacteria 15402
408 Ga0207428_10006030 3300027907 Bacteria 11207
409 Ga0207428_10013370 3300027907 Bacteria 7174
410 Ga0207428_10016477 3300027907 Bacteria 6356
411 Ga0207428_10087232 3300027907 Bacteria 2428
412 Ga0268266_10006252 3300028379 Bacteria 10932
413 Ga0268264_10014721 3300028381 Bacteria 6426
414 Ga0268264_10045246 3300028381 Bacteria 3654
415 Ga0307406_10002866 3300031901 Bacteria 9392
416 Ga0373926_0003824 3300035083 Unclassified 4913
417 Ga0373934_0001207 3300035086 Bacteria 9372
418 Ga0373934_0003578 3300035086 Bacteria 5714
419 Ga0373923_0016577 3300035111 Bacteria 2802
420 Ga0373941_0015265 3300035115 Bacteria 2067
421 Ga0373953_0017840 3300035117 Unclassified 2616
422 Ga0373956_0052830 3300035119 Bacteria 1828
423 Ga0373957_0025624 3300035120 Bacteria 2127
424 Ga0373957_0026542 3300035120 Bacteria 2096
425 Ga0373955_0009778 3300035172 Bacteria 4507
426 Ga0373931_0002496 3300035691 Bacteria 8163
427 Ga0373927_0000770 3300035695 Bacteria 24549
428 Ga0373927_0002507 3300035695 Bacteria 13396
429 Ga0373947_0004192 3300035725 Bacteria 8461
430 Ga0373937_0000037 3300036401 Bacteria 111413
431 Ga0373937_0003007 3300036401 Bacteria 14138
432 Ga0373937_0004412 3300036401 Bacteria 11962
433 Ga0373937_0015642 3300036401 Bacteria 6716
434 Ga0373937_0036248 3300036401 Bacteria 4494
435 Ga0373937_0062576 3300036401 Bacteria 3421
436 Ga0373925_0000383 3300037068 Bacteria 45655
437 Ga0395900_0062905 3300037418 Bacteria 3814
438 Ga0395898_0005623 3300037466 Bacteria 13512
439 Ga0395901_0011997 3300038443 Bacteria 8790
440 Ga0436365_0721783 3300039437 Bacteria 24143
441 Ga0436365_1328271 3300039437 Bacteria 75360
442 Ga0436362_0273161 3300039453 Bacteria 561309
443 Ga0436362_0787780 3300039453 Bacteria 3519
444 Ga0439462_0014517 3300042015 Bacteria 2025
445 Ga0450923_003626 3300042125 Unclassified 2353
446 Ga0439446_0012455 3300042156 Bacteria 2323
447 Ga0439444_0005896 3300042437 Bacteria 1832
448 Ga0439460_0000091 3300042461 Bacteria 14539
449 Ga0451577_0032003 3300042876 Bacteria 4740
450 Ga0495651_0000414 3300046462 Bacteria 33122
451 Ga0495580_0065773 3300046472 Bacteria 2539
452 Ga0495580_0093481 3300046472 Bacteria 2093
453 Ga0495582_0040452 3300046473 Bacteria 2567
454 Ga0495664_0006471 3300046477 Bacteria 6474
455 Ga0495594_0010445 3300046499 Bacteria 4816
456 Ga0495608_0035312 3300046511 Bacteria 3373
457 Ga0495628_0096647 3300046516 Bacteria 2282
458 Ga0495630_0008417 3300046517 Bacteria 7397
459 Ga0495630_0051034 3300046517 Bacteria 3095
460 Ga0495666_0042492 3300046526 Unclassified 2198
461 Ga0495652_0009904 3300046529 Bacteria 8643
462 Ga0495652_0098410 3300046529 Bacteria 2377
463 Ga0495665_0006814 3300046531 Bacteria 6164
464 Ga0495665_0015979 3300046531 Bacteria 4045
465 Ga0495665_0027200 3300046531 Bacteria 3071
466 Ga0495621_0016751 3300046539 Bacteria 2358
467 Ga0495645_0001057 3300046543 Bacteria 18749
468 Ga0495645_0001141 3300046543 Bacteria 18004
469 Ga0495645_0014964 3300046543 Bacteria 5512
470 Ga0495667_0000670 3300046559 Bacteria 21917
471 Ga0495635_0003463 3300046663 Bacteria 10904
472 Ga0495635_0036571 3300046663 Bacteria 3403
473 Ga0495599_0005583 3300046678 Bacteria 7541
474 Ga0495623_0005277 3300046679 Bacteria 8472
475 Ga0495646_0001169 3300046680 Bacteria 15331
476 Ga0495658_0033238 3300046683 Bacteria 2823
477 Ga0495613_0028908 3300046689 Bacteria 4123
478 Ga0495613_0130468 3300046689 Bacteria 1800
479 Ga0495624_0005926 3300046690 Bacteria 8734
480 Ga0495624_0055648 3300046690 Unclassified 2491
481 Ga0495600_0057017 3300046809 Bacteria 2552
482 Ga0495604_0022650 3300047317 Bacteria 5016
483 Ga0495604_0059567 3300047317 Bacteria 2926
484 Ga0495636_0015755 3300047318 Bacteria 3014
485 Ga0495675_0013039 3300047444 Bacteria 5241
486 Ga0495675_0086592 3300047444 Bacteria 1969
487 Ga0495684_0013349 3300047471 Bacteria 6325
488 Ga0495684_0021635 3300047471 Bacteria 4952
489 Ga0495684_0125722 3300047471 Bacteria 1929
490 Ga0495593_0009629 3300047673 Bacteria 5608
491 Ga0495615_0009839 3300048090 Bacteria 1893
492 Ga0496101_0000565 3300048904 Bacteria 22664
493 Ga0496102_0008252 3300048905 Bacteria 8920
494 Ga0496104_0040821 3300048907 Bacteria 4350
495 Ga0496106_0046306 3300048909 Bacteria 3269
496 Ga0496109_0000080 3300048912 Bacteria 100056
497 Ga0496112_0019517 3300048915 Bacteria 6399
498 Ga0496112_0028628 3300048915 Bacteria 5379
499 Ga0496112_0112440 3300048915 Bacteria 2694
500 Ga0496114_0022659 3300048917 Bacteria 5120
501 Ga0496115_0044469 3300048918 Bacteria 3542
502 Ga0496115_0050984 3300048918 Bacteria 3318
503 Ga0501033_0009328 3300049570 Bacteria 7556
504 Ga0501039_0041432 3300049575 Bacteria 3557
505 Ga0501042_0022762 3300049578 Bacteria 4379
506 Ga0501048_0007450 3300049582 Bacteria 8294
507 Ga0501071_0077675 3300049587 Bacteria 2425
508 Ga0501072_0034892 3300049588 Bacteria 3942
509 Ga0501072_0143748 3300049588 Unclassified 1902
510 Ga0501073_0000596 3300049589 Bacteria 25474
511 Ga0501073_0003044 3300049589 Bacteria 12570
512 Ga0501073_0056191 3300049589 Bacteria 2754
513 Ga0501079_0080861 3300049741 Bacteria 2512
514 Ga0501079_0099682 3300049741 Bacteria 2252
515 Ga0501080_0016966 3300049742 Bacteria 6723
516 Ga0501081_0003876 3300049743 Bacteria 9586
517 Ga0501081_0071900 3300049743 Bacteria 2412
518 Ga0501083_0005999 3300049744 Bacteria 8607
519 Ga0501083_0061162 3300049744 Bacteria 2515
520 Ga0501035_0052673 3300049822 Bacteria 3641
521 Ga0501035_0125575 3300049822 Bacteria 2240
522 Ga0501044_0130070 3300049823 Bacteria 2512
523 Ga0501045_0004415 3300049824 Bacteria 9708
524 Ga0501045_0035545 3300049824 Bacteria 3618
525 Ga0501045_0043364 3300049824 Bacteria 3276
526 nmdc:mga0k408_39279_c1 3300050493 Bacteria 2718
527 nmdc:mga06z11_21109_c1 3300050494 Bacteria 3021
528 nmdc:mga05p37_107058_c1 3300050507 Bacteria 3440
529 nmdc:mga05p37_121853_c1 3300050507 Bacteria 3203
530 nmdc:mga05p37_140497_c1 3300050507 Bacteria 2959
531 nmdc:mga05p37_191785_c1 3300050507 Unclassified 2480
532 nmdc:mga05p37_19813_c1 3300050507 Bacteria 8140
533 nmdc:mga05p37_2470_c1 3300050507 Bacteria 21509
534 nmdc:mga05p37_3331_c1 3300050507 Bacteria 18747
535 nmdc:mga05p37_34_c1 3300050507 Bacteria 111954
536 nmdc:mga05p37_37531_c1 3300050507 Bacteria 5941
537 nmdc:mga05p37_63135_c1 3300050507 Bacteria 4558
538 nmdc:mga05p37_64992_c1 3300050507 Bacteria 4490
539 nmdc:mga05p37_70950_c1 3300050507 Bacteria 4285
540 nmdc:mga05p37_756_c1 3300050507 Bacteria 35847
541 nmdc:mga05p37_79916_c1 3300050507 Bacteria 4027
542 nmdc:mga09592_138902_c1 3300050508 Bacteria 2094
543 nmdc:mga09592_30576_c1 3300050508 Bacteria 4481
544 nmdc:mga09592_3948_c1 3300050508 Bacteria 11946
545 nmdc:mga0qj67_434_c1 3300050509 Bacteria 28562
546 nmdc:mga06r32_10563_c2 3300050510 Bacteria 6610
547 nmdc:mga06r32_79421_c1 3300050510 Bacteria 3191
548 nmdc:mga06r32_946_c1 3300050510 Bacteria 25849
549 nmdc:mga08y16_1404_c1 3300050511 Bacteria 24129
550 nmdc:mga08y16_157744_c1 3300050511 Bacteria 2358
551 nmdc:mga08y16_15_c1 3300050511 Bacteria 397324
552 nmdc:mga08y16_16916_c1 3300050511 Bacteria 7680
553 nmdc:mga08y16_17221_c1 3300050511 Bacteria 7606
554 nmdc:mga08y16_2631_c1 3300050511 Bacteria 18449
555 nmdc:mga08y16_3486_c1 3300050511 Bacteria 16326
556 nmdc:mga08y16_3722_c1 3300050511 Bacteria 15880
557 nmdc:mga08y16_40659_c1 3300050511 Bacteria 4872
558 nmdc:mga08y16_46569_c1 3300050511 Unclassified 4540
559 nmdc:mga0n895_16904_c1 3300050512 Bacteria 6709
560 nmdc:mga0n895_187055_c1 3300050512 Bacteria 2102
561 nmdc:mga0n895_531_c1 3300050512 Bacteria 25976
562 nmdc:mga0n895_7439_c1 3300050512 Bacteria 9397
563 nmdc:mga0n895_84177_c1 3300050512 Bacteria 3173
564 nmdc:mga0n895_93482_c1 3300050512 Bacteria 3011
565 nmdc:mga0n895_9388_c1 3300050512 Bacteria 8558
566 nmdc:mga0rr50_125_c1 3300050513 Bacteria 42801
567 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
568 nmdc:mga0rr50_32326_c1 3300050513 Bacteria 3727
569 nmdc:mga08x19_1268_c1 3300050514 Bacteria 15681
570 nmdc:mga08x19_15660_c1 3300050514 Bacteria 4614
571 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
572 nmdc:mga08x19_311_c1 3300050514 Bacteria 35355
573 nmdc:mga08x19_606_c1 3300050514 Bacteria 23135
574 nmdc:mga0a205_13019_c1 3300050515 Bacteria 7722
575 nmdc:mga0a205_180979_c1 3300050515 Bacteria 2002
576 nmdc:mga0a205_181145_c1 3300050515 Unclassified 2001
577 nmdc:mga0a205_23200_c1 3300050515 Bacteria 5885
578 nmdc:mga0a205_27820_c1 3300050515 Bacteria 5401
579 nmdc:mga0a205_28336_c1 3300050515 Bacteria 5355
580 nmdc:mga0a205_37739_c1 3300050515 Bacteria 4646
581 nmdc:mga0a205_49679_c1 3300050515 Bacteria 4049
582 nmdc:mga0a205_64897_c1 3300050515 Bacteria 3526
583 nmdc:mga0a205_65073_c1 3300050515 Bacteria 3522
584 nmdc:mga0a205_82302_c1 3300050515 Bacteria 3109
585 Ga0495601_0085083 3300053077 Bacteria 2032
586 Ga0500641_0002710 3300053096 Bacteria 6258
587 Ga0500555_000520 3300053103 Bacteria 15421
588 Ga0500568_0002484 3300053139 Bacteria 10815
589 Ga0500645_001354 3300053730 Bacteria 12631
590 Ga0501084_0007390 3300054114 Bacteria 9055
591 Ga0501084_0022253 3300054114 Bacteria 5290
592 Ga0590071_007173 3300059421 Bacteria 2639
593 Ga0501082_0000367 3300060353 Bacteria 39868
594 Ga0501082_0128471 3300060353 Bacteria 2199
595 Ga0501082_0189184 3300060353 Unclassified 1791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_49679_c1 nmdc:mga0a205_49679_c1_56_1426 435
2 3300049743 Ga0501081_0071900 Ga0501081_0071900_20_1462 445
3 3300025907 Ga0207645_10072369 Ga0207645_100723692 458
4 3300027907 Ga0207428_10013370 Ga0207428_100133705 460
5 3300046531 Ga0495665_0027200 Ga0495665_0027200_838_2427 478
6 iso_pu_bacteria 2554235469 2556065861 481
7 iso_pu_bacteria 2711768088 2712196712 481
8 3300009553 Ga0105249_10027132 Ga0105249_100271324 492
9 3300005356 Ga0070674_100001138 Ga0070674_1000011382 498
10 3300005543 Ga0070672_100037595 Ga0070672_1000375954 501
11 3300005844 Ga0068862_100041803 Ga0068862_1000418032 501
12 3300025926 Ga0207659_10087151 Ga0207659_100871512 501
13 3300025940 Ga0207691_10175512 Ga0207691_101755122 501
14 3300014326 Ga0157380_10002028 Ga0157380_100020283 502
15 3300025937 Ga0207669_10000288 Ga0207669_1000028815 502
16 3300005546 Ga0070696_100005808 Ga0070696_1000058083 505
17 3300035115 Ga0373941_0015265 Ga0373941_0015265_478_2046 505
18 3300049578 Ga0501042_0022762 Ga0501042_0022762_1632_3257 505
19 3300049582 Ga0501048_0007450 Ga0501048_0007450_499_2124 505
20 3300049588 Ga0501072_0034892 Ga0501072_0034892_1391_3016 505
21 3300049741 Ga0501079_0080861 Ga0501079_0080861_24_1649 505
22 3300049744 Ga0501083_0005999 Ga0501083_0005999_2050_3675 505
23 3300049824 Ga0501045_0004415 Ga0501045_0004415_5720_7345 505
24 3300054114 Ga0501084_0007390 Ga0501084_0007390_4569_6194 505
25 3300060353 Ga0501082_0000367 Ga0501082_0000367_21048_22673 505
26 3300005548 Ga0070665_100008876 Ga0070665_1000088764 506
27 3300005842 Ga0068858_100022653 Ga0068858_1000226533 506
28 3300025934 Ga0207686_10004576 Ga0207686_100045764 506
29 3300026035 Ga0207703_10013894 Ga0207703_100138942 506
30 3300050512 nmdc:mga0n895_9388_c1 nmdc:mga0n895_9388_c1_1108_2703 506
31 3300046472 Ga0495580_0093481 Ga0495580_0093481_196_1812 507
32 3300005353 Ga0070669_100020167 Ga0070669_1000201674 508
33 3300014326 Ga0157380_10047933 Ga0157380_100479333 508
34 3300014745 Ga0157377_10000074 Ga0157377_1000007473 508
35 3300025923 Ga0207681_10018208 Ga0207681_100182084 508
36 3300025926 Ga0207659_10090270 Ga0207659_100902702 508
37 3300005354 Ga0070675_100017547 Ga0070675_1000175473 512
38 3300006871 Ga0075434_100061534 Ga0075434_1000615344 514
39 3300009094 Ga0111539_10005782 Ga0111539_100057825 514
40 3300009094 Ga0111539_10150793 Ga0111539_101507932 514
41 3300027907 Ga0207428_10003434 Ga0207428_100034349 514
42 3300046477 Ga0495664_0006471 Ga0495664_0006471_383_2098 514
43 3300050511 nmdc:mga08y16_1404_c1 nmdc:mga08y16_1404_c1_19741_21477 514
44 3300050512 nmdc:mga0n895_187055_c1 nmdc:mga0n895_187055_c1_199_1791 514
45 3300006237 Ga0097621_100019127 Ga0097621_1000191273 515
46 3300026121 Ga0207683_10044385 Ga0207683_100443852 515
47 3300027907 Ga0207428_10087232 Ga0207428_100872322 515
48 3300035120 Ga0373957_0025624 Ga0373957_0025624_59_1774 515
49 3300046529 Ga0495652_0098410 Ga0495652_0098410_527_2242 515
50 3300046543 Ga0495645_0014964 Ga0495645_0014964_3023_4738 515
51 3300046689 Ga0495613_0130468 Ga0495613_0130468_155_1756 515
52 3300047317 Ga0495604_0022650 Ga0495604_0022650_3136_4905 515
53 3300005337 Ga0070682_100000035 Ga0070682_100000035134 516
54 3300005436 Ga0070713_100066702 Ga0070713_1000667022 517
55 3300005438 Ga0070701_10034922 Ga0070701_100349221 518
56 3300026075 Ga0207708_10020543 Ga0207708_100205433 518
57 3300049587 Ga0501071_0077675 Ga0501071_0077675_89_1789 518
58 3300049822 Ga0501035_0125575 Ga0501035_0125575_367_2067 518
59 3300049824 Ga0501045_0043364 Ga0501045_0043364_1212_2912 518
60 3300006871 Ga0075434_100064488 Ga0075434_1000644883 521
61 3300009147 Ga0114129_10016133 Ga0114129_100161337 521
62 3300046462 Ga0495651_0000414 Ga0495651_0000414_24174_25790 521
63 3300060353 Ga0501082_0189184 Ga0501082_0189184_16_1653 521
64 3300036401 Ga0373937_0015642 Ga0373937_0015642_1377_3092 522
65 3300046511 Ga0495608_0035312 Ga0495608_0035312_223_1938 522
66 3300046559 Ga0495667_0000670 Ga0495667_0000670_16601_18316 522
67 3300047444 Ga0495675_0013039 Ga0495675_0013039_1421_3136 522
68 3300010375 Ga0105239_10317994 Ga0105239_103179941 523
69 3300014325 Ga0163163_10000077 Ga0163163_1000007781 523
70 3300050510 nmdc:mga06r32_10563_c2 nmdc:mga06r32_10563_c2_4481_6100 523
71 3300009147 Ga0114129_10152286 Ga0114129_101522862 524
72 3300050507 nmdc:mga05p37_37531_c1 nmdc:mga05p37_37531_c1_663_2417 524
73 3300050515 nmdc:mga0a205_181145_c1 nmdc:mga0a205_181145_c1_226_1929 525
74 3300053103 Ga0500555_000520 Ga0500555_000520_1305_3122 525
75 3300035086 Ga0373934_0001207 Ga0373934_0001207_3577_5301 526
76 3300035117 Ga0373953_0017840 Ga0373953_0017840_63_1787 526
77 3300035172 Ga0373955_0009778 Ga0373955_0009778_2640_4364 526
78 3300036401 Ga0373937_0003007 Ga0373937_0003007_9755_11479 526
79 3300047471 Ga0495684_0013349 Ga0495684_0013349_4433_6157 526
80 3300005356 Ga0070674_100010306 Ga0070674_1000103063 527
81 3300005458 Ga0070681_10003801 Ga0070681_100038014 527
82 3300005577 Ga0068857_100001097 Ga0068857_10000109719 527
83 3300009098 Ga0105245_10000035 Ga0105245_1000003530 527
84 3300014325 Ga0163163_10025770 Ga0163163_100257705 527
85 3300025912 Ga0207707_10009002 Ga0207707_100090026 527
86 3300025927 Ga0207687_10000009 Ga0207687_10000009289 527
87 3300025942 Ga0207689_10010729 Ga0207689_100107292 527
88 3300026116 Ga0207674_10006101 Ga0207674_100061013 527
89 3300042156 Ga0439446_0012455 Ga0439446_0012455_11_1855 527
90 3300042437 Ga0439444_0005896 Ga0439444_0005896_46_1743 527
91 3300025925 Ga0207650_10019217 Ga0207650_100192174 528
92 3300042461 Ga0439460_0000091 Ga0439460_0000091_10006_11712 528
93 3300006871 Ga0075434_100000719 Ga0075434_10000071917 529
94 3300006914 Ga0075436_100000203 Ga0075436_10000020316 529
95 3300007076 Ga0075435_100000012 Ga0075435_10000001239 529
96 3300014325 Ga0163163_10000871 Ga0163163_1000087111 529
97 3300014969 Ga0157376_10097012 Ga0157376_100970121 529
98 3300047317 Ga0495604_0059567 Ga0495604_0059567_450_2147 529
99 3300047444 Ga0495675_0086592 Ga0495675_0086592_274_1959 529
100 3300050512 nmdc:mga0n895_531_c1 nmdc:mga0n895_531_c1_3155_4939 529
101 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_291618_293402 529
102 3300050514 nmdc:mga08x19_311_c1 nmdc:mga08x19_311_c1_14094_15878 529
103 3300005536 Ga0070697_100010874 Ga0070697_1000108746 530
104 3300006844 Ga0075428_100002015 Ga0075428_1000020157 530
105 3300006880 Ga0075429_100042120 Ga0075429_1000421203 530
106 3300009094 Ga0111539_10058928 Ga0111539_100589282 530
107 3300014969 Ga0157376_10000003 Ga0157376_1000000344 530
108 3300035111 Ga0373923_0016577 Ga0373923_0016577_712_2358 530
109 3300036401 Ga0373937_0062576 Ga0373937_0062576_1449_3095 530
110 3300053730 Ga0500645_001354 Ga0500645_001354_738_2564 530
111 3300005290 Ga0065712_10086893 Ga0065712_100868932 531
112 3300005340 Ga0070689_100070622 Ga0070689_1000706223 531
113 3300005549 Ga0070704_100044829 Ga0070704_1000448292 531
114 3300005618 Ga0068864_100000972 Ga0068864_10000097215 531
115 3300009094 Ga0111539_10166350 Ga0111539_101663502 531
116 3300009147 Ga0114129_10033272 Ga0114129_100332725 531
117 3300013297 Ga0157378_10010542 Ga0157378_100105425 531
118 3300014325 Ga0163163_10038006 Ga0163163_100380062 531
119 3300025910 Ga0207684_10003540 Ga0207684_100035402 531
120 3300025910 Ga0207684_10030983 Ga0207684_100309832 531
121 3300025922 Ga0207646_10003308 Ga0207646_100033087 531
122 3300025936 Ga0207670_10059608 Ga0207670_100596082 531
123 3300026035 Ga0207703_10025146 Ga0207703_100251462 531
124 3300026095 Ga0207676_10006192 Ga0207676_100061922 531
125 3300036401 Ga0373937_0036248 Ga0373937_0036248_683_2482 531
126 3300042125 Ga0450923_003626 Ga0450923_003626_85_1812 531
127 3300046543 Ga0495645_0001057 Ga0495645_0001057_13537_15336 531
128 3300046663 Ga0495635_0036571 Ga0495635_0036571_663_2462 531
129 3300047318 Ga0495636_0015755 Ga0495636_0015755_490_2148 531
130 3300048915 Ga0496112_0019517 Ga0496112_0019517_4095_5876 531
131 3300050511 nmdc:mga08y16_40659_c1 nmdc:mga08y16_40659_c1_2790_4562 531
132 3300013297 Ga0157378_10000118 Ga0157378_1000011821 532
133 3300050511 nmdc:mga08y16_157744_c1 nmdc:mga08y16_157744_c1_514_2259 532
134 3300005436 Ga0070713_100065026 Ga0070713_1000650262 533
135 3300006847 Ga0075431_100138279 Ga0075431_1001382792 533
136 3300007076 Ga0075435_100018020 Ga0075435_1000180204 533
137 3300025928 Ga0207700_10058752 Ga0207700_100587522 533
138 3300050510 nmdc:mga06r32_79421_c1 nmdc:mga06r32_79421_c1_480_2147 533
139 3300009147 Ga0114129_10019734 Ga0114129_100197342 534
140 3300009176 Ga0105242_10006457 Ga0105242_100064575 534
141 3300048917 Ga0496114_0022659 Ga0496114_0022659_20_1825 534
142 3300048918 Ga0496115_0050984 Ga0496115_0050984_246_2051 534
143 3300005468 Ga0070707_100003889 Ga0070707_1000038896 535
144 3300006871 Ga0075434_100089577 Ga0075434_1000895772 535
145 3300006871 Ga0075434_100099126 Ga0075434_1000991262 535
146 3300009098 Ga0105245_10034604 Ga0105245_100346044 535
147 3300025927 Ga0207687_10103022 Ga0207687_101030221 535
148 3300027907 Ga0207428_10006030 Ga0207428_100060305 535
149 3300009098 Ga0105245_10008683 Ga0105245_100086835 536
150 3300025926 Ga0207659_10000901 Ga0207659_100009015 536
151 3300026095 Ga0207676_10036032 Ga0207676_100360322 536
152 3300005338 Ga0068868_100013318 Ga0068868_1000133182 537
153 3300005340 Ga0070689_100000748 Ga0070689_1000007487 537
154 3300005343 Ga0070687_100005194 Ga0070687_1000051944 537
155 3300005618 Ga0068864_100000007 Ga0068864_100000007155 537
156 3300005842 Ga0068858_100003752 Ga0068858_10000375212 537
157 3300006195 Ga0075366_10047497 Ga0075366_100474972 537
158 3300009098 Ga0105245_10000863 Ga0105245_100008639 537
159 3300013308 Ga0157375_10000003 Ga0157375_10000003232 537
160 3300025918 Ga0207662_10009189 Ga0207662_100091892 537
161 3300025927 Ga0207687_10000527 Ga0207687_1000052712 537
162 3300025936 Ga0207670_10000459 Ga0207670_100004599 537
163 3300025940 Ga0207691_10001373 Ga0207691_100013734 537
164 3300025960 Ga0207651_10118297 Ga0207651_101182971 537
165 3300026023 Ga0207677_10000001 Ga0207677_10000001272 537
166 3300026035 Ga0207703_10000599 Ga0207703_100005995 537
167 3300026095 Ga0207676_10000015 Ga0207676_10000015175 537
168 3300035083 Ga0373926_0003824 Ga0373926_0003824_1986_3659 537
169 3300035695 Ga0373927_0002507 Ga0373927_0002507_591_2264 537
170 3300035725 Ga0373947_0004192 Ga0373947_0004192_6516_8189 537
171 3300037068 Ga0373925_0000383 Ga0373925_0000383_38305_39978 537
172 3300046690 Ga0495624_0055648 Ga0495624_0055648_805_2478 537
173 3300049589 Ga0501073_0056191 Ga0501073_0056191_130_1854 537
174 3300050493 nmdc:mga0k408_39279_c1 nmdc:mga0k408_39279_c1_605_2479 537
175 3300005329 Ga0070683_100005131 Ga0070683_1000051316 538
176 3300005341 Ga0070691_10000199 Ga0070691_100001992 538
177 3300005347 Ga0070668_100015664 Ga0070668_1000156646 538
178 3300005354 Ga0070675_100075355 Ga0070675_1000753552 538
179 3300005535 Ga0070684_100002237 Ga0070684_1000022375 538
180 3300006844 Ga0075428_100004169 Ga0075428_10000416910 538
181 3300009147 Ga0114129_10020630 Ga0114129_100206305 538
182 3300009147 Ga0114129_10103539 Ga0114129_101035392 538
183 3300009177 Ga0105248_10022624 Ga0105248_100226246 538
184 3300025941 Ga0207711_10042296 Ga0207711_100422962 538
185 3300025944 Ga0207661_10005472 Ga0207661_100054721 538
186 3300035086 Ga0373934_0003578 Ga0373934_0003578_47_1819 538
187 3300035120 Ga0373957_0026542 Ga0373957_0026542_201_1973 538
188 3300036401 Ga0373937_0000037 Ga0373937_0000037_100280_102052 538
189 3300042015 Ga0439462_0014517 Ga0439462_0014517_26_1714 538
190 3300046472 Ga0495580_0065773 Ga0495580_0065773_395_2071 538
191 3300049575 Ga0501039_0041432 Ga0501039_0041432_1214_2905 538
192 3300049588 Ga0501072_0143748 Ga0501072_0143748_117_1808 538
193 3300049589 Ga0501073_0000596 Ga0501073_0000596_21111_22808 538
194 3300049824 Ga0501045_0035545 Ga0501045_0035545_1636_3327 538
195 3300050513 nmdc:mga0rr50_32326_c1 nmdc:mga0rr50_32326_c1_1784_3520 538
196 3300054114 Ga0501084_0022253 Ga0501084_0022253_2684_4375 538
197 3300005356 Ga0070674_100052205 Ga0070674_1000522052 539
198 3300005467 Ga0070706_100013339 Ga0070706_1000133394 539
199 3300005468 Ga0070707_100025577 Ga0070707_1000255775 539
200 3300009094 Ga0111539_10000045 Ga0111539_100000456 539
201 3300009094 Ga0111539_10001258 Ga0111539_100012587 539
202 3300009094 Ga0111539_10002121 Ga0111539_1000212114 539
203 3300009147 Ga0114129_10035900 Ga0114129_100359002 539
204 3300013307 Ga0157372_10022491 Ga0157372_100224915 539
205 3300025910 Ga0207684_10065907 Ga0207684_100659072 539
206 3300025936 Ga0207670_10068669 Ga0207670_100686691 539
207 3300025937 Ga0207669_10039954 Ga0207669_100399542 539
208 3300027907 Ga0207428_10000010 Ga0207428_100000106 539
209 3300027907 Ga0207428_10000486 Ga0207428_100004862 539
210 3300027907 Ga0207428_10016477 Ga0207428_100164772 539
211 3300035691 Ga0373931_0002496 Ga0373931_0002496_5881_7566 539
212 3300049741 Ga0501079_0099682 Ga0501079_0099682_496_2199 539
213 3300050507 nmdc:mga05p37_63135_c1 nmdc:mga05p37_63135_c1_889_2619 539
214 3300050511 nmdc:mga08y16_15_c1 nmdc:mga08y16_15_c1_4642_6336 539
215 3300050511 nmdc:mga08y16_16916_c1 nmdc:mga08y16_16916_c1_3760_5460 539
216 3300050511 nmdc:mga08y16_2631_c1 nmdc:mga08y16_2631_c1_14714_16408 539
217 3300050511 nmdc:mga08y16_3722_c1 nmdc:mga08y16_3722_c1_11065_12765 539
218 3300005545 Ga0070695_100002602 Ga0070695_1000026022 540
219 3300046473 Ga0495582_0040452 Ga0495582_0040452_813_2501 540
220 3300046499 Ga0495594_0010445 Ga0495594_0010445_2116_3846 540
221 3300046683 Ga0495658_0033238 Ga0495658_0033238_357_2045 540
222 3300047471 Ga0495684_0125722 Ga0495684_0125722_151_1917 540
223 3300048912 Ga0496109_0000080 Ga0496109_0000080_95764_97470 540
224 3300050512 nmdc:mga0n895_93482_c1 nmdc:mga0n895_93482_c1_437_2140 540
225 3300050515 nmdc:mga0a205_28336_c1 nmdc:mga0a205_28336_c1_1064_2767 540
226 3300005436 Ga0070713_100005222 Ga0070713_1000052222 541
227 3300005844 Ga0068862_100060742 Ga0068862_1000607423 541
228 3300005985 Ga0081539_10002724 Ga0081539_100027247 541
229 3300006844 Ga0075428_100068961 Ga0075428_1000689611 541
230 3300006914 Ga0075436_100000636 Ga0075436_1000006364 541
231 3300006914 Ga0075436_100001685 Ga0075436_1000016857 541
232 3300007076 Ga0075435_100000060 Ga0075435_10000006043 541
233 3300007076 Ga0075435_100011692 Ga0075435_1000116922 541
234 3300009093 Ga0105240_10006310 Ga0105240_100063109 541
235 3300009147 Ga0114129_10000374 Ga0114129_1000037435 541
236 3300009147 Ga0114129_10148444 Ga0114129_101484441 541
237 3300013297 Ga0157378_10027185 Ga0157378_100271856 541
238 3300013308 Ga0157375_10026724 Ga0157375_100267242 541
239 3300014326 Ga0157380_10002851 Ga0157380_100028516 541
240 3300026075 Ga0207708_10023021 Ga0207708_100230212 541
241 3300050494 nmdc:mga06z11_21109_c1 nmdc:mga06z11_21109_c1_753_2444 541
242 3300050507 nmdc:mga05p37_34_c1 nmdc:mga05p37_34_c1_46348_48105 541
243 3300050507 nmdc:mga05p37_756_c1 nmdc:mga05p37_756_c1_23797_25500 541
244 3300050513 nmdc:mga0rr50_125_c1 nmdc:mga0rr50_125_c1_31202_32878 541
245 3300050514 nmdc:mga08x19_15660_c1 nmdc:mga08x19_15660_c1_774_2573 541
246 3300050514 nmdc:mga08x19_606_c1 nmdc:mga08x19_606_c1_19266_20942 541
247 3300050515 nmdc:mga0a205_82302_c1 nmdc:mga0a205_82302_c1_307_2106 541
248 3300005347 Ga0070668_100028073 Ga0070668_1000280733 542
249 3300005718 Ga0068866_10017022 Ga0068866_100170222 542
250 3300005719 Ga0068861_100039185 Ga0068861_1000391851 542
251 3300005985 Ga0081539_10020833 Ga0081539_100208332 542
252 3300006237 Ga0097621_100035357 Ga0097621_1000353573 542
253 3300009176 Ga0105242_10027301 Ga0105242_100273012 542
254 3300009177 Ga0105248_10042395 Ga0105248_100423954 542
255 3300009553 Ga0105249_10014123 Ga0105249_100141236 542
256 3300025909 Ga0207705_10090786 Ga0207705_100907862 542
257 3300025923 Ga0207681_10048700 Ga0207681_100487001 542
258 3300025935 Ga0207709_10104760 Ga0207709_101047601 542
259 3300035695 Ga0373927_0000770 Ga0373927_0000770_11914_13641 542
260 3300046517 Ga0495630_0008417 Ga0495630_0008417_2868_4595 542
261 3300046529 Ga0495652_0009904 Ga0495652_0009904_1819_3546 542
262 3300046531 Ga0495665_0006814 Ga0495665_0006814_1070_2797 542
263 3300046663 Ga0495635_0003463 Ga0495635_0003463_6181_7908 542
264 3300046679 Ga0495623_0005277 Ga0495623_0005277_6136_7863 542
265 3300046680 Ga0495646_0001169 Ga0495646_0001169_7777_9504 542
266 3300046689 Ga0495613_0028908 Ga0495613_0028908_2016_3743 542
267 3300046690 Ga0495624_0005926 Ga0495624_0005926_5078_6805 542
268 3300047673 Ga0495593_0009629 Ga0495593_0009629_3682_5409 542
269 3300048904 Ga0496101_0000565 Ga0496101_0000565_970_2670 542
270 3300048907 Ga0496104_0040821 Ga0496104_0040821_701_2401 542
271 3300048918 Ga0496115_0044469 Ga0496115_0044469_1236_2936 542
272 3300049589 Ga0501073_0003044 Ga0501073_0003044_7830_9506 542
273 3300049742 Ga0501080_0016966 Ga0501080_0016966_2118_3794 542
274 3300050507 nmdc:mga05p37_140497_c1 nmdc:mga05p37_140497_c1_69_1868 542
275 3300050515 nmdc:mga0a205_180979_c1 nmdc:mga0a205_180979_c1_162_1859 542
276 3300053139 Ga0500568_0002484 Ga0500568_0002484_65_1759 542
277 3300005459 Ga0068867_100049330 Ga0068867_1000493302 543
278 3300005539 Ga0068853_100022638 Ga0068853_1000226383 543
279 3300005577 Ga0068857_100033263 Ga0068857_1000332632 543
280 3300005577 Ga0068857_100060069 Ga0068857_1000600692 543
281 3300006237 Ga0097621_100002630 Ga0097621_1000026307 543
282 3300006237 Ga0097621_100007218 Ga0097621_1000072185 543
283 3300006358 Ga0068871_100016403 Ga0068871_1000164036 543
284 3300006871 Ga0075434_100137717 Ga0075434_1001377172 543
285 3300006881 Ga0068865_100009719 Ga0068865_1000097191 543
286 3300007076 Ga0075435_100051814 Ga0075435_1000518142 543
287 3300009098 Ga0105245_10005687 Ga0105245_100056876 543
288 3300009176 Ga0105242_10001175 Ga0105242_100011755 543
289 3300009176 Ga0105242_10001476 Ga0105242_1000147611 543
290 3300009545 Ga0105237_10005738 Ga0105237_100057387 543
291 3300009551 Ga0105238_10008590 Ga0105238_100085908 543
292 3300010375 Ga0105239_10020313 Ga0105239_100203133 543
293 3300013296 Ga0157374_10010573 Ga0157374_100105736 543
294 3300013308 Ga0157375_10000787 Ga0157375_1000078717 543
295 3300025914 Ga0207671_10072490 Ga0207671_100724902 543
296 3300025927 Ga0207687_10009935 Ga0207687_100099351 543
297 3300025934 Ga0207686_10013407 Ga0207686_100134074 543
298 3300025934 Ga0207686_10019304 Ga0207686_100193043 543
299 3300025938 Ga0207704_10081179 Ga0207704_100811791 543
300 3300026041 Ga0207639_10043126 Ga0207639_100431263 543
301 3300026089 Ga0207648_10022198 Ga0207648_100221984 543
302 3300026116 Ga0207674_10041123 Ga0207674_100411234 543
303 3300050507 nmdc:mga05p37_19813_c1 nmdc:mga05p37_19813_c1_4421_6184 543
304 3300005406 Ga0070703_10000056 Ga0070703_1000005627 544
305 3300005439 Ga0070711_100000074 Ga0070711_10000007451 544
306 3300005440 Ga0070705_100001294 Ga0070705_1000012945 544
307 3300005467 Ga0070706_100000332 Ga0070706_10000033216 544
308 3300005468 Ga0070707_100000979 Ga0070707_10000097921 544
309 3300005518 Ga0070699_100000522 Ga0070699_10000052220 544
310 3300005546 Ga0070696_100000201 Ga0070696_1000002013 544
311 3300005842 Ga0068858_100014184 Ga0068858_1000141848 544
312 3300006846 Ga0075430_100033636 Ga0075430_1000336361 544
313 3300006914 Ga0075436_100027589 Ga0075436_1000275895 544
314 3300007076 Ga0075435_100114021 Ga0075435_1001140212 544
315 3300009094 Ga0111539_10000382 Ga0111539_1000038215 544
316 3300009176 Ga0105242_10005422 Ga0105242_100054226 544
317 3300025885 Ga0207653_10000125 Ga0207653_1000012519 544
318 3300025910 Ga0207684_10000407 Ga0207684_1000040731 544
319 3300025916 Ga0207663_10000220 Ga0207663_1000022012 544
320 3300025922 Ga0207646_10001548 Ga0207646_1000154820 544
321 3300027907 Ga0207428_10000899 Ga0207428_100008995 544
322 3300028379 Ga0268266_10006252 Ga0268266_100062522 544
323 3300037418 Ga0395900_0062905 Ga0395900_0062905_988_2706 544
324 3300037466 Ga0395898_0005623 Ga0395898_0005623_11_1729 544
325 3300038443 Ga0395901_0011997 Ga0395901_0011997_6619_8337 544
326 3300050507 nmdc:mga05p37_191785_c1 nmdc:mga05p37_191785_c1_271_2091 544
327 3300050511 nmdc:mga08y16_3486_c1 nmdc:mga08y16_3486_c1_14412_16121 544
328 3300050514 nmdc:mga08x19_2_c1 nmdc:mga08x19_2_c1_524284_525987 544
329 3300060353 Ga0501082_0128471 Ga0501082_0128471_329_2047 544
330 3300005434 Ga0070709_10000001 Ga0070709_10000001283 545
331 3300005545 Ga0070695_100000345 Ga0070695_10000034516 545
332 3300005548 Ga0070665_100026189 Ga0070665_1000261891 545
333 3300005617 Ga0068859_100000359 Ga0068859_10000035916 545
334 3300005842 Ga0068858_100100416 Ga0068858_1001004162 545
335 3300005937 Ga0081455_10002696 Ga0081455_1000269611 545
336 3300006847 Ga0075431_100084808 Ga0075431_1000848082 545
337 3300006931 Ga0097620_100000359 Ga0097620_10000035912 545
338 3300009098 Ga0105245_10004235 Ga0105245_100042358 545
339 3300009147 Ga0114129_10000195 Ga0114129_100001958 545
340 3300013307 Ga0157372_10029365 Ga0157372_100293652 545
341 3300025906 Ga0207699_10000004 Ga0207699_10000004105 545
342 3300025927 Ga0207687_10002303 Ga0207687_100023036 545
343 3300025927 Ga0207687_10021858 Ga0207687_100218583 545
344 3300026023 Ga0207677_10103259 Ga0207677_101032592 545
345 3300026089 Ga0207648_10013095 Ga0207648_100130957 545
346 3300027614 Ga0209970_1001969 Ga0209970_10019692 545
347 3300027665 Ga0209983_1000178 Ga0209983_10001781 545
348 3300027682 Ga0209971_1000111 Ga0209971_100011111 545
349 3300027695 Ga0209966_1000497 Ga0209966_10004972 545
350 3300027717 Ga0209998_10000193 Ga0209998_1000019310 545
351 3300027876 Ga0209974_10000805 Ga0209974_100008054 545
352 3300042876 Ga0451577_0032003 Ga0451577_0032003_2238_3944 545
353 3300049570 Ga0501033_0009328 Ga0501033_0009328_3249_4961 545
354 3300049822 Ga0501035_0052673 Ga0501035_0052673_144_1856 545
355 3300049823 Ga0501044_0130070 Ga0501044_0130070_657_2369 545
356 3300050507 nmdc:mga05p37_3331_c1 nmdc:mga05p37_3331_c1_14908_16602 545
357 3300050514 nmdc:mga08x19_1268_c1 nmdc:mga08x19_1268_c1_9257_10951 545
358 3300050515 nmdc:mga0a205_23200_c1 nmdc:mga0a205_23200_c1_3345_5054 545
359 3300050515 nmdc:mga0a205_27820_c1 nmdc:mga0a205_27820_c1_1561_3255 545
360 3300059421 Ga0590071_007173 Ga0590071_007173_593_2302 545
361 3300005329 Ga0070683_100010859 Ga0070683_1000108593 546
362 3300005329 Ga0070683_100015811 Ga0070683_1000158116 546
363 3300005331 Ga0070670_100001330 Ga0070670_10000133011 546
364 3300005334 Ga0068869_100000639 Ga0068869_10000063914 546
365 3300005337 Ga0070682_100003006 Ga0070682_1000030063 546
366 3300005344 Ga0070661_100002337 Ga0070661_1000023378 546
367 3300005353 Ga0070669_100140648 Ga0070669_1001406481 546
368 3300005354 Ga0070675_100000188 Ga0070675_10000018818 546
369 3300005366 Ga0070659_100007695 Ga0070659_1000076957 546
370 3300005445 Ga0070708_100000082 Ga0070708_1000000823 546
371 3300005458 Ga0070681_10005948 Ga0070681_100059485 546
372 3300005535 Ga0070684_100010650 Ga0070684_1000106504 546
373 3300005535 Ga0070684_100025187 Ga0070684_1000251875 546
374 3300005547 Ga0070693_100001505 Ga0070693_1000015057 546
375 3300005577 Ga0068857_100015282 Ga0068857_1000152823 546
376 3300005614 Ga0068856_100004353 Ga0068856_1000043536 546
377 3300005615 Ga0070702_100005176 Ga0070702_1000051764 546
378 3300005617 Ga0068859_100012014 Ga0068859_1000120146 546
379 3300005618 Ga0068864_100048212 Ga0068864_1000482122 546
380 3300005841 Ga0068863_100107257 Ga0068863_1001072571 546
381 3300005843 Ga0068860_100089250 Ga0068860_1000892502 546
382 3300006358 Ga0068871_100003680 Ga0068871_1000036805 546
383 3300006871 Ga0075434_100014912 Ga0075434_1000149124 546
384 3300006931 Ga0097620_100012012 Ga0097620_1000120121 546
385 3300009098 Ga0105245_10006141 Ga0105245_100061417 546
386 3300010375 Ga0105239_10019405 Ga0105239_100194058 546
387 3300011119 Ga0105246_10009772 Ga0105246_100097722 546
388 3300013105 Ga0157369_10023357 Ga0157369_100233574 546
389 3300013307 Ga0157372_10004656 Ga0157372_100046565 546
390 3300014745 Ga0157377_10002819 Ga0157377_100028194 546
391 3300021358 Ga0213873_10000005 Ga0213873_1000000511 546
392 3300021384 Ga0213876_10000010 Ga0213876_10000010445 546
393 3300025912 Ga0207707_10009854 Ga0207707_100098542 546
394 3300025913 Ga0207695_10007143 Ga0207695_100071432 546
395 3300025921 Ga0207652_10013972 Ga0207652_100139723 546
396 3300025926 Ga0207659_10000168 Ga0207659_100001689 546
397 3300025927 Ga0207687_10025682 Ga0207687_100256824 546
398 3300025933 Ga0207706_10006248 Ga0207706_100062483 546
399 3300025942 Ga0207689_10000317 Ga0207689_1000031731 546
400 3300025944 Ga0207661_10001815 Ga0207661_100018158 546
401 3300025944 Ga0207661_10047065 Ga0207661_100470654 546
402 3300025945 Ga0207679_10003366 Ga0207679_100033666 546
403 3300026088 Ga0207641_10040492 Ga0207641_100404922 546
404 3300026095 Ga0207676_10030993 Ga0207676_100309932 546
405 3300026116 Ga0207674_10017768 Ga0207674_100177683 546
406 3300035119 Ga0373956_0052830 Ga0373956_0052830_28_1815 546
407 3300036401 Ga0373937_0004412 Ga0373937_0004412_7984_9771 546
408 3300039437 Ga0436365_1328271 Ga0436365_1328271_65422_67113 546
409 3300039453 Ga0436362_0273161 Ga0436362_0273161_8429_10120 546
410 3300046516 Ga0495628_0096647 Ga0495628_0096647_469_2256 546
411 3300046543 Ga0495645_0001141 Ga0495645_0001141_15025_16812 546
412 3300046678 Ga0495599_0005583 Ga0495599_0005583_2199_3986 546
413 3300046809 Ga0495600_0057017 Ga0495600_0057017_727_2514 546
414 3300048915 Ga0496112_0028628 Ga0496112_0028628_907_2595 546
415 3300050511 nmdc:mga08y16_46569_c1 nmdc:mga08y16_46569_c1_1913_3616 546
416 3300053077 Ga0495601_0085083 Ga0495601_0085083_279_1967 546
417 3300005329 Ga0070683_100000110 Ga0070683_10000011042 547
418 3300005331 Ga0070670_100000094 Ga0070670_10000009453 547
419 3300005336 Ga0070680_100005751 Ga0070680_1000057513 547
420 3300005338 Ga0068868_100000131 Ga0068868_10000013119 547
421 3300005458 Ga0070681_10039024 Ga0070681_100390243 547
422 3300005530 Ga0070679_100001228 Ga0070679_10000122815 547
423 3300005535 Ga0070684_100001363 Ga0070684_10000136311 547
424 3300005981 Ga0081538_10001131 Ga0081538_1000113126 547
425 3300009147 Ga0114129_10152120 Ga0114129_101521202 547
426 3300013105 Ga0157369_10000404 Ga0157369_100004042 547
427 3300014326 Ga0157380_10135789 Ga0157380_101357891 547
428 3300025912 Ga0207707_10008282 Ga0207707_100082825 547
429 3300025917 Ga0207660_10008143 Ga0207660_100081433 547
430 3300025921 Ga0207652_10005108 Ga0207652_100051085 547
431 3300025925 Ga0207650_10000101 Ga0207650_1000010153 547
432 3300025944 Ga0207661_10000022 Ga0207661_10000022141 547
433 3300025981 Ga0207640_10000659 Ga0207640_100006599 547
434 3300026023 Ga0207677_10000132 Ga0207677_1000013232 547
435 3300046517 Ga0495630_0051034 Ga0495630_0051034_110_1840 547
436 3300046531 Ga0495665_0015979 Ga0495665_0015979_2155_3885 547
437 3300005343 Ga0070687_100044407 Ga0070687_1000444071 548
438 3300005353 Ga0070669_100055908 Ga0070669_1000559082 548
439 3300005354 Ga0070675_100033578 Ga0070675_1000335782 548
440 3300005365 Ga0070688_100018032 Ga0070688_1000180324 548
441 3300005535 Ga0070684_100068302 Ga0070684_1000683021 548
442 3300021384 Ga0213876_10020911 Ga0213876_100209113 548
443 3300025908 Ga0207643_10009667 Ga0207643_100096674 548
444 3300025923 Ga0207681_10091669 Ga0207681_100916691 548
445 3300025940 Ga0207691_10114730 Ga0207691_101147302 548
446 3300046539 Ga0495621_0016751 Ga0495621_0016751_88_1845 548
447 3300048090 Ga0495615_0009839 Ga0495615_0009839_129_1844 548
448 3300005353 Ga0070669_100006815 Ga0070669_1000068153 549
449 3300005364 Ga0070673_100019424 Ga0070673_1000194242 549
450 3300005440 Ga0070705_100006824 Ga0070705_1000068242 549
451 3300005459 Ga0068867_100011660 Ga0068867_1000116604 549
452 3300005467 Ga0070706_100027752 Ga0070706_1000277522 549
453 3300005468 Ga0070707_100006343 Ga0070707_1000063438 549
454 3300005518 Ga0070699_100000005 Ga0070699_10000000560 549
455 3300005543 Ga0070672_100006375 Ga0070672_1000063753 549
456 3300005546 Ga0070696_100030188 Ga0070696_1000301883 549
457 3300005549 Ga0070704_100011473 Ga0070704_1000114734 549
458 3300005615 Ga0070702_100001939 Ga0070702_1000019392 549
459 3300005843 Ga0068860_100033612 Ga0068860_1000336123 549
460 3300006871 Ga0075434_100020132 Ga0075434_1000201324 549
461 3300009098 Ga0105245_10010615 Ga0105245_100106153 549
462 3300009551 Ga0105238_10000030 Ga0105238_10000030119 549
463 3300013296 Ga0157374_10000020 Ga0157374_10000020218 549
464 3300013297 Ga0157378_10009582 Ga0157378_100095826 549
465 3300013308 Ga0157375_10000060 Ga0157375_1000006019 549
466 3300014745 Ga0157377_10000031 Ga0157377_1000003163 549
467 3300025907 Ga0207645_10002686 Ga0207645_100026862 549
468 3300025910 Ga0207684_10035528 Ga0207684_100355284 549
469 3300025923 Ga0207681_10024121 Ga0207681_100241212 549
470 3300025924 Ga0207694_10000002 Ga0207694_100000021044 549
471 3300025924 Ga0207694_10000003 Ga0207694_1000000356 549
472 3300025940 Ga0207691_10012292 Ga0207691_100122923 549
473 3300025941 Ga0207711_10017911 Ga0207711_100179113 549
474 3300025960 Ga0207651_10059301 Ga0207651_100593012 549
475 3300025960 Ga0207651_10070992 Ga0207651_100709922 549
476 3300026035 Ga0207703_10076026 Ga0207703_100760262 549
477 3300026118 Ga0207675_100000848 Ga0207675_10000084813 549
478 3300028381 Ga0268264_10014721 Ga0268264_100147214 549
479 3300047471 Ga0495684_0021635 Ga0495684_0021635_855_2588 549
480 3300048909 Ga0496106_0046306 Ga0496106_0046306_624_2324 549
481 3300048915 Ga0496112_0112440 Ga0496112_0112440_108_1841 549
482 3300050511 nmdc:mga08y16_17221_c1 nmdc:mga08y16_17221_c1_5833_7572 549
483 3300050512 nmdc:mga0n895_16904_c1 nmdc:mga0n895_16904_c1_2170_3882 549
484 3300050515 nmdc:mga0a205_64897_c1 nmdc:mga0a205_64897_c1_1731_3443 549
485 3300005471 Ga0070698_100077105 Ga0070698_1000771052 550
486 3300005535 Ga0070684_100017507 Ga0070684_1000175074 550
487 3300005844 Ga0068862_100006761 Ga0068862_1000067614 550
488 3300005985 Ga0081539_10009577 Ga0081539_100095775 550
489 3300006844 Ga0075428_100000267 Ga0075428_1000002672 550
490 3300006871 Ga0075434_100050102 Ga0075434_1000501023 550
491 3300006871 Ga0075434_100068246 Ga0075434_1000682462 550
492 3300006880 Ga0075429_100003272 Ga0075429_1000032724 550
493 3300006914 Ga0075436_100011115 Ga0075436_1000111154 550
494 3300007076 Ga0075435_100097710 Ga0075435_1000977102 550
495 3300009094 Ga0111539_10044843 Ga0111539_100448435 550
496 3300009147 Ga0114129_10000211 Ga0114129_100002115 550
497 3300009147 Ga0114129_10005751 Ga0114129_100057517 550
498 3300009176 Ga0105242_10135800 Ga0105242_101358002 550
499 3300021384 Ga0213876_10000135 Ga0213876_1000013574 550
500 3300025909 Ga0207705_10015427 Ga0207705_100154275 550
501 3300025923 Ga0207681_10028187 Ga0207681_100281872 550
502 3300026089 Ga0207648_10041192 Ga0207648_100411922 550
503 3300039437 Ga0436365_0721783 Ga0436365_0721783_13733_15439 550
504 3300039453 Ga0436362_0787780 Ga0436362_0787780_382_2088 550
505 3300049743 Ga0501081_0003876 Ga0501081_0003876_7075_8790 550
506 3300049744 Ga0501083_0061162 Ga0501083_0061162_736_2451 550
507 3300050507 nmdc:mga05p37_64992_c1 nmdc:mga05p37_64992_c1_161_1879 550
508 3300050508 nmdc:mga09592_3948_c1 nmdc:mga09592_3948_c1_9330_11048 550
509 3300050512 nmdc:mga0n895_84177_c1 nmdc:mga0n895_84177_c1_1017_2822 550
510 3300050515 nmdc:mga0a205_13019_c1 nmdc:mga0a205_13019_c1_2696_4465 550
511 3300050515 nmdc:mga0a205_65073_c1 nmdc:mga0a205_65073_c1_259_1998 550
512 3300003203 JGI25406J46586_10000215 JGI25406J46586_100002154 551
513 3300005329 Ga0070683_100017147 Ga0070683_1000171476 551
514 3300005336 Ga0070680_100050549 Ga0070680_1000505493 551
515 3300005338 Ga0068868_100027763 Ga0068868_1000277632 551
516 3300005344 Ga0070661_100013586 Ga0070661_1000135865 551
517 3300005344 Ga0070661_100036574 Ga0070661_1000365742 551
518 3300005345 Ga0070692_10024729 Ga0070692_100247291 551
519 3300005347 Ga0070668_100049966 Ga0070668_1000499663 551
520 3300005365 Ga0070688_100038027 Ga0070688_1000380272 551
521 3300005458 Ga0070681_10026838 Ga0070681_100268382 551
522 3300005535 Ga0070684_100002543 Ga0070684_1000025436 551
523 3300005539 Ga0068853_100040809 Ga0068853_1000408093 551
524 3300005547 Ga0070693_100006317 Ga0070693_1000063173 551
525 3300005563 Ga0068855_100050378 Ga0068855_1000503782 551
526 3300005719 Ga0068861_100035006 Ga0068861_1000350063 551
527 3300005841 Ga0068863_100063323 Ga0068863_1000633233 551
528 3300005843 Ga0068860_100089764 Ga0068860_1000897643 551
529 3300005937 Ga0081455_10000830 Ga0081455_1000083023 551
530 3300005985 Ga0081539_10000010 Ga0081539_10000010178 551
531 3300006846 Ga0075430_100001542 Ga0075430_10000154214 551
532 3300006847 Ga0075431_100002573 Ga0075431_1000025737 551
533 3300006880 Ga0075429_100038101 Ga0075429_1000381013 551
534 3300009147 Ga0114129_10001965 Ga0114129_1000196515 551
535 3300009147 Ga0114129_10006295 Ga0114129_100062952 551
536 3300010375 Ga0105239_10073310 Ga0105239_100733103 551
537 3300013102 Ga0157371_10043514 Ga0157371_100435143 551
538 3300014745 Ga0157377_10017123 Ga0157377_100171232 551
539 3300014968 Ga0157379_10041836 Ga0157379_100418362 551
540 3300017792 Ga0163161_10048540 Ga0163161_100485402 551
541 3300025907 Ga0207645_10001540 Ga0207645_1000154017 551
542 3300025912 Ga0207707_10044769 Ga0207707_100447693 551
543 3300025912 Ga0207707_10071167 Ga0207707_100711673 551
544 3300025917 Ga0207660_10044877 Ga0207660_100448772 551
545 3300025918 Ga0207662_10004148 Ga0207662_100041487 551
546 3300025920 Ga0207649_10023833 Ga0207649_100238333 551
547 3300025923 Ga0207681_10062773 Ga0207681_100627731 551
548 3300025933 Ga0207706_10003451 Ga0207706_100034517 551
549 3300025945 Ga0207679_10007208 Ga0207679_100072087 551
550 3300026075 Ga0207708_10028662 Ga0207708_100286623 551
551 3300026088 Ga0207641_10050983 Ga0207641_100509832 551
552 3300026116 Ga0207674_10022426 Ga0207674_100224262 551
553 3300026116 Ga0207674_10063214 Ga0207674_100632143 551
554 3300026118 Ga0207675_100003134 Ga0207675_1000031343 551
555 3300026121 Ga0207683_10142923 Ga0207683_101429232 551
556 3300028381 Ga0268264_10045246 Ga0268264_100452462 551
557 3300031901 Ga0307406_10002866 Ga0307406_100028663 551
558 3300046526 Ga0495666_0042492 Ga0495666_0042492_202_1935 551
559 3300048905 Ga0496102_0008252 Ga0496102_0008252_4353_6074 551
560 3300050507 nmdc:mga05p37_2470_c1 nmdc:mga05p37_2470_c1_6728_8455 551
561 3300050507 nmdc:mga05p37_70950_c1 nmdc:mga05p37_70950_c1_1285_3060 551
562 3300050507 nmdc:mga05p37_79916_c1 nmdc:mga05p37_79916_c1_20_1795 551
563 3300050508 nmdc:mga09592_30576_c1 nmdc:mga09592_30576_c1_2188_3909 551
564 3300050509 nmdc:mga0qj67_434_c1 nmdc:mga0qj67_434_c1_16106_17833 551
565 3300050510 nmdc:mga06r32_946_c1 nmdc:mga06r32_946_c1_17218_18945 551
566 3300005345 Ga0070692_10023313 Ga0070692_100233132 552
567 3300005356 Ga0070674_100014695 Ga0070674_1000146953 552
568 3300005438 Ga0070701_10016265 Ga0070701_100162652 552
569 3300005536 Ga0070697_100003884 Ga0070697_1000038846 552
570 3300005718 Ga0068866_10007303 Ga0068866_100073034 552
571 3300005841 Ga0068863_100002910 Ga0068863_10000291012 552
572 3300006847 Ga0075431_100009104 Ga0075431_1000091043 552
573 3300006852 Ga0075433_10023290 Ga0075433_100232904 552
574 3300006871 Ga0075434_100072877 Ga0075434_1000728772 552
575 3300014326 Ga0157380_10048627 Ga0157380_100486272 552
576 3300025937 Ga0207669_10029876 Ga0207669_100298762 552
577 3300026088 Ga0207641_10003075 Ga0207641_1000307512 552
578 3300026089 Ga0207648_10010564 Ga0207648_100105647 552
579 3300050507 nmdc:mga05p37_107058_c1 nmdc:mga05p37_107058_c1_1264_3021 552
580 3300050507 nmdc:mga05p37_121853_c1 nmdc:mga05p37_121853_c1_568_2340 552
581 3300050508 nmdc:mga09592_138902_c1 nmdc:mga09592_138902_c1_201_1958 552
582 3300050512 nmdc:mga0n895_7439_c1 nmdc:mga0n895_7439_c1_5057_6841 552
583 3300050515 nmdc:mga0a205_37739_c1 nmdc:mga0a205_37739_c1_1574_3358 552
584 3300053096 Ga0500641_0002710 Ga0500641_0002710_45_1976 552
585 3300005355 Ga0070671_100046812 Ga0070671_1000468122 553
586 3300005617 Ga0068859_100142322 Ga0068859_1001423222 553
587 3300005841 Ga0068863_100126016 Ga0068863_1001260162 553
588 3300006931 Ga0097620_100142321 Ga0097620_1001423212 553
589 3300025926 Ga0207659_10051462 Ga0207659_100514622 553
590 3300025931 Ga0207644_10035263 Ga0207644_100352632 553
591 3300014969 Ga0157376_10002956 Ga0157376_100029568 554
592 3300026116 Ga0207674_10057086 Ga0207674_100570862 554
593 3300005518 Ga0070699_100012292 Ga0070699_1000122926 556
594 3300005353 Ga0070669_100101107 Ga0070669_1001011072 557
595 3300013296 Ga0157374_10063928 Ga0157374_100639283 557
596 3300003203 JGI25406J46586_10000121 JGI25406J46586_1000012118 562
597 3300005985 Ga0081539_10001107 Ga0081539_100011073 562

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

119

616

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ewq-assembly3.cif.gz_C the crystal structure of an amidase family protein from bacillus anthracis str. ames 0.8866 39 561
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.8838 37 561
5ewq-assembly1.cif.gz_A the crystal structure of an amidase family protein from bacillus anthracis str. ames 0.8836 39 561
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.882 37 561
5ewq-assembly2.cif.gz_B the crystal structure of an amidase family protein from bacillus anthracis str. ames 0.8764 39 561
ID Description Score Start End Superfamily
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8748 36 562 3.90.1300.10
5ewqB00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8744 39 561 3.90.1300.10
af_A0A0P0XRM7_54_372_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8726 31 356 3.90.1300.10
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8713 36 562 3.90.1300.10
af_A0A0P0WV09_96_533_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8669 103 561 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A3N5Z6L6-F1-model_v4 Amidase domain-containing protein 0.9804 213 562
AF-A0A2V8C0C1-F1-model_v4 Amidase 0.9736 45 157
AF-A0A2G4JHN8-F1-model_v4 Amidase (EC 3.5.1.4) 0.9607 16 560 GO:0004040
AF-A0A7C2G498-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A 0.9597 56 162 GO:0003824
AF-A0A6L6EHM3-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A 0.9559 40 162 GO:0016740

Feature Viewer

pLDDT pTM Quality
90.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map