F467716

General Info

Members Datasets Scaffolds Average Seq Length
597 306 1194 230

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_39245_c1|nmdc:mga0k408_39245_c1_1863_2699
Length 278
Sequence VAIDPALPFMLKREEMNAPVSWGRQQENSTHRMSHFLHTEADLNAALAKLILADPRLAPVAAKAGSFPLRRREGGFVGLCSIVIGQQLSVASAAAIRGRMMAAFDPFHHDSVRRARTDKLQRIGLSGAKIRTLKAIGTAVSKGDINLDALVDMDADDAHNELIKLHGIGPWTADIYLMVCLGHADAWPSGDLALQEAARHALGLRTRPDAKKMIKLAKIWRPYRAVAAHLLWKYYGVIKGREGAPVAADAKPAPTKPAKKKEDLNGRTRRPAARTARR

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
102 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
103 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
104 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
304 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.22
Nodule 0.84
Rhizoplane 10.22
Rhizosphere 77.89
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_39245_c1 3300050493 Bacteria 2719
2 JGI25153J46596_10000795 3300003215 Bacteria 19333
3 Ga0070676_10078807 3300005328 Bacteria 1994
4 Ga0070676_10092305 3300005328 Bacteria 1857
5 Ga0070676_10247733 3300005328 Bacteria 1188
6 Ga0070683_100181643 3300005329 Bacteria 1997
7 Ga0070690_100208616 3300005330 Bacteria 1363
8 Ga0070670_100101543 3300005331 Bacteria 2477
9 Ga0070670_100461528 3300005331 Bacteria 1126
10 Ga0070677_10004889 3300005333 Bacteria 4401
11 Ga0070680_100019574 3300005336 Bacteria 5367
12 Ga0070680_100440894 3300005336 Bacteria 1112
13 Ga0070660_100039873 3300005339 Bacteria 3571
14 Ga0070689_100012423 3300005340 Bacteria 6134
15 Ga0070692_10067957 3300005345 Bacteria 1892
16 Ga0070668_100144859 3300005347 Bacteria 1917
17 Ga0070668_100540130 3300005347 Bacteria 1013
18 Ga0070669_100130455 3300005353 Bacteria 1927
19 Ga0070669_100538140 3300005353 Bacteria 973
20 Ga0070675_100181578 3300005354 Bacteria 1819
21 Ga0070675_100219947 3300005354 Bacteria 1654
22 Ga0070675_100605941 3300005354 Bacteria 993
23 Ga0070675_100773680 3300005354 Bacteria 877
24 Ga0070671_100106977 3300005355 Bacteria 2348
25 Ga0070671_100287108 3300005355 Bacteria 1400
26 Ga0070674_100001207 3300005356 Bacteria 13561
27 Ga0070674_100056417 3300005356 Bacteria 2724
28 Ga0070674_100061649 3300005356 Bacteria 2618
29 Ga0070674_100836123 3300005356 Bacteria 797
30 Ga0070673_100050187 3300005364 Bacteria 3261
31 Ga0070688_100701089 3300005365 Bacteria 784
32 Ga0070659_100107186 3300005366 Bacteria 2253
33 Ga0070659_100314096 3300005366 Bacteria 1309
34 Ga0070667_100081663 3300005367 Bacteria 2766
35 Ga0070714_100575989 3300005435 Bacteria 1079
36 Ga0070713_100022564 3300005436 Bacteria 4866
37 Ga0070713_100663548 3300005436 Bacteria 994
38 Ga0070701_10064049 3300005438 Bacteria 1947
39 Ga0070711_100112183 3300005439 Bacteria 2003
40 Ga0070700_100028400 3300005441 Bacteria 3327
41 Ga0070700_100140031 3300005441 Bacteria 1643
42 Ga0070663_100519938 3300005455 Bacteria 991
43 Ga0070678_100049000 3300005456 Bacteria 3046
44 Ga0070678_100085350 3300005456 Bacteria 2406
45 Ga0070678_100136948 3300005456 Bacteria 1954
46 Ga0070678_100176995 3300005456 Bacteria 1743
47 Ga0070678_100335111 3300005456 Bacteria 1296
48 Ga0070662_100097983 3300005457 Bacteria 2213
49 Ga0070681_10039853 3300005458 Bacteria 4709
50 Ga0070681_10126092 3300005458 Bacteria 2493
51 Ga0068867_100158030 3300005459 Bacteria 1786
52 Ga0070685_10007275 3300005466 Bacteria 5660
53 Ga0070679_100006622 3300005530 Bacteria 10800
54 Ga0070679_100459307 3300005530 Bacteria 1218
55 Ga0070684_100043741 3300005535 Bacteria 3870
56 Ga0068853_100103530 3300005539 Bacteria 2519
57 Ga0068853_100206725 3300005539 Bacteria 1788
58 Ga0070672_100004096 3300005543 Bacteria 9520
59 Ga0070672_100796186 3300005543 Bacteria 831
60 Ga0070686_100197606 3300005544 Bacteria 1439
61 Ga0070696_100187254 3300005546 Bacteria 1539
62 Ga0070693_100067481 3300005547 Bacteria 2097
63 Ga0070665_100155135 3300005548 Bacteria 2291
64 Ga0068855_100110115 3300005563 Bacteria 3162
65 Ga0068855_100196155 3300005563 Bacteria 2275
66 Ga0070664_100066803 3300005564 Bacteria 3071
67 Ga0068856_100000226 3300005614 Bacteria 61246
68 Ga0068856_100027040 3300005614 Bacteria 5597
69 Ga0070702_100006580 3300005615 Bacteria 5510
70 Ga0070702_100125310 3300005615 Bacteria 1614
71 Ga0068852_100139704 3300005616 Bacteria 2240
72 Ga0068852_100358293 3300005616 Bacteria 1426
73 Ga0068859_100077247 3300005617 Bacteria 3371
74 Ga0068859_100523306 3300005617 Bacteria 1281
75 Ga0068859_100689956 3300005617 Bacteria 1112
76 Ga0068864_100017011 3300005618 Bacteria 6060
77 Ga0068864_100075352 3300005618 Bacteria 2946
78 Ga0068866_10114229 3300005718 Bacteria 1511
79 Ga0068861_100057720 3300005719 Bacteria 2965
80 Ga0068870_10041123 3300005840 Bacteria 2400
81 Ga0068863_100053819 3300005841 Bacteria 3815
82 Ga0068863_100154859 3300005841 Bacteria 2194
83 Ga0068863_100277199 3300005841 Bacteria 1624
84 Ga0068858_100073327 3300005842 Bacteria 3178
85 Ga0068860_100010300 3300005843 Bacteria 9248
86 Ga0068862_100047079 3300005844 Bacteria 3679
87 Ga0081455_10004142 3300005937 Bacteria 16369
88 Ga0081538_10041420 3300005981 Bacteria 2923
89 Ga0081540_1000085 3300005983 Bacteria 99716
90 Ga0081540_1008984 3300005983 Bacteria 6914
91 Ga0081540_1030378 3300005983 Bacteria 2993
92 Ga0081540_1096113 3300005983 Bacteria 1289
93 Ga0081539_10048583 3300005985 Bacteria 2412
94 Ga0070717_10772255 3300006028 Bacteria 874
95 Ga0075365_10039809 3300006038 Bacteria 3063
96 Ga0075365_10099063 3300006038 Bacteria 1994
97 Ga0075365_10336346 3300006038 Bacteria 1064
98 Ga0075368_10004405 3300006042 Bacteria 4772
99 Ga0075368_10013329 3300006042 Bacteria 3018
100 Ga0075368_10139234 3300006042 Bacteria 1011
101 Ga0075363_100002556 3300006048 Bacteria 7474
102 Ga0075363_100038476 3300006048 Bacteria 2516
103 Ga0075364_10007028 3300006051 Bacteria 6652
104 Ga0075364_10050791 3300006051 Bacteria 2707
105 Ga0075364_10158994 3300006051 Bacteria 1525
106 Ga0070712_100075403 3300006175 Bacteria 2425
107 Ga0070712_100213908 3300006175 Bacteria 1522
108 Ga0070712_100398660 3300006175 Bacteria 1136
109 Ga0075362_10009019 3300006177 Bacteria 3839
110 Ga0075362_10035456 3300006177 Bacteria 2178
111 Ga0075362_10052193 3300006177 Bacteria 1832
112 Ga0075367_10022841 3300006178 Bacteria 3513
113 Ga0075367_10069679 3300006178 Bacteria 2112
114 Ga0075367_10102884 3300006178 Bacteria 1747
115 Ga0075367_10164012 3300006178 Bacteria 1382
116 Ga0075369_10022333 3300006186 Bacteria 2609
117 Ga0075369_10112534 3300006186 Bacteria 1227
118 Ga0075366_10009689 3300006195 Bacteria 5384
119 Ga0075366_10067115 3300006195 Bacteria 2134
120 Ga0075366_10070152 3300006195 Bacteria 2086
121 Ga0075366_10251378 3300006195 Bacteria 1078
122 Ga0097621_100158019 3300006237 Bacteria 1947
123 Ga0075428_100057961 3300006844 Bacteria 4240
124 Ga0075428_100689682 3300006844 Bacteria 1088
125 Ga0075430_100000489 3300006846 Bacteria 29724
126 Ga0075431_100101016 3300006847 Bacteria 2976
127 Ga0075431_100233802 3300006847 Bacteria 1872
128 Ga0075433_10187038 3300006852 Bacteria 1842
129 Ga0075433_10462517 3300006852 Bacteria 1118
130 Ga0075433_10588652 3300006852 Bacteria 977
131 Ga0075434_100039062 3300006871 Bacteria 4703
132 Ga0075434_100749987 3300006871 Bacteria 993
133 Ga0068865_100132408 3300006881 Bacteria 1870
134 Ga0068865_100305650 3300006881 Bacteria 1274
135 Ga0097620_100077243 3300006931 Bacteria 3371
136 Ga0097620_100523284 3300006931 Bacteria 1281
137 Ga0097620_100690085 3300006931 Bacteria 1112
138 Ga0099795_10161236 3300007788 Bacteria 925
139 Ga0105240_10430241 3300009093 Bacteria 1481
140 Ga0111539_10048740 3300009094 Bacteria 5055
141 Ga0111539_10079175 3300009094 Bacteria 3866
142 Ga0111539_10150702 3300009094 Bacteria 2722
143 Ga0111539_10335497 3300009094 Bacteria 1760
144 Ga0105245_10934851 3300009098 Bacteria 910
145 Ga0105247_10013496 3300009101 Bacteria 4899
146 Ga0114129_10857406 3300009147 Bacteria 1154
147 Ga0105243_10056625 3300009148 Bacteria 3118
148 Ga0105243_10339468 3300009148 Bacteria 1375
149 Ga0105242_10319188 3300009176 Bacteria 1424
150 Ga0105242_10565232 3300009176 Bacteria 1093
151 Ga0105242_10727020 3300009176 Bacteria 974
152 Ga0105248_10003595 3300009177 Bacteria 17185
153 Ga0105248_10103950 3300009177 Bacteria 3202
154 Ga0105237_10065880 3300009545 Bacteria 3617
155 Ga0105238_10004667 3300009551 Bacteria 13560
156 Ga0105249_10085193 3300009553 Bacteria 2944
157 Ga0105249_10534557 3300009553 Bacteria 1221
158 Ga0099796_10093872 3300010159 Bacteria 1119
159 Ga0105246_10030817 3300011119 Bacteria 3545
160 Ga0105246_10151210 3300011119 Bacteria 1757
161 Ga0105246_10841898 3300011119 Bacteria 817
162 Ga0157374_10627102 3300013296 Bacteria 1086
163 Ga0157378_10143311 3300013297 Bacteria 2221
164 Ga0157378_10208467 3300013297 Bacteria 1852
165 Ga0163162_10148467 3300013306 Bacteria 2461
166 Ga0157372_10110637 3300013307 Bacteria 3146
167 Ga0157372_10297296 3300013307 Bacteria 1878
168 Ga0157375_10574521 3300013308 Bacteria 1288
169 Ga0157375_11030976 3300013308 Bacteria 961
170 Ga0163163_10209588 3300014325 Bacteria 1998
171 Ga0157380_10083512 3300014326 Bacteria 2617
172 Ga0157380_10093254 3300014326 Bacteria 2490
173 Ga0157380_10246153 3300014326 Bacteria 1615
174 Ga0157380_10512733 3300014326 Bacteria 1168
175 Ga0157377_10020140 3300014745 Bacteria 3491
176 Ga0157379_10175553 3300014968 Bacteria 1935
177 Ga0157376_10043585 3300014969 Bacteria 3683
178 Ga0157376_10083484 3300014969 Bacteria 2748
179 Ga0157376_10270244 3300014969 Bacteria 1597
180 Ga0157376_10382998 3300014969 Bacteria 1355
181 Ga0163161_10171098 3300017792 Bacteria 1661
182 Ga0163161_10200971 3300017792 Bacteria 1536
183 Ga0214544_1000003 3300021320 Bacteria 643752
184 Ga0214542_1000003 3300021321 Bacteria 435700
185 Ga0214545_1000004 3300021324 Bacteria 453352
186 Ga0214543_1000007 3300021327 Bacteria 414744
187 Ga0209758_1001241 3300025297 Bacteria 31750
188 Ga0209758_1024191 3300025297 Bacteria 2715
189 Ga0207426_1052737 3300025302 Bacteria 1203
190 Ga0207697_10059012 3300025315 Bacteria 1594
191 Ga0207682_10002672 3300025893 Bacteria 7945
192 Ga0207688_10024767 3300025901 Bacteria 3292
193 Ga0207688_10032751 3300025901 Bacteria 2873
194 Ga0207688_10074279 3300025901 Bacteria 1933
195 Ga0207645_10079760 3300025907 Bacteria 2098
196 Ga0207645_10111082 3300025907 Bacteria 1774
197 Ga0207645_10147270 3300025907 Bacteria 1536
198 Ga0207643_10002238 3300025908 Bacteria 10540
199 Ga0207707_10100264 3300025912 Bacteria 2531
200 Ga0207707_10187078 3300025912 Bacteria 1807
201 Ga0207671_10190752 3300025914 Bacteria 1598
202 Ga0207693_10067534 3300025915 Bacteria 2800
203 Ga0207693_10417345 3300025915 Bacteria 1049
204 Ga0207663_10165751 3300025916 Bacteria 1565
205 Ga0207660_10080935 3300025917 Bacteria 2386
206 Ga0207649_10058418 3300025920 Bacteria 2415
207 Ga0207652_10101268 3300025921 Bacteria 2544
208 Ga0207681_10346088 3300025923 Bacteria 1189
209 Ga0207650_10033575 3300025925 Bacteria 3717
210 Ga0207659_10020216 3300025926 Bacteria 4397
211 Ga0207659_10023310 3300025926 Bacteria 4129
212 Ga0207659_10041839 3300025926 Bacteria 3210
213 Ga0207700_10123616 3300025928 Bacteria 2101
214 Ga0207700_10447577 3300025928 Bacteria 1138
215 Ga0207644_10007203 3300025931 Bacteria 7241
216 Ga0207644_10101638 3300025931 Bacteria 2161
217 Ga0207644_10509367 3300025931 Bacteria 993
218 Ga0207690_10037865 3300025932 Bacteria 3134
219 Ga0207706_10041076 3300025933 Bacteria 4101
220 Ga0207686_10126473 3300025934 Bacteria 1747
221 Ga0207686_10191801 3300025934 Bacteria 1457
222 Ga0207709_10220447 3300025935 Bacteria 1368
223 Ga0207670_10005620 3300025936 Bacteria 6895
224 Ga0207670_10008148 3300025936 Bacteria 5898
225 Ga0207669_10015203 3300025937 Bacteria 3876
226 Ga0207669_10033011 3300025937 Bacteria 2915
227 Ga0207669_10074153 3300025937 Bacteria 2150
228 Ga0207704_10012784 3300025938 Bacteria 4175
229 Ga0207665_10305893 3300025939 Bacteria 1190
230 Ga0207691_10004178 3300025940 Bacteria 14026
231 Ga0207691_10018885 3300025940 Bacteria 6530
232 Ga0207711_10314327 3300025941 Bacteria 1446
233 Ga0207689_10036539 3300025942 Bacteria 4077
234 Ga0207661_10181872 3300025944 Bacteria 1837
235 Ga0207679_10028263 3300025945 Bacteria 3889
236 Ga0207667_10189937 3300025949 Bacteria 2108
237 Ga0207667_10205435 3300025949 Bacteria 2020
238 Ga0207651_10056987 3300025960 Bacteria 2692
239 Ga0207668_10362144 3300025972 Bacteria 1215
240 Ga0207668_10931254 3300025972 Bacteria 774
241 Ga0207640_10732911 3300025981 Bacteria 850
242 Ga0207658_10055323 3300025986 Bacteria 2940
243 Ga0207677_10179275 3300026023 Bacteria 1665
244 Ga0207677_10180016 3300026023 Bacteria 1662
245 Ga0207703_10115320 3300026035 Bacteria 2298
246 Ga0207639_10111726 3300026041 Bacteria 2228
247 Ga0207639_10263620 3300026041 Bacteria 1508
248 Ga0207678_10005695 3300026067 Bacteria 11126
249 Ga0207708_10002527 3300026075 Bacteria 13457
250 Ga0207708_10076267 3300026075 Bacteria 2571
251 Ga0207708_10184519 3300026075 Bacteria 1657
252 Ga0207702_10435203 3300026078 Bacteria 1270
253 Ga0207641_10010184 3300026088 Bacteria 7732
254 Ga0207641_10159431 3300026088 Bacteria 2050
255 Ga0207641_10182512 3300026088 Bacteria 1923
256 Ga0207648_10011877 3300026089 Bacteria 8184
257 Ga0207648_10051718 3300026089 Bacteria 3591
258 Ga0207648_10304959 3300026089 Bacteria 1429
259 Ga0207676_10020091 3300026095 Bacteria 4881
260 Ga0207676_10143804 3300026095 Bacteria 2045
261 Ga0207674_10124632 3300026116 Bacteria 2542
262 Ga0207675_100003481 3300026118 Bacteria 15380
263 Ga0207675_100463228 3300026118 Bacteria 1258
264 Ga0207683_10009087 3300026121 Bacteria 8469
265 Ga0207683_10010842 3300026121 Bacteria 7774
266 Ga0207683_10024973 3300026121 Bacteria 5151
267 Ga0207683_10198856 3300026121 Bacteria 1821
268 Ga0207698_10177817 3300026142 Bacteria 1881
269 Ga0207698_10613894 3300026142 Bacteria 1073
270 Ga0209813_10034072 3300027866 Bacteria 1518
271 Ga0209813_10052020 3300027866 Bacteria 1283
272 Ga0207428_10070347 3300027907 Bacteria 2750
273 Ga0268266_10161731 3300028379 Bacteria 2026
274 Ga0268264_10021842 3300028381 Bacteria 5223
275 Ga0265334_10014414 3300028573 Bacteria 3296
276 Ga0265338_10011853 3300028800 Bacteria 10017
277 Ga0265325_10007440 3300031241 Bacteria 6553
278 Ga0265325_10016782 3300031241 Bacteria 4086
279 Ga0265340_10007094 3300031247 Bacteria 6108
280 Ga0265339_10000085 3300031249 Bacteria 79483
281 Ga0265316_10153796 3300031344 Bacteria 1722
282 Ga0265313_10000647 3300031595 Bacteria 35853
283 Ga0373926_0012865 3300035083 Bacteria 2833
284 Ga0373940_0099040 3300035088 Bacteria 883
285 Ga0373949_0049794 3300035090 Bacteria 1053
286 Ga0373923_0104349 3300035111 Bacteria 1253
287 Ga0373936_0070022 3300035113 Bacteria 1444
288 Ga0373936_0247171 3300035113 Bacteria 796
289 Ga0373945_0222250 3300035116 Bacteria 790
290 Ga0373953_0028351 3300035117 Bacteria 2158
291 Ga0373954_0006709 3300035118 Bacteria 5020
292 Ga0373954_0026195 3300035118 Bacteria 2672
293 Ga0373956_0014664 3300035119 Bacteria 3277
294 Ga0373957_0001458 3300035120 Bacteria 6409
295 Ga0373957_0005308 3300035120 Bacteria 3988
296 Ga0373960_0017566 3300035121 Bacteria 1855
297 Ga0373943_0000352 3300035170 Bacteria 19408
298 Ga0373943_0160999 3300035170 Bacteria 1222
299 Ga0373946_0001249 3300035171 Bacteria 8793
300 Ga0373946_0006178 3300035171 Bacteria 4338
301 Ga0373955_0008459 3300035172 Bacteria 4782
302 Ga0373955_0083504 3300035172 Bacteria 1809
303 Ga0373955_0420558 3300035172 Bacteria 813
304 Ga0373942_0057239 3300035207 Bacteria 1108
305 Ga0373924_0008832 3300035410 Bacteria 3676
306 Ga0373924_0082861 3300035410 Bacteria 1366
307 Ga0373931_0000661 3300035691 Bacteria 14248
308 Ga0373931_0011009 3300035691 Bacteria 4361
309 Ga0373931_0179524 3300035691 Bacteria 1253
310 Ga0373931_0309097 3300035691 Bacteria 978
311 Ga0373935_0012755 3300035692 Bacteria 5061
312 Ga0373935_0021699 3300035692 Bacteria 3933
313 Ga0373935_0060513 3300035692 Bacteria 2423
314 Ga0373935_0068827 3300035692 Bacteria 2278
315 Ga0373935_0097011 3300035692 Bacteria 1938
316 Ga0373935_0435639 3300035692 Bacteria 945
317 Ga0373927_0004615 3300035695 Bacteria 9604
318 Ga0373927_0028135 3300035695 Bacteria 3668
319 Ga0373933_0004636 3300035724 Bacteria 7529
320 Ga0373933_0299794 3300035724 Bacteria 1040
321 Ga0373947_0003411 3300035725 Bacteria 9404
322 Ga0373947_0010463 3300035725 Bacteria 5324
323 Ga0373947_0045797 3300035725 Bacteria 2618
324 Ga0373947_0078499 3300035725 Bacteria 2038
325 Ga0373947_0097971 3300035725 Bacteria 1839
326 Ga0373947_0143639 3300035725 Bacteria 1533
327 Ga0373937_0005933 3300036401 Bacteria 10512
328 Ga0373937_0011478 3300036401 Bacteria 7776
329 Ga0373925_0005584 3300037068 Bacteria 9363
330 Ga0373925_0032037 3300037068 Bacteria 3867
331 Ga0373925_0099534 3300037068 Bacteria 2233
332 Ga0373925_0118826 3300037068 Bacteria 2050
333 Ga0373925_0420827 3300037068 Bacteria 1091
334 Ga0436364_0883442 3300037853 Bacteria 2210
335 Ga0436365_0023415 3300039437 Bacteria 903
336 Ga0436365_0311949 3300039437 Bacteria 3387
337 Ga0436365_0622224 3300039437 Bacteria 2069
338 Ga0436365_0797393 3300039437 Bacteria 1507
339 Ga0436360_0711225 3300039438 Bacteria 2311
340 Ga0436360_1224151 3300039438 Bacteria 1206
341 Ga0436362_1105849 3300039453 Bacteria 1990
342 Ga0466963_0029639 3300044694 Bacteria 3524
343 Ga0466959_0074951 3300045049 Bacteria 2446
344 Ga0466958_0036745 3300045836 Bacteria 2933
345 Ga0495592_0022740 3300046454 Bacteria 4768
346 Ga0495592_0166668 3300046454 Bacteria 1511
347 Ga0495603_0101689 3300046455 Bacteria 1678
348 Ga0495629_0016023 3300046459 Bacteria 5386
349 Ga0495629_0020945 3300046459 Bacteria 4667
350 Ga0495629_0081788 3300046459 Bacteria 2254
351 Ga0495629_0153108 3300046459 Bacteria 1602
352 Ga0495638_0011133 3300046460 Bacteria 6213
353 Ga0495651_0000683 3300046462 Bacteria 26390
354 Ga0495651_0087812 3300046462 Bacteria 2338
355 Ga0495651_0167929 3300046462 Bacteria 1565
356 Ga0495653_0027136 3300046463 Bacteria 4585
357 Ga0495653_0068169 3300046463 Bacteria 2669
358 Ga0495580_0063685 3300046472 Bacteria 2585
359 Ga0495582_0042767 3300046473 Bacteria 2495
360 Ga0495582_0088884 3300046473 Bacteria 1721
361 Ga0495662_0001042 3300046476 Bacteria 13611
362 Ga0495664_0000398 3300046477 Bacteria 21306
363 Ga0495607_0135360 3300046501 Bacteria 1277
364 Ga0495608_0008405 3300046511 Bacteria 7232
365 Ga0495608_0036991 3300046511 Bacteria 3283
366 Ga0495608_0140889 3300046511 Bacteria 1539
367 Ga0495616_0043874 3300046513 Bacteria 2270
368 Ga0495618_0001639 3300046514 Bacteria 14929
369 Ga0495620_0122854 3300046515 Bacteria 1022
370 Ga0495628_0015143 3300046516 Bacteria 6442
371 Ga0495628_0118388 3300046516 Bacteria 2033
372 Ga0495628_0249909 3300046516 Bacteria 1324
373 Ga0495630_0005356 3300046517 Bacteria 9049
374 Ga0495630_0462295 3300046517 Bacteria 972
375 Ga0495666_0087736 3300046526 Bacteria 1469
376 Ga0495652_0008127 3300046529 Bacteria 9602
377 Ga0495665_0008645 3300046531 Bacteria 5528
378 Ga0495665_0092597 3300046531 Bacteria 1588
379 Ga0495640_0001593 3300046533 Bacteria 17910
380 Ga0495640_0001922 3300046533 Bacteria 16557
381 Ga0495640_0083813 3300046533 Bacteria 2115
382 Ga0495640_0109576 3300046533 Bacteria 1805
383 Ga0495640_0132692 3300046533 Bacteria 1610
384 Ga0495640_0239641 3300046533 Bacteria 1139
385 Ga0495586_0075524 3300046535 Bacteria 1845
386 Ga0495587_0001278 3300046536 Bacteria 16748
387 Ga0495587_0043616 3300046536 Bacteria 2670
388 Ga0495587_0160215 3300046536 Bacteria 1281
389 Ga0495621_0017509 3300046539 Bacteria 2317
390 Ga0495645_0002097 3300046543 Bacteria 13543
391 Ga0495645_0006686 3300046543 Bacteria 8011
392 Ga0495667_0001611 3300046559 Bacteria 14962
393 Ga0495667_0019123 3300046559 Bacteria 4623
394 Ga0495656_0021310 3300046615 Bacteria 2522
395 Ga0495656_0203403 3300046615 Bacteria 984
396 Ga0495634_0006411 3300046642 Bacteria 8941
397 Ga0495634_0006916 3300046642 Bacteria 8573
398 Ga0495635_0006850 3300046663 Bacteria 7962
399 Ga0495635_0058798 3300046663 Bacteria 2644
400 Ga0495635_0076459 3300046663 Bacteria 2294
401 Ga0495635_0144516 3300046663 Bacteria 1620
402 Ga0495659_0015584 3300046664 Bacteria 2501
403 Ga0495657_0030233 3300046675 Bacteria 3795
404 Ga0495599_0001159 3300046678 Bacteria 14939
405 Ga0495599_0012198 3300046678 Bacteria 5293
406 Ga0495623_0021790 3300046679 Bacteria 4138
407 Ga0495623_0048890 3300046679 Bacteria 2680
408 Ga0495646_0003431 3300046680 Bacteria 9853
409 Ga0495646_0004245 3300046680 Bacteria 9016
410 Ga0495647_0001108 3300046681 Bacteria 8236
411 Ga0495647_0107054 3300046681 Bacteria 1163
412 Ga0495658_0017638 3300046683 Bacteria 3692
413 Ga0495658_0098008 3300046683 Bacteria 1746
414 Ga0495613_0189912 3300046689 Bacteria 1452
415 Ga0495613_0262698 3300046689 Bacteria 1202
416 Ga0495624_0016189 3300046690 Bacteria 5022
417 Ga0495624_0019477 3300046690 Bacteria 4527
418 Ga0495624_0032141 3300046690 Bacteria 3404
419 Ga0495670_0066642 3300046691 Bacteria 1817
420 Ga0495600_0002886 3300046809 Bacteria 10017
421 Ga0495660_0219018 3300046810 Bacteria 898
422 Ga0495581_0087455 3300047315 Bacteria 1807
423 Ga0495604_0003637 3300047317 Bacteria 12292
424 Ga0495604_0160585 3300047317 Bacteria 1588
425 Ga0495604_0178654 3300047317 Bacteria 1486
426 Ga0495604_0250622 3300047317 Bacteria 1207
427 Ga0495674_0006413 3300047319 Bacteria 11282
428 Ga0495674_0010144 3300047319 Bacteria 8925
429 Ga0495674_0012504 3300047319 Bacteria 7996
430 Ga0495674_0198739 3300047319 Bacteria 1664
431 Ga0495676_0078762 3300047321 Bacteria 2508
432 Ga0495676_0085811 3300047321 Bacteria 2371
433 Ga0495680_0002984 3300047322 Bacteria 16902
434 Ga0495680_0009791 3300047322 Bacteria 8595
435 Ga0495680_0188840 3300047322 Bacteria 1483
436 Ga0495675_0001860 3300047444 Bacteria 12561
437 Ga0495675_0015332 3300047444 Bacteria 4847
438 Ga0495684_0002371 3300047471 Bacteria 15057
439 Ga0495684_0007415 3300047471 Bacteria 8501
440 Ga0495684_0010871 3300047471 Bacteria 7037
441 Ga0495684_0018202 3300047471 Bacteria 5414
442 Ga0495684_0019206 3300047471 Bacteria 5260
443 Ga0495684_0130504 3300047471 Bacteria 1888
444 Ga0495684_0329613 3300047471 Bacteria 1089
445 Ga0495593_0008885 3300047673 Bacteria 5830
446 Ga0495602_0051338 3300048088 Bacteria 3673
447 Ga0495602_0122681 3300048088 Bacteria 2087
448 Ga0496100_0035195 3300048903 Bacteria 3148
449 Ga0496100_0194788 3300048903 Bacteria 1473
450 Ga0496100_0256403 3300048903 Bacteria 1295
451 Ga0496101_0006319 3300048904 Bacteria 7625
452 Ga0496101_0019145 3300048904 Bacteria 4668
453 Ga0496101_0035050 3300048904 Bacteria 3548
454 Ga0496102_0006616 3300048905 Bacteria 9904
455 Ga0496102_0014897 3300048905 Bacteria 6765
456 Ga0496102_0036294 3300048905 Bacteria 4440
457 Ga0496102_0214629 3300048905 Bacteria 1813
458 Ga0496103_0007625 3300048906 Bacteria 6438
459 Ga0496103_0225229 3300048906 Bacteria 1206
460 Ga0496103_0332463 3300048906 Bacteria 977
461 Ga0496104_0002585 3300048907 Bacteria 15610
462 Ga0496104_0006348 3300048907 Bacteria 10396
463 Ga0496104_0018321 3300048907 Bacteria 6387
464 Ga0496104_0031604 3300048907 Bacteria 4924
465 Ga0496104_0220156 3300048907 Bacteria 1810
466 Ga0496104_0414908 3300048907 Bacteria 1258
467 Ga0496105_0013923 3300048908 Bacteria 6392
468 Ga0496105_0026580 3300048908 Bacteria 4723
469 Ga0496105_0186538 3300048908 Bacteria 1697
470 Ga0496105_0203549 3300048908 Bacteria 1615
471 Ga0496106_0012492 3300048909 Bacteria 6272
472 Ga0496106_0013286 3300048909 Bacteria 6078
473 Ga0496106_0105305 3300048909 Bacteria 2192
474 Ga0496107_0001605 3300048910 Bacteria 14079
475 Ga0496107_0096150 3300048910 Bacteria 2167
476 Ga0496108_0022150 3300048911 Bacteria 5224
477 Ga0496108_0058896 3300048911 Bacteria 3230
478 Ga0496109_0024809 3300048912 Bacteria 5335
479 Ga0496109_0037951 3300048912 Bacteria 4353
480 Ga0496109_0071069 3300048912 Bacteria 3194
481 Ga0496109_0375729 3300048912 Unclassified 1342
482 Ga0496109_0567015 3300048912 Bacteria 1071
483 Ga0496110_0000307 3300048913 Bacteria 32320
484 Ga0496110_0024273 3300048913 Bacteria 5165
485 Ga0496110_0033258 3300048913 Bacteria 4458
486 Ga0496110_0078422 3300048913 Bacteria 2941
487 Ga0496110_0097753 3300048913 Bacteria 2630
488 Ga0496111_0000821 3300048914 Bacteria 16686
489 Ga0496111_0038708 3300048914 Bacteria 3417
490 Ga0496111_0172613 3300048914 Bacteria 1606
491 Ga0496111_0483661 3300048914 Bacteria 912
492 Ga0496112_0047505 3300048915 Bacteria 4211
493 Ga0496112_0078177 3300048915 Bacteria 3272
494 Ga0496112_0096201 3300048915 Bacteria 2931
495 Ga0496112_0112174 3300048915 Bacteria 2696
496 Ga0496112_0245651 3300048915 Bacteria 1742
497 Ga0496112_0771026 3300048915 Bacteria 887
498 Ga0496113_0008882 3300048916 Bacteria 6572
499 Ga0496113_0016919 3300048916 Bacteria 5048
500 Ga0496113_0037140 3300048916 Bacteria 3572
501 Ga0496113_0644865 3300048916 Bacteria 847
502 Ga0496114_0012044 3300048917 Bacteria 6919
503 Ga0496114_0257628 3300048917 Bacteria 1535
504 Ga0496115_0006494 3300048918 Bacteria 8573
505 Ga0496115_0031856 3300048918 Bacteria 4156
506 Ga0496115_0121980 3300048918 Bacteria 2145
507 Ga0496115_0128820 3300048918 Bacteria 2085
508 Ga0496115_0265906 3300048918 Bacteria 1410
509 Ga0501032_0009094 3300049569 Bacteria 7210
510 Ga0501032_0093649 3300049569 Bacteria 1992
511 Ga0501033_0016498 3300049570 Bacteria 5592
512 Ga0501034_0017833 3300049571 Bacteria 7281
513 Ga0501034_0094015 3300049571 Bacteria 2995
514 Ga0501034_0099347 3300049571 Bacteria 2905
515 Ga0501034_0142152 3300049571 Bacteria 2379
516 Ga0501036_0013023 3300049572 Bacteria 6905
517 Ga0501037_0032105 3300049573 Bacteria 3876
518 Ga0501039_0193224 3300049575 Bacteria 1600
519 Ga0501043_0128617 3300049579 Bacteria 1985
520 Ga0501046_0002133 3300049580 Bacteria 18692
521 Ga0501047_0052390 3300049581 Bacteria 3944
522 Ga0501047_0155463 3300049581 Bacteria 2161
523 Ga0501048_0003856 3300049582 Bacteria 11424
524 Ga0501067_0025311 3300049583 Bacteria 3289
525 Ga0501068_0002424 3300049584 Bacteria 9897
526 Ga0501069_0005060 3300049585 Bacteria 6837
527 Ga0501070_0030079 3300049586 Bacteria 4550
528 Ga0501070_0117279 3300049586 Bacteria 2199
529 Ga0501071_0016735 3300049587 Bacteria 5043
530 Ga0501072_0002795 3300049588 Bacteria 13096
531 Ga0501073_0004768 3300049589 Bacteria 10177
532 Ga0501073_0307469 3300049589 Bacteria 1094
533 Ga0501074_0009941 3300049590 Bacteria 6913
534 Ga0501076_0214016 3300049592 Bacteria 1575
535 Ga0501076_0327981 3300049592 Bacteria 1256
536 Ga0501080_0017056 3300049742 Bacteria 6706
537 Ga0501080_0100754 3300049742 Bacteria 2680
538 Ga0501083_0017264 3300049744 Bacteria 5032
539 Ga0501083_0096895 3300049744 Bacteria 1946
540 Ga0501035_0071623 3300049822 Bacteria 3068
541 Ga0501035_0546530 3300049822 Bacteria 949
542 Ga0501044_0000332 3300049823 Bacteria 59619
543 Ga0501044_0054416 3300049823 Bacteria 4113
544 Ga0501044_0111532 3300049823 Bacteria 2743
545 Ga0501044_0260700 3300049823 Bacteria 1672
546 nmdc:mga03683_15729_c1 3300050489 Bacteria 2829
547 nmdc:mga03683_189060_c1 3300050489 Bacteria 942
548 nmdc:mga03683_36113_c1 3300050489 Bacteria 2009
549 nmdc:mga03n38_123176_c1 3300050490 Bacteria 1277
550 nmdc:mga03n38_171946_c1 3300050490 Bacteria 1104
551 nmdc:mga03n38_7405_c1 3300050490 Bacteria 3882
552 nmdc:mga00v17_128022_c1 3300050491 Bacteria 1621
553 nmdc:mga00v17_20342_c1 3300050491 Bacteria 3801
554 nmdc:mga00v17_74558_c1 3300050491 Bacteria 2109
555 nmdc:mga00v17_85136_c1 3300050491 Bacteria 1979
556 nmdc:mga0yw44_2018_c1 3300050492 Bacteria 8446
557 nmdc:mga0yw44_38319_c1 3300050492 Bacteria 2836
558 nmdc:mga0yw44_445351_c1 3300050492 Bacteria 877
559 nmdc:mga0k408_129357_c1 3300050493 Bacteria 1498
560 nmdc:mga0k408_15774_c1 3300050493 Bacteria 4183
561 nmdc:mga0k408_36837_c1 3300050493 Bacteria 2808
562 nmdc:mga06z11_18120_c1 3300050494 Bacteria 3210
563 nmdc:mga06z11_233247_c1 3300050494 Bacteria 1079
564 nmdc:mga06z11_7174_c1 3300050494 Bacteria 4574
565 nmdc:mga06z11_98250_c1 3300050494 Bacteria 1602
566 nmdc:mga07m45_123235_c1 3300050496 Bacteria 1498
567 nmdc:mga07m45_39071_c1 3300050496 Bacteria 2651
568 nmdc:mga07m45_3943_c1 3300050496 Bacteria 7209
569 nmdc:mga06r32_19027_c1 3300050510 Bacteria 6296
570 nmdc:mga06r32_504162_c1 3300050510 Bacteria 1187
571 nmdc:mga08y16_23171_c1 3300050511 Bacteria 6554
572 nmdc:mga08y16_412074_c1 3300050511 Bacteria 1382
573 nmdc:mga08y16_479019_c1 3300050511 Bacteria 1267
574 nmdc:mga08y16_61532_c1 3300050511 Bacteria 3920
575 nmdc:mga0n895_1454_c1 3300050512 Bacteria 17715
576 nmdc:mga0n895_161498_c1 3300050512 Bacteria 2272
577 nmdc:mga0n895_183410_c1 3300050512 Bacteria 2124
578 nmdc:mga0a205_206434_c1 3300050515 Bacteria 1854
579 nmdc:mga0a205_464243_c1 3300050515 Bacteria 1125
580 nmdc:mga0sz30_39917_c1 3300050516 Bacteria 1971
581 Ga0495601_0001473 3300053077 Bacteria 12971
582 Ga0495601_0003349 3300053077 Bacteria 9178
583 Ga0495612_0000315 3300053078 Bacteria 19515
584 Ga0495612_0005252 3300053078 Bacteria 5350
585 Ga0495612_0179101 3300053078 Bacteria 930
586 Ga0495595_0000273 3300053084 Bacteria 20369
587 Ga0495595_0176513 3300053084 Bacteria 1058
588 Ga0495619_0001384 3300053085 Bacteria 15951
589 Ga0495619_0001786 3300053085 Bacteria 14305
590 Ga0495619_0146413 3300053085 Bacteria 1628
591 Ga0500641_0055938 3300053096 Bacteria 1634
592 Ga0500593_000672 3300053117 Bacteria 13043
593 Ga0500658_0230327 3300053134 Bacteria 850
594 Ga0500568_0011347 3300053139 Bacteria 4141
595 Ga0500604_0054078 3300053151 Bacteria 1246
596 Ga0500616_0063988 3300053153 Bacteria 1895
597 8056679041 8056673599 Bacteria 7871253
598 nmdc:mga0k408_39245_c1
599 JGI25153J46596_10000795
600 Ga0070676_10078807
601 Ga0070676_10092305
602 Ga0070676_10247733
603 Ga0070683_100181643
604 Ga0070690_100208616
605 Ga0070670_100101543
606 Ga0070670_100461528
607 Ga0070677_10004889
608 Ga0070680_100019574
609 Ga0070680_100440894
610 Ga0070660_100039873
611 Ga0070689_100012423
612 Ga0070692_10067957
613 Ga0070668_100144859
614 Ga0070668_100540130
615 Ga0070669_100130455
616 Ga0070669_100538140
617 Ga0070675_100181578
618 Ga0070675_100219947
619 Ga0070675_100605941
620 Ga0070675_100773680
621 Ga0070671_100106977
622 Ga0070671_100287108
623 Ga0070674_100001207
624 Ga0070674_100056417
625 Ga0070674_100061649
626 Ga0070674_100836123
627 Ga0070673_100050187
628 Ga0070688_100701089
629 Ga0070659_100107186
630 Ga0070659_100314096
631 Ga0070667_100081663
632 Ga0070714_100575989
633 Ga0070713_100022564
634 Ga0070713_100663548
635 Ga0070701_10064049
636 Ga0070711_100112183
637 Ga0070700_100028400
638 Ga0070700_100140031
639 Ga0070663_100519938
640 Ga0070678_100049000
641 Ga0070678_100085350
642 Ga0070678_100136948
643 Ga0070678_100176995
644 Ga0070678_100335111
645 Ga0070662_100097983
646 Ga0070681_10039853
647 Ga0070681_10126092
648 Ga0068867_100158030
649 Ga0070685_10007275
650 Ga0070679_100006622
651 Ga0070679_100459307
652 Ga0070684_100043741
653 Ga0068853_100103530
654 Ga0068853_100206725
655 Ga0070672_100004096
656 Ga0070672_100796186
657 Ga0070686_100197606
658 Ga0070696_100187254
659 Ga0070693_100067481
660 Ga0070665_100155135
661 Ga0068855_100110115
662 Ga0068855_100196155
663 Ga0070664_100066803
664 Ga0068856_100000226
665 Ga0068856_100027040
666 Ga0070702_100006580
667 Ga0070702_100125310
668 Ga0068852_100139704
669 Ga0068852_100358293
670 Ga0068859_100077247
671 Ga0068859_100523306
672 Ga0068859_100689956
673 Ga0068864_100017011
674 Ga0068864_100075352
675 Ga0068866_10114229
676 Ga0068861_100057720
677 Ga0068870_10041123
678 Ga0068863_100053819
679 Ga0068863_100154859
680 Ga0068863_100277199
681 Ga0068858_100073327
682 Ga0068860_100010300
683 Ga0068862_100047079
684 Ga0081455_10004142
685 Ga0081538_10041420
686 Ga0081540_1000085
687 Ga0081540_1008984
688 Ga0081540_1030378
689 Ga0081540_1096113
690 Ga0081539_10048583
691 Ga0070717_10772255
692 Ga0075365_10039809
693 Ga0075365_10099063
694 Ga0075365_10336346
695 Ga0075368_10004405
696 Ga0075368_10013329
697 Ga0075368_10139234
698 Ga0075363_100002556
699 Ga0075363_100038476
700 Ga0075364_10007028
701 Ga0075364_10050791
702 Ga0075364_10158994
703 Ga0070712_100075403
704 Ga0070712_100213908
705 Ga0070712_100398660
706 Ga0075362_10009019
707 Ga0075362_10035456
708 Ga0075362_10052193
709 Ga0075367_10022841
710 Ga0075367_10069679
711 Ga0075367_10102884
712 Ga0075367_10164012
713 Ga0075369_10022333
714 Ga0075369_10112534
715 Ga0075366_10009689
716 Ga0075366_10067115
717 Ga0075366_10070152
718 Ga0075366_10251378
719 Ga0097621_100158019
720 Ga0075428_100057961
721 Ga0075428_100689682
722 Ga0075430_100000489
723 Ga0075431_100101016
724 Ga0075431_100233802
725 Ga0075433_10187038
726 Ga0075433_10462517
727 Ga0075433_10588652
728 Ga0075434_100039062
729 Ga0075434_100749987
730 Ga0068865_100132408
731 Ga0068865_100305650
732 Ga0097620_100077243
733 Ga0097620_100523284
734 Ga0097620_100690085
735 Ga0099795_10161236
736 Ga0105240_10430241
737 Ga0111539_10048740
738 Ga0111539_10079175
739 Ga0111539_10150702
740 Ga0111539_10335497
741 Ga0105245_10934851
742 Ga0105247_10013496
743 Ga0114129_10857406
744 Ga0105243_10056625
745 Ga0105243_10339468
746 Ga0105242_10319188
747 Ga0105242_10565232
748 Ga0105242_10727020
749 Ga0105248_10003595
750 Ga0105248_10103950
751 Ga0105237_10065880
752 Ga0105238_10004667
753 Ga0105249_10085193
754 Ga0105249_10534557
755 Ga0099796_10093872
756 Ga0105246_10030817
757 Ga0105246_10151210
758 Ga0105246_10841898
759 Ga0157374_10627102
760 Ga0157378_10143311
761 Ga0157378_10208467
762 Ga0163162_10148467
763 Ga0157372_10110637
764 Ga0157372_10297296
765 Ga0157375_10574521
766 Ga0157375_11030976
767 Ga0163163_10209588
768 Ga0157380_10083512
769 Ga0157380_10093254
770 Ga0157380_10246153
771 Ga0157380_10512733
772 Ga0157377_10020140
773 Ga0157379_10175553
774 Ga0157376_10043585
775 Ga0157376_10083484
776 Ga0157376_10270244
777 Ga0157376_10382998
778 Ga0163161_10171098
779 Ga0163161_10200971
780 Ga0214544_1000003
781 Ga0214542_1000003
782 Ga0214545_1000004
783 Ga0214543_1000007
784 Ga0209758_1001241
785 Ga0209758_1024191
786 Ga0207426_1052737
787 Ga0207697_10059012
788 Ga0207682_10002672
789 Ga0207688_10024767
790 Ga0207688_10032751
791 Ga0207688_10074279
792 Ga0207645_10079760
793 Ga0207645_10111082
794 Ga0207645_10147270
795 Ga0207643_10002238
796 Ga0207707_10100264
797 Ga0207707_10187078
798 Ga0207671_10190752
799 Ga0207693_10067534
800 Ga0207693_10417345
801 Ga0207663_10165751
802 Ga0207660_10080935
803 Ga0207649_10058418
804 Ga0207652_10101268
805 Ga0207681_10346088
806 Ga0207650_10033575
807 Ga0207659_10020216
808 Ga0207659_10023310
809 Ga0207659_10041839
810 Ga0207700_10123616
811 Ga0207700_10447577
812 Ga0207644_10007203
813 Ga0207644_10101638
814 Ga0207644_10509367
815 Ga0207690_10037865
816 Ga0207706_10041076
817 Ga0207686_10126473
818 Ga0207686_10191801
819 Ga0207709_10220447
820 Ga0207670_10005620
821 Ga0207670_10008148
822 Ga0207669_10015203
823 Ga0207669_10033011
824 Ga0207669_10074153
825 Ga0207704_10012784
826 Ga0207665_10305893
827 Ga0207691_10004178
828 Ga0207691_10018885
829 Ga0207711_10314327
830 Ga0207689_10036539
831 Ga0207661_10181872
832 Ga0207679_10028263
833 Ga0207667_10189937
834 Ga0207667_10205435
835 Ga0207651_10056987
836 Ga0207668_10362144
837 Ga0207668_10931254
838 Ga0207640_10732911
839 Ga0207658_10055323
840 Ga0207677_10179275
841 Ga0207677_10180016
842 Ga0207703_10115320
843 Ga0207639_10111726
844 Ga0207639_10263620
845 Ga0207678_10005695
846 Ga0207708_10002527
847 Ga0207708_10076267
848 Ga0207708_10184519
849 Ga0207702_10435203
850 Ga0207641_10010184
851 Ga0207641_10159431
852 Ga0207641_10182512
853 Ga0207648_10011877
854 Ga0207648_10051718
855 Ga0207648_10304959
856 Ga0207676_10020091
857 Ga0207676_10143804
858 Ga0207674_10124632
859 Ga0207675_100003481
860 Ga0207675_100463228
861 Ga0207683_10009087
862 Ga0207683_10010842
863 Ga0207683_10024973
864 Ga0207683_10198856
865 Ga0207698_10177817
866 Ga0207698_10613894
867 Ga0209813_10034072
868 Ga0209813_10052020
869 Ga0207428_10070347
870 Ga0268266_10161731
871 Ga0268264_10021842
872 Ga0265334_10014414
873 Ga0265338_10011853
874 Ga0265325_10007440
875 Ga0265325_10016782
876 Ga0265340_10007094
877 Ga0265339_10000085
878 Ga0265316_10153796
879 Ga0265313_10000647
880 Ga0373926_0012865
881 Ga0373940_0099040
882 Ga0373949_0049794
883 Ga0373923_0104349
884 Ga0373936_0070022
885 Ga0373936_0247171
886 Ga0373945_0222250
887 Ga0373953_0028351
888 Ga0373954_0006709
889 Ga0373954_0026195
890 Ga0373956_0014664
891 Ga0373957_0001458
892 Ga0373957_0005308
893 Ga0373960_0017566
894 Ga0373943_0000352
895 Ga0373943_0160999
896 Ga0373946_0001249
897 Ga0373946_0006178
898 Ga0373955_0008459
899 Ga0373955_0083504
900 Ga0373955_0420558
901 Ga0373942_0057239
902 Ga0373924_0008832
903 Ga0373924_0082861
904 Ga0373931_0000661
905 Ga0373931_0011009
906 Ga0373931_0179524
907 Ga0373931_0309097
908 Ga0373935_0012755
909 Ga0373935_0021699
910 Ga0373935_0060513
911 Ga0373935_0068827
912 Ga0373935_0097011
913 Ga0373935_0435639
914 Ga0373927_0004615
915 Ga0373927_0028135
916 Ga0373933_0004636
917 Ga0373933_0299794
918 Ga0373947_0003411
919 Ga0373947_0010463
920 Ga0373947_0045797
921 Ga0373947_0078499
922 Ga0373947_0097971
923 Ga0373947_0143639
924 Ga0373937_0005933
925 Ga0373937_0011478
926 Ga0373925_0005584
927 Ga0373925_0032037
928 Ga0373925_0099534
929 Ga0373925_0118826
930 Ga0373925_0420827
931 Ga0436364_0883442
932 Ga0436365_0023415
933 Ga0436365_0311949
934 Ga0436365_0622224
935 Ga0436365_0797393
936 Ga0436360_0711225
937 Ga0436360_1224151
938 Ga0436362_1105849
939 Ga0466963_0029639
940 Ga0466959_0074951
941 Ga0466958_0036745
942 Ga0495592_0022740
943 Ga0495592_0166668
944 Ga0495603_0101689
945 Ga0495629_0016023
946 Ga0495629_0020945
947 Ga0495629_0081788
948 Ga0495629_0153108
949 Ga0495638_0011133
950 Ga0495651_0000683
951 Ga0495651_0087812
952 Ga0495651_0167929
953 Ga0495653_0027136
954 Ga0495653_0068169
955 Ga0495580_0063685
956 Ga0495582_0042767
957 Ga0495582_0088884
958 Ga0495662_0001042
959 Ga0495664_0000398
960 Ga0495607_0135360
961 Ga0495608_0008405
962 Ga0495608_0036991
963 Ga0495608_0140889
964 Ga0495616_0043874
965 Ga0495618_0001639
966 Ga0495620_0122854
967 Ga0495628_0015143
968 Ga0495628_0118388
969 Ga0495628_0249909
970 Ga0495630_0005356
971 Ga0495630_0462295
972 Ga0495666_0087736
973 Ga0495652_0008127
974 Ga0495665_0008645
975 Ga0495665_0092597
976 Ga0495640_0001593
977 Ga0495640_0001922
978 Ga0495640_0083813
979 Ga0495640_0109576
980 Ga0495640_0132692
981 Ga0495640_0239641
982 Ga0495586_0075524
983 Ga0495587_0001278
984 Ga0495587_0043616
985 Ga0495587_0160215
986 Ga0495621_0017509
987 Ga0495645_0002097
988 Ga0495645_0006686
989 Ga0495667_0001611
990 Ga0495667_0019123
991 Ga0495656_0021310
992 Ga0495656_0203403
993 Ga0495634_0006411
994 Ga0495634_0006916
995 Ga0495635_0006850
996 Ga0495635_0058798
997 Ga0495635_0076459
998 Ga0495635_0144516
999 Ga0495659_0015584
1000 Ga0495657_0030233
1001 Ga0495599_0001159
1002 Ga0495599_0012198
1003 Ga0495623_0021790
1004 Ga0495623_0048890
1005 Ga0495646_0003431
1006 Ga0495646_0004245
1007 Ga0495647_0001108
1008 Ga0495647_0107054
1009 Ga0495658_0017638
1010 Ga0495658_0098008
1011 Ga0495613_0189912
1012 Ga0495613_0262698
1013 Ga0495624_0016189
1014 Ga0495624_0019477
1015 Ga0495624_0032141
1016 Ga0495670_0066642
1017 Ga0495600_0002886
1018 Ga0495660_0219018
1019 Ga0495581_0087455
1020 Ga0495604_0003637
1021 Ga0495604_0160585
1022 Ga0495604_0178654
1023 Ga0495604_0250622
1024 Ga0495674_0006413
1025 Ga0495674_0010144
1026 Ga0495674_0012504
1027 Ga0495674_0198739
1028 Ga0495676_0078762
1029 Ga0495676_0085811
1030 Ga0495680_0002984
1031 Ga0495680_0009791
1032 Ga0495680_0188840
1033 Ga0495675_0001860
1034 Ga0495675_0015332
1035 Ga0495684_0002371
1036 Ga0495684_0007415
1037 Ga0495684_0010871
1038 Ga0495684_0018202
1039 Ga0495684_0019206
1040 Ga0495684_0130504
1041 Ga0495684_0329613
1042 Ga0495593_0008885
1043 Ga0495602_0051338
1044 Ga0495602_0122681
1045 Ga0496100_0035195
1046 Ga0496100_0194788
1047 Ga0496100_0256403
1048 Ga0496101_0006319
1049 Ga0496101_0019145
1050 Ga0496101_0035050
1051 Ga0496102_0006616
1052 Ga0496102_0014897
1053 Ga0496102_0036294
1054 Ga0496102_0214629
1055 Ga0496103_0007625
1056 Ga0496103_0225229
1057 Ga0496103_0332463
1058 Ga0496104_0002585
1059 Ga0496104_0006348
1060 Ga0496104_0018321
1061 Ga0496104_0031604
1062 Ga0496104_0220156
1063 Ga0496104_0414908
1064 Ga0496105_0013923
1065 Ga0496105_0026580
1066 Ga0496105_0186538
1067 Ga0496105_0203549
1068 Ga0496106_0012492
1069 Ga0496106_0013286
1070 Ga0496106_0105305
1071 Ga0496107_0001605
1072 Ga0496107_0096150
1073 Ga0496108_0022150
1074 Ga0496108_0058896
1075 Ga0496109_0024809
1076 Ga0496109_0037951
1077 Ga0496109_0071069
1078 Ga0496109_0375729
1079 Ga0496109_0567015
1080 Ga0496110_0000307
1081 Ga0496110_0024273
1082 Ga0496110_0033258
1083 Ga0496110_0078422
1084 Ga0496110_0097753
1085 Ga0496111_0000821
1086 Ga0496111_0038708
1087 Ga0496111_0172613
1088 Ga0496111_0483661
1089 Ga0496112_0047505
1090 Ga0496112_0078177
1091 Ga0496112_0096201
1092 Ga0496112_0112174
1093 Ga0496112_0245651
1094 Ga0496112_0771026
1095 Ga0496113_0008882
1096 Ga0496113_0016919
1097 Ga0496113_0037140
1098 Ga0496113_0644865
1099 Ga0496114_0012044
1100 Ga0496114_0257628
1101 Ga0496115_0006494
1102 Ga0496115_0031856
1103 Ga0496115_0121980
1104 Ga0496115_0128820
1105 Ga0496115_0265906
1106 Ga0501032_0009094
1107 Ga0501032_0093649
1108 Ga0501033_0016498
1109 Ga0501034_0017833
1110 Ga0501034_0094015
1111 Ga0501034_0099347
1112 Ga0501034_0142152
1113 Ga0501036_0013023
1114 Ga0501037_0032105
1115 Ga0501039_0193224
1116 Ga0501043_0128617
1117 Ga0501046_0002133
1118 Ga0501047_0052390
1119 Ga0501047_0155463
1120 Ga0501048_0003856
1121 Ga0501067_0025311
1122 Ga0501068_0002424
1123 Ga0501069_0005060
1124 Ga0501070_0030079
1125 Ga0501070_0117279
1126 Ga0501071_0016735
1127 Ga0501072_0002795
1128 Ga0501073_0004768
1129 Ga0501073_0307469
1130 Ga0501074_0009941
1131 Ga0501076_0214016
1132 Ga0501076_0327981
1133 Ga0501080_0017056
1134 Ga0501080_0100754
1135 Ga0501083_0017264
1136 Ga0501083_0096895
1137 Ga0501035_0071623
1138 Ga0501035_0546530
1139 Ga0501044_0000332
1140 Ga0501044_0054416
1141 Ga0501044_0111532
1142 Ga0501044_0260700
1143 nmdc:mga03683_15729_c1
1144 nmdc:mga03683_189060_c1
1145 nmdc:mga03683_36113_c1
1146 nmdc:mga03n38_123176_c1
1147 nmdc:mga03n38_171946_c1
1148 nmdc:mga03n38_7405_c1
1149 nmdc:mga00v17_128022_c1
1150 nmdc:mga00v17_20342_c1
1151 nmdc:mga00v17_74558_c1
1152 nmdc:mga00v17_85136_c1
1153 nmdc:mga0yw44_2018_c1
1154 nmdc:mga0yw44_38319_c1
1155 nmdc:mga0yw44_445351_c1
1156 nmdc:mga0k408_129357_c1
1157 nmdc:mga0k408_15774_c1
1158 nmdc:mga0k408_36837_c1
1159 nmdc:mga06z11_18120_c1
1160 nmdc:mga06z11_233247_c1
1161 nmdc:mga06z11_7174_c1
1162 nmdc:mga06z11_98250_c1
1163 nmdc:mga07m45_123235_c1
1164 nmdc:mga07m45_39071_c1
1165 nmdc:mga07m45_3943_c1
1166 nmdc:mga06r32_19027_c1
1167 nmdc:mga06r32_504162_c1
1168 nmdc:mga08y16_23171_c1
1169 nmdc:mga08y16_412074_c1
1170 nmdc:mga08y16_479019_c1
1171 nmdc:mga08y16_61532_c1
1172 nmdc:mga0n895_1454_c1
1173 nmdc:mga0n895_161498_c1
1174 nmdc:mga0n895_183410_c1
1175 nmdc:mga0a205_206434_c1
1176 nmdc:mga0a205_464243_c1
1177 nmdc:mga0sz30_39917_c1
1178 Ga0495601_0001473
1179 Ga0495601_0003349
1180 Ga0495612_0000315
1181 Ga0495612_0005252
1182 Ga0495612_0179101
1183 Ga0495595_0000273
1184 Ga0495595_0176513
1185 Ga0495619_0001384
1186 Ga0495619_0001786
1187 Ga0495619_0146413
1188 Ga0500641_0055938
1189 Ga0500593_000672
1190 Ga0500658_0230327
1191 Ga0500568_0011347
1192 Ga0500604_0054078
1193 Ga0500616_0063988
1194 8056679041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

80

222

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.89 4 194
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8615 1 186
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.846 4 186
2yg9-assembly2.cif.gz_B structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans 0.8438 3 201
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.8418 5 193
ID Description Score Start End Superfamily
af_Q92383_49_162_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9407 30 136 1.10.340.30
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9294 29 136 1.10.340.30
af_A0A1D8PI96_136_252_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9066 30 132 1.10.340.30
af_I1JZX0_85_197_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9023 29 136 1.10.340.30
1ebmA03 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9008 31 136 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A560LKB1-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9943 2 198 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A515KFY0-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9919 2 197 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A0P7X4P8-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9851 2 198 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A2U3PSA9-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9839 2 198 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A1W2EI23-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9783 2 200 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Map