F467607

General Info

Members Datasets Scaffolds Average Seq Length
596 281 589 200

Family's Representative Sequence

Representative Sequence 3300053137|Ga0500561_0131941|Ga0500561_0131941_44_727
Length 227
Sequence MHIAQRAVRSIGEASVPSSCLAPSGHNAALMSEPAAPSSATASHLARNLVSLRHARGLTQDGLAKSAALPRSTIATLESGDGNPSLSVLVKVAGALGVPIDELLASPRAMVRHWAADEVALRSRPAGKGRGVALRVLVPESVPDEMMEVMDFEPGAVMGGTPHLPGTREFFTCLDGRVNLMVAGERYTLAEGEVLAFPGNLPHSYQNADALQPARGISLVVLAKAGV

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
203 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
250 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
271 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
272 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
273 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
274 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
277 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.08
Nodule 0
Rhizoplane 2.68
Rhizosphere 78.52
Stem 0
Stem Tuber 0
Unclassified 6.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002894 3300002773 Bacteria 6130
2 JGI25153J46596_10007019 3300003215 Bacteria 5609
3 JGI25153J46596_10011594 3300003215 Bacteria 3881
4 rootL2_10058867 3300003322 Bacteria 2962
5 Ga0055526_1002792 3300003771 Bacteria 11561
6 Ga0065165_1003998 3300005262 Bacteria 9638
7 Ga0070676_10020755 3300005328 Bacteria 3672
8 Ga0070690_100342553 3300005330 Bacteria 1083
9 Ga0070670_100006074 3300005331 Bacteria 10215
10 Ga0070670_100008070 3300005331 Bacteria 8955
11 Ga0070670_100077964 3300005331 Bacteria 2846
12 Ga0070670_100129878 3300005331 Bacteria 2175
13 Ga0070670_100331550 3300005331 Bacteria 1334
14 Ga0070670_100452825 3300005331 Bacteria 1138
15 Ga0070670_100593974 3300005331 Bacteria 990
16 Ga0070677_10020310 3300005333 Bacteria 2418
17 Ga0068869_100017350 3300005334 Bacteria 4877
18 Ga0070666_10146727 3300005335 Bacteria 1645
19 Ga0070682_100474233 3300005337 Bacteria 964
20 Ga0068868_100022466 3300005338 Bacteria 4760
21 Ga0068868_100034136 3300005338 Bacteria 3926
22 Ga0068868_100055847 3300005338 Bacteria 3117
23 Ga0068868_100375780 3300005338 Bacteria 1222
24 Ga0070660_100182252 3300005339 Bacteria 1700
25 Ga0070660_100230035 3300005339 Bacteria 1508
26 Ga0070687_100006034 3300005343 Bacteria 4939
27 Ga0070661_100001667 3300005344 Bacteria 15398
28 Ga0070661_100447340 3300005344 Bacteria 1028
29 Ga0070668_100003853 3300005347 Bacteria 11069
30 Ga0070669_100005123 3300005353 Bacteria 9478
31 Ga0070675_100011995 3300005354 Bacteria 6792
32 Ga0070675_100018260 3300005354 Bacteria 5583
33 Ga0070675_100031570 3300005354 Bacteria 4283
34 Ga0070675_100050187 3300005354 Bacteria 3426
35 Ga0070671_100020822 3300005355 Bacteria 5349
36 Ga0070671_100023972 3300005355 Bacteria 4993
37 Ga0070671_100028965 3300005355 Bacteria 4565
38 Ga0070671_100067021 3300005355 Bacteria 2992
39 Ga0070671_100132032 3300005355 Bacteria 2103
40 Ga0070674_100008283 3300005356 Bacteria 6184
41 Ga0070674_100039156 3300005356 Bacteria 3200
42 Ga0070674_100046859 3300005356 Bacteria 2960
43 Ga0070674_100053652 3300005356 Bacteria 2785
44 Ga0070674_100056094 3300005356 Bacteria 2731
45 Ga0070673_100003566 3300005364 Bacteria 9717
46 Ga0070673_100007794 3300005364 Bacteria 7088
47 Ga0070673_100024223 3300005364 Bacteria 4447
48 Ga0070673_100048699 3300005364 Bacteria 3306
49 Ga0070673_100341072 3300005364 Bacteria 1328
50 Ga0070673_100371090 3300005364 Bacteria 1274
51 Ga0070673_100387946 3300005364 Bacteria 1246
52 Ga0070673_100480416 3300005364 Bacteria 1121
53 Ga0070688_100833926 3300005365 Bacteria 723
54 Ga0070667_100021565 3300005367 Bacteria 5347
55 Ga0070667_100025553 3300005367 Bacteria 4910
56 Ga0070667_100163858 3300005367 Bacteria 1960
57 Ga0070667_100529486 3300005367 Bacteria 1082
58 Ga0070714_100167860 3300005435 Unclassified 1990
59 Ga0070701_10263334 3300005438 Bacteria 1046
60 Ga0070708_100284328 3300005445 Bacteria 1557
61 Ga0070663_100901011 3300005455 Bacteria 764
62 Ga0070678_100006937 3300005456 Bacteria 6682
63 Ga0070678_100020363 3300005456 Bacteria 4351
64 Ga0070678_100114754 3300005456 Bacteria 2113
65 Ga0070678_100129938 3300005456 Bacteria 1999
66 Ga0070662_100007391 3300005457 Bacteria 7120
67 Ga0070662_100018033 3300005457 Bacteria 4769
68 Ga0068867_100002336 3300005459 Bacteria 13350
69 Ga0068867_100004396 3300005459 Bacteria 9918
70 Ga0068867_100004662 3300005459 Bacteria 9645
71 Ga0068867_100010749 3300005459 Bacteria 6455
72 Ga0068867_100017302 3300005459 Bacteria 5120
73 Ga0068867_100774035 3300005459 Bacteria 854
74 Ga0070685_10571083 3300005466 Bacteria 810
75 Ga0070706_100013190 3300005467 Bacteria 7646
76 Ga0070707_100434109 3300005468 Bacteria 1274
77 Ga0070699_100209236 3300005518 Bacteria 1736
78 Ga0070684_100057588 3300005535 Bacteria 3393
79 Ga0068853_100053324 3300005539 Bacteria 3483
80 Ga0068853_100109927 3300005539 Bacteria 2448
81 Ga0068853_100127632 3300005539 Bacteria 2274
82 Ga0068853_100547769 3300005539 Bacteria 1096
83 Ga0068853_100835793 3300005539 Bacteria 883
84 Ga0070672_100005430 3300005543 Bacteria 8448
85 Ga0070672_100006558 3300005543 Bacteria 7828
86 Ga0070672_100011962 3300005543 Bacteria 6068
87 Ga0070672_100014096 3300005543 Bacteria 5658
88 Ga0070672_100023123 3300005543 Bacteria 4577
89 Ga0070672_100046972 3300005543 Bacteria 3348
90 Ga0070672_100192566 3300005543 Bacteria 1703
91 Ga0070665_100028143 3300005548 Bacteria 5660
92 Ga0070665_100556828 3300005548 Bacteria 1159
93 Ga0070704_101062663 3300005549 Bacteria 734
94 Ga0068855_100061498 3300005563 Bacteria 4387
95 Ga0070664_100049125 3300005564 Bacteria 3567
96 Ga0070664_100100514 3300005564 Bacteria 2514
97 Ga0070664_100579453 3300005564 Bacteria 1039
98 Ga0068857_100005818 3300005577 Bacteria 10530
99 Ga0068857_100032809 3300005577 Bacteria 4590
100 Ga0068857_100032823 3300005577 Bacteria 4588
101 Ga0068854_100046890 3300005578 Bacteria 3078
102 Ga0068854_100078529 3300005578 Bacteria 2432
103 Ga0068854_100658631 3300005578 Bacteria 900
104 Ga0068856_100040549 3300005614 Bacteria 4574
105 Ga0068856_100274486 3300005614 Bacteria 1702
106 Ga0068852_100174474 3300005616 Bacteria 2017
107 Ga0068852_100218130 3300005616 Bacteria 1813
108 Ga0068852_100364211 3300005616 Bacteria 1415
109 Ga0068852_100417914 3300005616 Bacteria 1322
110 Ga0068852_101022815 3300005616 Bacteria 845
111 Ga0068859_100057456 3300005617 Bacteria 3919
112 Ga0068859_100098215 3300005617 Bacteria 2982
113 Ga0068859_100179968 3300005617 Bacteria 2197
114 Ga0068859_101058299 3300005617 Bacteria 892
115 Ga0068864_100026599 3300005618 Bacteria 4880
116 Ga0068864_100034603 3300005618 Bacteria 4298
117 Ga0068864_100117254 3300005618 Bacteria 2376
118 Ga0068864_100209211 3300005618 Bacteria 1795
119 Ga0068864_100488682 3300005618 Bacteria 1183
120 Ga0068866_10024004 3300005718 Bacteria 2843
121 Ga0068866_10076369 3300005718 Bacteria 1786
122 Ga0068861_100007197 3300005719 Bacteria 7623
123 Ga0068861_100013009 3300005719 Bacteria 5816
124 Ga0068851_10023362 3300005834 Bacteria 3021
125 Ga0068851_10062308 3300005834 Bacteria 1913
126 Ga0068851_10125635 3300005834 Bacteria 1383
127 Ga0068851_10458412 3300005834 Bacteria 759
128 Ga0068870_10480258 3300005840 Bacteria 825
129 Ga0068863_100081253 3300005841 Bacteria 3070
130 Ga0068863_100114674 3300005841 Bacteria 2567
131 Ga0068863_100179110 3300005841 Bacteria 2035
132 Ga0068863_100728586 3300005841 Bacteria 987
133 Ga0068858_100032248 3300005842 Bacteria 4866
134 Ga0068858_100249105 3300005842 Bacteria 1687
135 Ga0068860_100001710 3300005843 Bacteria 23445
136 Ga0068860_100002908 3300005843 Bacteria 17738
137 Ga0068860_100483870 3300005843 Bacteria 1234
138 Ga0068862_100227262 3300005844 Bacteria 1692
139 Ga0075368_10014629 3300006042 Bacteria 2902
140 Ga0075363_100022277 3300006048 Bacteria 3202
141 Ga0075363_100176678 3300006048 Bacteria 1214
142 Ga0075364_10317560 3300006051 Bacteria 1061
143 Ga0070715_10198814 3300006163 Bacteria 1017
144 Ga0075362_10029350 3300006177 Bacteria 2369
145 Ga0075362_10047342 3300006177 Bacteria 1915
146 Ga0075362_10136391 3300006177 Bacteria 1170
147 Ga0075367_10003398 3300006178 Bacteria 7585
148 Ga0075367_10008118 3300006178 Bacteria 5420
149 Ga0075367_10054103 3300006178 Bacteria 2380
150 Ga0075366_10015836 3300006195 Bacteria 4329
151 Ga0075366_10026111 3300006195 Bacteria 3419
152 Ga0075366_10342880 3300006195 Bacteria 916
153 Ga0097621_100035713 3300006237 Bacteria 3973
154 Ga0097621_100045759 3300006237 Bacteria 3536
155 Ga0097621_100168888 3300006237 Bacteria 1884
156 Ga0075370_10000519 3300006353 Bacteria 14695
157 Ga0075370_10004616 3300006353 Bacteria 6720
158 Ga0075370_10004658 3300006353 Bacteria 6688
159 Ga0075370_10005088 3300006353 Bacteria 6480
160 Ga0075370_10022523 3300006353 Bacteria 3460
161 Ga0075370_10030077 3300006353 Bacteria 3029
162 Ga0075370_10283454 3300006353 Bacteria 984
163 Ga0075370_10346277 3300006353 Bacteria 887
164 Ga0075370_10493036 3300006353 Unclassified 739
165 Ga0068871_100132099 3300006358 Bacteria 2117
166 Ga0068871_100155407 3300006358 Unclassified 1953
167 Ga0068871_100925491 3300006358 Bacteria 809
168 Ga0075430_100477103 3300006846 Bacteria 1029
169 Ga0068865_100016577 3300006881 Bacteria 4718
170 Ga0068865_100047168 3300006881 Bacteria 2959
171 Ga0068865_100452476 3300006881 Bacteria 1062
172 Ga0097620_100057455 3300006931 Bacteria 3919
173 Ga0097620_100098215 3300006931 Bacteria 2982
174 Ga0097620_100179960 3300006931 Bacteria 2197
175 Ga0097620_101058194 3300006931 Bacteria 892
176 Ga0105240_10597290 3300009093 Bacteria 1216
177 Ga0105245_10023807 3300009098 Bacteria 5376
178 Ga0105245_10095933 3300009098 Bacteria 2736
179 Ga0105245_10208999 3300009098 Bacteria 1878
180 Ga0114129_10025979 3300009147 Bacteria 8293
181 Ga0105243_10001013 3300009148 Bacteria 25972
182 Ga0105243_10010176 3300009148 Bacteria 7152
183 Ga0105241_10082578 3300009174 Unclassified 2519
184 Ga0105241_10460618 3300009174 Bacteria 1126
185 Ga0105242_10248653 3300009176 Bacteria 1601
186 Ga0105248_10003994 3300009177 Bacteria 16307
187 Ga0105248_10066500 3300009177 Bacteria 4047
188 Ga0105248_10393162 3300009177 Bacteria 1561
189 Ga0105248_10749489 3300009177 Bacteria 1102
190 Ga0105248_10960900 3300009177 Bacteria 965
191 Ga0105237_10001435 3300009545 Bacteria 31496
192 Ga0105237_10018178 3300009545 Bacteria 7277
193 Ga0105238_10005749 3300009551 Bacteria 12267
194 Ga0105249_10044249 3300009553 Bacteria 4049
195 Ga0105239_10001553 3300010375 Bacteria 30349
196 Ga0105239_10033378 3300010375 Bacteria 5653
197 Ga0157370_10098030 3300013104 Bacteria 2750
198 Ga0157369_10053347 3300013105 Bacteria 4371
199 Ga0157369_11178506 3300013105 Bacteria 782
200 Ga0157378_10033598 3300013297 Bacteria 4536
201 Ga0163162_10006598 3300013306 Bacteria 11239
202 Ga0163162_10159454 3300013306 Bacteria 2377
203 Ga0163162_10232322 3300013306 Bacteria 1975
204 Ga0163162_10593928 3300013306 Bacteria 1234
205 Ga0163162_10658766 3300013306 Bacteria 1170
206 Ga0157372_10057147 3300013307 Bacteria 4361
207 Ga0157372_10128218 3300013307 Bacteria 2918
208 Ga0157375_10010086 3300013308 Bacteria 8306
209 Ga0157375_10034712 3300013308 Bacteria 4807
210 Ga0157375_10046443 3300013308 Bacteria 4234
211 Ga0157375_10159021 3300013308 Bacteria 2400
212 Ga0157375_10423194 3300013308 Bacteria 1498
213 Ga0163163_10000524 3300014325 Bacteria 34246
214 Ga0163163_10275283 3300014325 Bacteria 1734
215 Ga0163163_10329019 3300014325 Bacteria 1582
216 Ga0157380_10041577 3300014326 Bacteria 3588
217 Ga0157380_10122316 3300014326 Bacteria 2206
218 Ga0157380_10204039 3300014326 Bacteria 1756
219 Ga0157380_10535555 3300014326 Bacteria 1145
220 Ga0157377_10000006 3300014745 Bacteria 419853
221 Ga0157377_10162329 3300014745 Bacteria 1391
222 Ga0157379_10007142 3300014968 Bacteria 9657
223 Ga0157379_10026336 3300014968 Bacteria 5177
224 Ga0157379_10032199 3300014968 Bacteria 4673
225 Ga0157379_10046335 3300014968 Bacteria 3879
226 Ga0157379_10261844 3300014968 Bacteria 1571
227 Ga0157376_10015732 3300014969 Bacteria 5724
228 Ga0157376_10313146 3300014969 Bacteria 1490
229 Ga0157376_10340742 3300014969 Bacteria 1432
230 Ga0163161_10072629 3300017792 Bacteria 2520
231 Ga0163161_10107259 3300017792 Bacteria 2085
232 Ga0163161_10480410 3300017792 Bacteria 1009
233 Ga0213876_10035781 3300021384 Bacteria 2619
234 Ga0207425_1000905 3300025245 Bacteria 14290
235 Ga0209129_1000038 3300025258 Bacteria 322778
236 Ga0209129_1000154 3300025258 Bacteria 109449
237 Ga0209233_1009228 3300025261 Bacteria 3013
238 Ga0209673_1008207 3300025273 Bacteria 4682
239 Ga0209673_1009410 3300025273 Bacteria 4235
240 Ga0209564_1000162 3300025295 Bacteria 162265
241 Ga0209758_1000152 3300025297 Bacteria 162418
242 Ga0209758_1004256 3300025297 Bacteria 12104
243 Ga0209050_1000202 3300025298 Bacteria 133468
244 Ga0209256_1035992 3300025299 Bacteria 1302
245 Ga0209051_1042523 3300025303 Bacteria 1605
246 Ga0209257_1027771 3300025304 Bacteria 1876
247 Ga0209257_1047002 3300025304 Bacteria 1244
248 Ga0207697_10044945 3300025315 Bacteria 1817
249 Ga0207656_10029458 3300025321 Bacteria 2261
250 Ga0207682_10010639 3300025893 Bacteria 3600
251 Ga0207642_10012289 3300025899 Bacteria 3087
252 Ga0207642_10125355 3300025899 Bacteria 1332
253 Ga0207685_10193437 3300025905 Bacteria 951
254 Ga0207645_10013620 3300025907 Bacteria 5473
255 Ga0207645_10202144 3300025907 Bacteria 1307
256 Ga0207705_10026166 3300025909 Bacteria 4163
257 Ga0207705_10124012 3300025909 Bacteria 1919
258 Ga0207705_10355901 3300025909 Bacteria 1128
259 Ga0207684_10008994 3300025910 Bacteria 8856
260 Ga0207684_10046792 3300025910 Bacteria 3670
261 Ga0207654_10137993 3300025911 Bacteria 1551
262 Ga0207654_10236623 3300025911 Bacteria 1218
263 Ga0207695_10101950 3300025913 Bacteria 2864
264 Ga0207695_10131577 3300025913 Bacteria 2459
265 Ga0207671_10129088 3300025914 Bacteria 1939
266 Ga0207663_10524559 3300025916 Unclassified 923
267 Ga0207662_10016086 3300025918 Bacteria 4216
268 Ga0207662_10319990 3300025918 Bacteria 1035
269 Ga0207657_10055184 3300025919 Bacteria 3433
270 Ga0207649_10278194 3300025920 Bacteria 1216
271 Ga0207646_10056675 3300025922 Bacteria 3502
272 Ga0207681_10014947 3300025923 Bacteria 4835
273 Ga0207694_10059865 3300025924 Bacteria 2962
274 Ga0207694_11009785 3300025924 Unclassified 704
275 Ga0207650_10001509 3300025925 Bacteria 16629
276 Ga0207650_10002949 3300025925 Bacteria 11735
277 Ga0207650_10009021 3300025925 Bacteria 6819
278 Ga0207650_10329614 3300025925 Bacteria 1252
279 Ga0207650_10655027 3300025925 Bacteria 885
280 Ga0207659_10005000 3300025926 Bacteria 8035
281 Ga0207659_10014723 3300025926 Bacteria 5053
282 Ga0207659_10045449 3300025926 Bacteria 3096
283 Ga0207687_10013260 3300025927 Bacteria 5380
284 Ga0207644_10015344 3300025931 Bacteria 5140
285 Ga0207644_10024937 3300025931 Bacteria 4108
286 Ga0207644_10041298 3300025931 Bacteria 3262
287 Ga0207644_10050606 3300025931 Bacteria 2979
288 Ga0207644_10154327 3300025931 Bacteria 1779
289 Ga0207644_10171879 3300025931 Bacteria 1692
290 Ga0207644_10178513 3300025931 Bacteria 1663
291 Ga0207644_10727169 3300025931 Bacteria 828
292 Ga0207690_10158006 3300025932 Bacteria 1687
293 Ga0207690_10445961 3300025932 Bacteria 1039
294 Ga0207706_10006464 3300025933 Bacteria 10882
295 Ga0207706_10006915 3300025933 Bacteria 10492
296 Ga0207706_10392194 3300025933 Bacteria 1204
297 Ga0207709_10000918 3300025935 Bacteria 22222
298 Ga0207709_10035746 3300025935 Bacteria 2939
299 Ga0207670_10246149 3300025936 Bacteria 1379
300 Ga0207670_10606422 3300025936 Bacteria 899
301 Ga0207669_10002932 3300025937 Bacteria 7325
302 Ga0207669_10088077 3300025937 Bacteria 2012
303 Ga0207669_10172978 3300025937 Bacteria 1539
304 Ga0207704_10064898 3300025938 Bacteria 2284
305 Ga0207691_10001450 3300025940 Bacteria 23610
306 Ga0207691_10003420 3300025940 Bacteria 15434
307 Ga0207691_10013320 3300025940 Bacteria 7877
308 Ga0207691_10023385 3300025940 Bacteria 5816
309 Ga0207691_10024373 3300025940 Bacteria 5691
310 Ga0207691_10292872 3300025940 Bacteria 1399
311 Ga0207691_10334637 3300025940 Bacteria 1297
312 Ga0207711_10022609 3300025941 Bacteria 5260
313 Ga0207711_10103830 3300025941 Bacteria 2517
314 Ga0207689_10008839 3300025942 Bacteria 8749
315 Ga0207689_10063606 3300025942 Bacteria 3035
316 Ga0207689_10075066 3300025942 Bacteria 2779
317 Ga0207689_10780719 3300025942 Bacteria 806
318 Ga0207661_10150338 3300025944 Bacteria 2012
319 Ga0207679_10006305 3300025945 Bacteria 7489
320 Ga0207679_10014460 3300025945 Bacteria 5191
321 Ga0207651_10021326 3300025960 Bacteria 3935
322 Ga0207651_10027746 3300025960 Bacteria 3562
323 Ga0207651_10053388 3300025960 Bacteria 2762
324 Ga0207651_10210703 3300025960 Bacteria 1564
325 Ga0207651_10577451 3300025960 Bacteria 980
326 Ga0207712_10019369 3300025961 Bacteria 4443
327 Ga0207712_10246745 3300025961 Bacteria 1441
328 Ga0207712_10727587 3300025961 Bacteria 868
329 Ga0207668_10006769 3300025972 Bacteria 6784
330 Ga0207640_10133809 3300025981 Bacteria 1796
331 Ga0207640_10155096 3300025981 Bacteria 1687
332 Ga0207640_10491242 3300025981 Unclassified 1020
333 Ga0207658_10019709 3300025986 Bacteria 4666
334 Ga0207658_10162538 3300025986 Bacteria 1831
335 Ga0207658_10502215 3300025986 Bacteria 1080
336 Ga0207658_10503254 3300025986 Bacteria 1079
337 Ga0207677_10008949 3300026023 Bacteria 5617
338 Ga0207677_10009887 3300026023 Bacteria 5379
339 Ga0207677_10076447 3300026023 Bacteria 2384
340 Ga0207677_10101836 3300026023 Bacteria 2116
341 Ga0207703_10026556 3300026035 Bacteria 4558
342 Ga0207703_10131606 3300026035 Bacteria 2161
343 Ga0207639_10032785 3300026041 Bacteria 3827
344 Ga0207639_10289361 3300026041 Bacteria 1444
345 Ga0207639_10600380 3300026041 Bacteria 1015
346 Ga0207678_10515338 3300026067 Bacteria 1043
347 Ga0207702_10053645 3300026078 Bacteria 3414
348 Ga0207702_10089332 3300026078 Bacteria 2694
349 Ga0207641_10045920 3300026088 Bacteria 3680
350 Ga0207641_10071563 3300026088 Bacteria 2983
351 Ga0207641_10348724 3300026088 Bacteria 1410
352 Ga0207641_10391844 3300026088 Bacteria 1332
353 Ga0207641_10462974 3300026088 Bacteria 1227
354 Ga0207641_10713588 3300026088 Bacteria 988
355 Ga0207648_10000439 3300026089 Bacteria 46028
356 Ga0207648_10000936 3300026089 Bacteria 32936
357 Ga0207648_10005574 3300026089 Bacteria 12665
358 Ga0207648_10015155 3300026089 Bacteria 7095
359 Ga0207648_10027227 3300026089 Bacteria 5077
360 Ga0207648_10030658 3300026089 Bacteria 4760
361 Ga0207648_10083223 3300026089 Bacteria 2791
362 Ga0207676_10004408 3300026095 Bacteria 9951
363 Ga0207676_10028624 3300026095 Bacteria 4164
364 Ga0207676_10078525 3300026095 Bacteria 2674
365 Ga0207676_10271851 3300026095 Bacteria 1535
366 Ga0207674_10012525 3300026116 Bacteria 9476
367 Ga0207674_10122060 3300026116 Bacteria 2572
368 Ga0207674_10633212 3300026116 Bacteria 1033
369 Ga0207675_100010737 3300026118 Bacteria 8579
370 Ga0207675_100090736 3300026118 Bacteria 2873
371 Ga0207675_100351726 3300026118 Bacteria 1444
372 Ga0207683_10009710 3300026121 Bacteria 8207
373 Ga0207683_10056908 3300026121 Bacteria 3432
374 Ga0207683_10071631 3300026121 Bacteria 3064
375 Ga0207683_10140114 3300026121 Bacteria 2179
376 Ga0207698_10008831 3300026142 Bacteria 6388
377 Ga0207698_10045653 3300026142 Bacteria 3302
378 Ga0207698_10071950 3300026142 Bacteria 2746
379 Ga0207698_10340459 3300026142 Bacteria 1413
380 Ga0207698_10649096 3300026142 Unclassified 1045
381 Ga0207698_10938373 3300026142 Bacteria 874
382 Ga0209813_10085588 3300027866 Bacteria 1050
383 Ga0268266_10088047 3300028379 Bacteria 2717
384 Ga0268266_10104102 3300028379 Bacteria 2506
385 Ga0268264_10012844 3300028381 Bacteria 6892
386 Ga0268264_10099392 3300028381 Bacteria 2525
387 Ga0268264_10365218 3300028381 Bacteria 1378
388 Ga0268264_10387759 3300028381 Bacteria 1339
389 Ga0268264_10543912 3300028381 Bacteria 1138
390 Ga0307517_10025918 3300028786 Bacteria 7138
391 Ga0307515_10000109 3300028794 Bacteria 195895
392 Ga0307515_10003984 3300028794 Bacteria 30816
393 Ga0307515_10026336 3300028794 Bacteria 10016
394 Ga0307515_10072877 3300028794 Bacteria 4626
395 Ga0307512_10050741 3300030522 Bacteria 3328
396 Ga0307512_10181132 3300030522 Bacteria 1184
397 Ga0307512_10305691 3300030522 Bacteria 736
398 Ga0265320_10063660 3300031240 Bacteria 1754
399 Ga0307513_10012800 3300031456 Bacteria 10329
400 Ga0307513_10156076 3300031456 Bacteria 2182
401 Ga0307513_10559587 3300031456 Bacteria 855
402 Ga0307509_10000157 3300031507 Bacteria 106022
403 Ga0307509_10001408 3300031507 Bacteria 40683
404 Ga0307509_10029770 3300031507 Bacteria 6054
405 Ga0307509_10076765 3300031507 Bacteria 3465
406 Ga0307509_10168165 3300031507 Bacteria 2077
407 Ga0307408_100040814 3300031548 Bacteria 3288
408 Ga0307408_100479211 3300031548 Bacteria 1085
409 Ga0307508_10000237 3300031616 Bacteria 67014
410 Ga0307508_10000291 3300031616 Bacteria 61434
411 Ga0307508_10052501 3300031616 Bacteria 3620
412 Ga0307514_10002703 3300031649 Bacteria 17950
413 Ga0307514_10346786 3300031649 Bacteria 795
414 Ga0307516_10000723 3300031730 Bacteria 45058
415 Ga0307516_10144069 3300031730 Bacteria 2149
416 Ga0307405_10004869 3300031731 Bacteria 6409
417 Ga0307405_10138040 3300031731 Bacteria 1695
418 Ga0307405_10173049 3300031731 Bacteria 1542
419 Ga0307413_10047355 3300031824 Bacteria 2563
420 Ga0307518_10350242 3300031838 Bacteria 860
421 Ga0307410_10189644 3300031852 Bacteria 1562
422 Ga0307406_10024872 3300031901 Bacteria 3581
423 Ga0307406_10147016 3300031901 Bacteria 1676
424 Ga0307412_10292275 3300031911 Bacteria 1284
425 Ga0307412_10367741 3300031911 Bacteria 1160
426 Ga0307412_10396936 3300031911 Bacteria 1121
427 Ga0307409_100685375 3300031995 Bacteria 1022
428 Ga0307409_100951606 3300031995 Bacteria 875
429 Ga0307416_100166488 3300032002 Bacteria 2045
430 Ga0307416_100202106 3300032002 Bacteria 1886
431 Ga0307416_100240950 3300032002 Bacteria 1752
432 Ga0307416_100636426 3300032002 Bacteria 1150
433 Ga0307414_10227989 3300032004 Bacteria 1534
434 Ga0307411_10140987 3300032005 Bacteria 1777
435 Ga0307415_100027395 3300032126 Bacteria 3610
436 Ga0307507_10030539 3300033179 Bacteria 5682
437 Ga0307507_10036600 3300033179 Bacteria 5013
438 Ga0307507_10235578 3300033179 Bacteria 1206
439 Ga0307510_10056823 3300033180 Bacteria 4068
440 Ga0307510_10145368 3300033180 Bacteria 2004
441 Ga0307510_10324240 3300033180 Bacteria 996
442 Ga0373949_0055251 3300035090 Bacteria 1010
443 Ga0373952_0014343 3300035092 Bacteria 1585
444 Ga0373945_0033745 3300035116 Bacteria 1821
445 Ga0373946_0135184 3300035171 Bacteria 1138
446 Ga0373955_0391008 3300035172 Bacteria 844
447 Ga0373931_0205102 3300035691 Bacteria 1180
448 Ga0373935_0142049 3300035692 Bacteria 1623
449 Ga0373935_0253586 3300035692 Bacteria 1232
450 Ga0373927_0091669 3300035695 Bacteria 1974
451 Ga0373933_0115373 3300035724 Bacteria 1678
452 Ga0373937_0024322 3300036401 Bacteria 5461
453 Ga0373925_0065615 3300037068 Bacteria 2735
454 Ga0395900_0002836 3300037418 Bacteria 18919
455 Ga0395898_0021746 3300037466 Bacteria 6501
456 Ga0395905_0000078 3300037471 Bacteria 161593
457 Ga0395905_0001177 3300037471 Bacteria 32676
458 Ga0395905_0007409 3300037471 Bacteria 10909
459 Ga0395905_0028557 3300037471 Bacteria 5258
460 Ga0395905_0054613 3300037471 Bacteria 3738
461 Ga0395905_0096698 3300037471 Bacteria 2772
462 Ga0395905_0118492 3300037471 Bacteria 2488
463 Ga0395905_1301765 3300037471 Bacteria 631
464 Ga0436365_0002712 3300039437 Bacteria 6007
465 Ga0436365_0306544 3300039437 Bacteria 1737
466 Ga0439461_0044131 3300041410 Bacteria 972
467 Ga0451843_1104350 3300041509 Bacteria 727
468 Ga0439431_0017356 3300041997 Bacteria 1691
469 Ga0466969_0000010 3300044656 Bacteria 117215
470 Ga0466969_0005174 3300044656 Bacteria 6935
471 Ga0466969_0070406 3300044656 Bacteria 1682
472 Ga0466969_0211406 3300044656 Bacteria 883
473 Ga0466972_0000231 3300044658 Bacteria 38797
474 Ga0466972_0001299 3300044658 Bacteria 12074
475 Ga0466972_0035506 3300044658 Bacteria 2439
476 Ga0466972_0283307 3300044658 Bacteria 774
477 Ga0466965_0003639 3300044683 Bacteria 6790
478 Ga0466965_0043499 3300044683 Bacteria 2217
479 Ga0466966_0007831 3300044684 Bacteria 7071
480 Ga0466966_0043768 3300044684 Bacteria 2868
481 Ga0466961_0002667 3300044693 Bacteria 11070
482 Ga0466961_0063227 3300044693 Bacteria 2351
483 Ga0466961_0073919 3300044693 Bacteria 2161
484 Ga0466963_0101521 3300044694 Bacteria 1969
485 Ga0466964_0022474 3300044706 Bacteria 2447
486 Ga0466964_0031942 3300044706 Bacteria 2090
487 Ga0466964_0050406 3300044706 Bacteria 1706
488 Ga0466971_0397136 3300044719 Bacteria 672
489 Ga0466968_0006862 3300044735 Bacteria 4309
490 Ga0466968_0040857 3300044735 Bacteria 1956
491 Ga0466970_0002900 3300044765 Bacteria 8310
492 Ga0466970_0185682 3300044765 Bacteria 1154
493 Ga0466970_0215940 3300044765 Bacteria 1069
494 Ga0466970_0313634 3300044765 Bacteria 886
495 Ga0466957_0110896 3300044842 Bacteria 1739
496 Ga0466957_0161795 3300044842 Bacteria 1454
497 Ga0466959_0000169 3300045049 Bacteria 43342
498 Ga0466959_0011339 3300045049 Bacteria 6402
499 Ga0466959_0025563 3300045049 Bacteria 4377
500 Ga0466958_0151575 3300045836 Bacteria 1462
501 Ga0466967_0436208 3300045976 Bacteria 1278
502 Ga0466967_0939819 3300045976 Bacteria 860
503 Ga0495592_0000350 3300046454 Bacteria 37566
504 Ga0495592_0159446 3300046454 Bacteria 1554
505 Ga0495629_0044220 3300046459 Bacteria 3126
506 Ga0495651_0525777 3300046462 Bacteria 754
507 Ga0495606_0398380 3300046507 Bacteria 718
508 Ga0495618_0218775 3300046514 Bacteria 1202
509 Ga0495628_0389477 3300046516 Bacteria 1020
510 Ga0495632_0033886 3300046519 Bacteria 2618
511 Ga0495632_0142380 3300046519 Bacteria 1111
512 Ga0495643_0134961 3300046522 Bacteria 1236
513 Ga0495666_0031176 3300046526 Bacteria 2613
514 Ga0495645_0110568 3300046543 Bacteria 1945
515 Ga0495625_0086404 3300046660 Bacteria 2176
516 Ga0495657_0295898 3300046675 Bacteria 966
517 Ga0495647_0057243 3300046681 Bacteria 1530
518 Ga0495658_0034403 3300046683 Bacteria 2780
519 Ga0495658_0044914 3300046683 Bacteria 2477
520 Ga0495658_0087843 3300046683 Bacteria 1836
521 Ga0495671_0077336 3300046692 Bacteria 1631
522 Ga0495604_0643368 3300047317 Bacteria 677
523 Ga0495674_0475968 3300047319 Bacteria 1001
524 Ga0495687_000070 3300047443 Bacteria 159227
525 Ga0495684_0092845 3300047471 Bacteria 2286
526 Ga0496101_0319700 3300048904 Bacteria 1217
527 Ga0496102_0006709 3300048905 Bacteria 9831
528 Ga0496104_0101794 3300048907 Bacteria 2751
529 Ga0496104_1492513 3300048907 Bacteria 579
530 Ga0496108_0173708 3300048911 Bacteria 1865
531 Ga0496108_0182722 3300048911 Bacteria 1816
532 Ga0496108_0461946 3300048911 Bacteria 1109
533 Ga0496109_0130651 3300048912 Bacteria 2344
534 Ga0496109_0511104 3300048912 Bacteria 1134
535 Ga0496110_0252897 3300048913 Bacteria 1604
536 Ga0496110_0339284 3300048913 Bacteria 1369
537 Ga0496111_0471242 3300048914 Bacteria 926
538 Ga0496112_0038517 3300048915 Bacteria 4668
539 Ga0496113_0219898 3300048916 Bacteria 1513
540 Ga0496113_0747297 3300048916 Unclassified 779
541 Ga0496114_0094562 3300048917 Bacteria 2542
542 Ga0496125_0241988 3300048928 Bacteria 1145
543 Ga0501300_017303 3300049523 Bacteria 1052
544 Ga0501303_022921 3300049526 Bacteria 678
545 Ga0501034_0089826 3300049571 Bacteria 3070
546 Ga0501036_0273193 3300049572 Bacteria 1415
547 Ga0501037_0698921 3300049573 Bacteria 675
548 Ga0501043_0048842 3300049579 Bacteria 3326
549 Ga0501046_0327396 3300049580 Bacteria 1115
550 Ga0501073_0091268 3300049589 Bacteria 2117
551 Ga0501206_015943 3300049653 Bacteria 1042
552 Ga0501080_0147212 3300049742 Bacteria 2177
553 Ga0501265_007902 3300049762 Bacteria 1259
554 nmdc:mga03n38_61554_c1 3300050490 Bacteria 1710
555 nmdc:mga0yw44_162213_c1 3300050492 Bacteria 1464
556 nmdc:mga0yw44_49238_c1 3300050492 Bacteria 2542
557 nmdc:mga0k408_137755_c1 3300050493 Bacteria 1451
558 nmdc:mga0k408_59828_c1 3300050493 Bacteria 2214
559 nmdc:mga0k408_62782_c1 3300050493 Bacteria 2161
560 nmdc:mga0k408_80165_c1 3300050493 Bacteria 1910
561 nmdc:mga06z11_10448_c1 3300050494 Bacteria 3959
562 nmdc:mga06z11_60682_c1 3300050494 Bacteria 1970
563 nmdc:mga04h51_32983_c1 3300050495 Bacteria 1646
564 nmdc:mga07m45_13444_c1 3300050496 Bacteria 4345
565 nmdc:mga07m45_186627_c1 3300050496 Bacteria 1206
566 nmdc:mga07m45_1976_c1 3300050496 Bacteria 9492
567 nmdc:mga07m45_24997_c1 3300050496 Bacteria 3274
568 nmdc:mga07m45_43128_c1 3300050496 Bacteria 2529
569 nmdc:mga07m45_97434_c1 3300050496 Bacteria 1688
570 nmdc:mga05p37_42453_c1 3300050507 Bacteria 5587
571 nmdc:mga0sz30_42072_c1 3300050516 Bacteria 1337
572 Ga0495612_0186495 3300053078 Bacteria 912
573 Ga0500578_0000327 3300053086 Bacteria 57988
574 Ga0500583_0013937 3300053092 Bacteria 3130
575 Ga0500583_0221545 3300053092 Bacteria 938
576 Ga0500628_025429 3300053129 Bacteria 1238
577 Ga0500655_013867 3300053133 Bacteria 1473
578 Ga0500561_0131941 3300053137 Bacteria 769
579 Ga0500564_162004 3300053138 Bacteria 946
580 Ga0500568_0016606 3300053139 Bacteria 3267
581 Ga0500577_0008593 3300053142 Bacteria 2921
582 Ga0500590_055769 3300053148 Bacteria 1998
583 Ga0500604_0088755 3300053151 Bacteria 1007
584 Ga0500622_0000293 3300053156 Bacteria 51215
585 Ga0500584_117047 3300053726 Bacteria 1065
586 Ga0466962_0027022 3300061719 Bacteria 2755
587 Ga0466962_0066086 3300061719 Bacteria 1726
588 Ga0466962_0264052 3300061719 Bacteria 848
589 Ga0466962_0295130 3300061719 Bacteria 801

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_1492513 Ga0496104_1492513_27_515 162
2 3300005330 Ga0070690_100342553 Ga0070690_1003425531 187
3 3300009174 Ga0105241_10082578 Ga0105241_100825785 187
4 3300013307 Ga0157372_10128218 Ga0157372_101282182 187
5 3300025932 Ga0207690_10445961 Ga0207690_104459612 187
6 3300049571 Ga0501034_0089826 Ga0501034_0089826_24_593 187
7 3300049572 Ga0501036_0273193 Ga0501036_0273193_399_968 187
8 3300049573 Ga0501037_0698921 Ga0501037_0698921_54_623 187
9 3300049579 Ga0501043_0048842 Ga0501043_0048842_530_1099 187
10 3300049580 Ga0501046_0327396 Ga0501046_0327396_272_841 187
11 3300049589 Ga0501073_0091268 Ga0501073_0091268_871_1440 187
12 3300049742 Ga0501080_0147212 Ga0501080_0147212_1194_1763 187
13 iso_pu_bacteria 2585428058 2587732529 187
14 3300005331 Ga0070670_100593974 Ga0070670_1005939742 188
15 3300005338 Ga0068868_100055847 Ga0068868_1000558473 188
16 3300005356 Ga0070674_100008283 Ga0070674_1000082836 188
17 3300005364 Ga0070673_100371090 Ga0070673_1003710902 188
18 3300005365 Ga0070688_100833926 Ga0070688_1008339261 188
19 3300005367 Ga0070667_100021565 Ga0070667_1000215652 188
20 3300005435 Ga0070714_100167860 Ga0070714_1001678602 188
21 3300005456 Ga0070678_100006937 Ga0070678_1000069374 188
22 3300005543 Ga0070672_100192566 Ga0070672_1001925662 188
23 3300005548 Ga0070665_100028143 Ga0070665_1000281434 188
24 3300005563 Ga0068855_100061498 Ga0068855_1000614985 188
25 3300005841 Ga0068863_100728586 Ga0068863_1007285861 188
26 3300006358 Ga0068871_100155407 Ga0068871_1001554073 188
27 3300006881 Ga0068865_100047168 Ga0068865_1000471684 188
28 3300009177 Ga0105248_10960900 Ga0105248_109609002 188
29 3300013105 Ga0157369_10053347 Ga0157369_100533473 188
30 3300013306 Ga0163162_10658766 Ga0163162_106587662 188
31 3300013308 Ga0157375_10046443 Ga0157375_100464435 188
32 3300013308 Ga0157375_10423194 Ga0157375_104231942 188
33 3300014969 Ga0157376_10015732 Ga0157376_100157322 188
34 3300017792 Ga0163161_10480410 Ga0163161_104804102 188
35 3300025916 Ga0207663_10524559 Ga0207663_105245592 188
36 3300025925 Ga0207650_10655027 Ga0207650_106550272 188
37 3300025936 Ga0207670_10246149 Ga0207670_102461492 188
38 3300025936 Ga0207670_10606422 Ga0207670_106064222 188
39 3300025937 Ga0207669_10002932 Ga0207669_100029322 188
40 3300025940 Ga0207691_10292872 Ga0207691_102928722 188
41 3300025960 Ga0207651_10577451 Ga0207651_105774511 188
42 3300025961 Ga0207712_10727587 Ga0207712_107275872 188
43 3300025986 Ga0207658_10162538 Ga0207658_101625382 188
44 3300026023 Ga0207677_10076447 Ga0207677_100764472 188
45 3300026088 Ga0207641_10713588 Ga0207641_107135881 188
46 3300026121 Ga0207683_10009710 Ga0207683_100097107 188
47 3300028379 Ga0268266_10088047 Ga0268266_100880472 188
48 3300030522 Ga0307512_10181132 Ga0307512_101811322 188
49 3300030522 Ga0307512_10305691 Ga0307512_103056911 188
50 3300031507 Ga0307509_10000157 Ga0307509_100001572 188
51 3300031507 Ga0307509_10001408 Ga0307509_1000140812 188
52 3300031616 Ga0307508_10000291 Ga0307508_1000029110 188
53 3300031649 Ga0307514_10346786 Ga0307514_103467861 188
54 3300031838 Ga0307518_10350242 Ga0307518_103502422 188
55 3300033179 Ga0307507_10235578 Ga0307507_102355782 188
56 3300033180 Ga0307510_10056823 Ga0307510_100568232 188
57 3300033180 Ga0307510_10145368 Ga0307510_101453682 188
58 3300033180 Ga0307510_10324240 Ga0307510_103242402 188
59 3300037418 Ga0395900_0002836 Ga0395900_0002836_11533_12108 188
60 3300037466 Ga0395898_0021746 Ga0395898_0021746_2012_2587 188
61 3300037471 Ga0395905_0118492 Ga0395905_0118492_302_883 188
62 3300037471 Ga0395905_1301765 Ga0395905_1301765_26_601 188
63 3300041410 Ga0439461_0044131 Ga0439461_0044131_179_745 188
64 3300041997 Ga0439431_0017356 Ga0439431_0017356_936_1502 188
65 3300044656 Ga0466969_0005174 Ga0466969_0005174_18_599 188
66 3300044658 Ga0466972_0000231 Ga0466972_0000231_13028_13597 188
67 3300044658 Ga0466972_0035506 Ga0466972_0035506_1542_2111 188
68 3300044683 Ga0466965_0003639 Ga0466965_0003639_2448_3017 188
69 3300044684 Ga0466966_0007831 Ga0466966_0007831_489_1070 188
70 3300044693 Ga0466961_0073919 Ga0466961_0073919_1490_2071 188
71 3300044706 Ga0466964_0022474 Ga0466964_0022474_92_661 188
72 3300044706 Ga0466964_0031942 Ga0466964_0031942_318_887 188
73 3300044735 Ga0466968_0006862 Ga0466968_0006862_2962_3531 188
74 3300044735 Ga0466968_0040857 Ga0466968_0040857_1036_1605 188
75 3300044765 Ga0466970_0215940 Ga0466970_0215940_16_597 188
76 3300045049 Ga0466959_0011339 Ga0466959_0011339_521_1102 188
77 3300046454 Ga0495592_0000350 Ga0495592_0000350_11014_11640 188
78 3300046519 Ga0495632_0142380 Ga0495632_0142380_462_1040 188
79 3300047317 Ga0495604_0643368 Ga0495604_0643368_10_588 188
80 3300048904 Ga0496101_0319700 Ga0496101_0319700_88_666 188
81 3300048914 Ga0496111_0471242 Ga0496111_0471242_201_776 188
82 3300053092 Ga0500583_0013937 Ga0500583_0013937_2469_3047 188
83 3300053138 Ga0500564_162004 Ga0500564_162004_74_700 188
84 3300005331 Ga0070670_100331550 Ga0070670_1003315502 189
85 3300005355 Ga0070671_100020822 Ga0070671_1000208224 189
86 3300005364 Ga0070673_100480416 Ga0070673_1004804162 189
87 3300005445 Ga0070708_100284328 Ga0070708_1002843282 189
88 3300005456 Ga0070678_100114754 Ga0070678_1001147542 189
89 3300005618 Ga0068864_100117254 Ga0068864_1001172543 189
90 3300006237 Ga0097621_100035713 Ga0097621_1000357131 189
91 3300009147 Ga0114129_10025979 Ga0114129_100259793 189
92 3300009177 Ga0105248_10066500 Ga0105248_100665003 189
93 3300014325 Ga0163163_10275283 Ga0163163_102752832 189
94 3300025925 Ga0207650_10329614 Ga0207650_103296142 189
95 3300025931 Ga0207644_10041298 Ga0207644_100412982 189
96 3300025941 Ga0207711_10022609 Ga0207711_100226094 189
97 3300026095 Ga0207676_10028624 Ga0207676_100286244 189
98 3300028794 Ga0307515_10072877 Ga0307515_100728773 189
99 3300031240 Ga0265320_10063660 Ga0265320_100636602 189
100 3300031507 Ga0307509_10076765 Ga0307509_100767653 189
101 3300031616 Ga0307508_10052501 Ga0307508_100525012 189
102 3300033179 Ga0307507_10030539 Ga0307507_100305392 189
103 3300037068 Ga0373925_0065615 Ga0373925_0065615_1778_2446 189
104 3300037471 Ga0395905_0028557 Ga0395905_0028557_623_1201 189
105 3300044765 Ga0466970_0313634 Ga0466970_0313634_296_874 189
106 3300046507 Ga0495606_0398380 Ga0495606_0398380_79_684 189
107 3300046526 Ga0495666_0031176 Ga0495666_0031176_809_1390 189
108 3300046660 Ga0495625_0086404 Ga0495625_0086404_1044_1625 189
109 3300046681 Ga0495647_0057243 Ga0495647_0057243_507_1175 189
110 3300046683 Ga0495658_0034403 Ga0495658_0034403_997_1578 189
111 3300048911 Ga0496108_0461946 Ga0496108_0461946_277_915 189
112 3300050493 nmdc:mga0k408_80165_c1 nmdc:mga0k408_80165_c1_227_805 189
113 3300050507 nmdc:mga05p37_42453_c1 nmdc:mga05p37_42453_c1_1197_1766 189
114 3300061719 Ga0466962_0264052 Ga0466962_0264052_199_777 189
115 iso_pu_bacteria 2751185846 2753569314 189
116 3300005356 Ga0070674_100056094 Ga0070674_1000560941 190
117 3300005459 Ga0068867_100004396 Ga0068867_1000043965 190
118 3300005543 Ga0070672_100014096 Ga0070672_1000140967 190
119 3300005616 Ga0068852_101022815 Ga0068852_1010228152 190
120 3300005617 Ga0068859_100098215 Ga0068859_1000982152 190
121 3300005617 Ga0068859_100179968 Ga0068859_1001799684 190
122 3300005617 Ga0068859_101058299 Ga0068859_1010582992 190
123 3300005718 Ga0068866_10076369 Ga0068866_100763692 190
124 3300005719 Ga0068861_100013009 Ga0068861_1000130098 190
125 3300005841 Ga0068863_100179110 Ga0068863_1001791104 190
126 3300005842 Ga0068858_100249105 Ga0068858_1002491051 190
127 3300005843 Ga0068860_100001710 Ga0068860_10000171021 190
128 3300006177 Ga0075362_10029350 Ga0075362_100293501 190
129 3300006178 Ga0075367_10054103 Ga0075367_100541033 190
130 3300006237 Ga0097621_100045759 Ga0097621_1000457595 190
131 3300006353 Ga0075370_10493036 Ga0075370_104930361 190
132 3300006358 Ga0068871_100925491 Ga0068871_1009254912 190
133 3300006846 Ga0075430_100477103 Ga0075430_1004771032 190
134 3300006881 Ga0068865_100016577 Ga0068865_1000165773 190
135 3300006931 Ga0097620_100098215 Ga0097620_1000982152 190
136 3300006931 Ga0097620_100179960 Ga0097620_1001799601 190
137 3300006931 Ga0097620_101058194 Ga0097620_1010581942 190
138 3300009545 Ga0105237_10018178 Ga0105237_100181788 190
139 3300013297 Ga0157378_10033598 Ga0157378_100335982 190
140 3300013306 Ga0163162_10006598 Ga0163162_100065985 190
141 3300013306 Ga0163162_10232322 Ga0163162_102323222 190
142 3300013308 Ga0157375_10159021 Ga0157375_101590213 190
143 3300014325 Ga0163163_10000524 Ga0163163_100005244 190
144 3300014326 Ga0157380_10041577 Ga0157380_100415775 190
145 3300014745 Ga0157377_10162329 Ga0157377_101623292 190
146 3300014968 Ga0157379_10046335 Ga0157379_100463355 190
147 3300014968 Ga0157379_10261844 Ga0157379_102618442 190
148 3300017792 Ga0163161_10072629 Ga0163161_100726293 190
149 3300025931 Ga0207644_10178513 Ga0207644_101785132 190
150 3300025937 Ga0207669_10172978 Ga0207669_101729782 190
151 3300025940 Ga0207691_10023385 Ga0207691_100233857 190
152 3300025942 Ga0207689_10063606 Ga0207689_100636064 190
153 3300025961 Ga0207712_10246745 Ga0207712_102467451 190
154 3300026035 Ga0207703_10131606 Ga0207703_101316062 190
155 3300026089 Ga0207648_10000439 Ga0207648_1000043935 190
156 3300026095 Ga0207676_10078525 Ga0207676_100785253 190
157 3300026118 Ga0207675_100090736 Ga0207675_1000907363 190
158 3300026142 Ga0207698_10938373 Ga0207698_109383731 190
159 3300028381 Ga0268264_10387759 Ga0268264_103877592 190
160 3300028381 Ga0268264_10543912 Ga0268264_105439122 190
161 3300028794 Ga0307515_10000109 Ga0307515_1000010994 190
162 3300028794 Ga0307515_10003984 Ga0307515_100039844 190
163 3300030522 Ga0307512_10050741 Ga0307512_100507412 190
164 3300031456 Ga0307513_10012800 Ga0307513_100128005 190
165 3300031507 Ga0307509_10029770 Ga0307509_100297704 190
166 3300031616 Ga0307508_10000237 Ga0307508_1000023751 190
167 3300031649 Ga0307514_10002703 Ga0307514_100027038 190
168 3300031995 Ga0307409_100951606 Ga0307409_1009516061 190
169 3300033179 Ga0307507_10036600 Ga0307507_100366005 190
170 3300035090 Ga0373949_0055251 Ga0373949_0055251_334_924 190
171 3300046692 Ga0495671_0077336 Ga0495671_0077336_946_1533 190
172 3300050493 nmdc:mga0k408_59828_c1 nmdc:mga0k408_59828_c1_1431_2030 190
173 3300053086 Ga0500578_0000327 Ga0500578_0000327_24187_24792 190
174 3300003322 rootL2_10058867 rootL2_100588673 191
175 3300005614 Ga0068856_100274486 Ga0068856_1002744862 191
176 3300006048 Ga0075363_100176678 Ga0075363_1001766782 191
177 3300006177 Ga0075362_10136391 Ga0075362_101363911 191
178 3300006195 Ga0075366_10015836 Ga0075366_100158362 191
179 3300006353 Ga0075370_10004616 Ga0075370_100046162 191
180 3300013105 Ga0157369_11178506 Ga0157369_111785061 191
181 3300025261 Ga0209233_1009228 Ga0209233_10092282 191
182 3300026078 Ga0207702_10053645 Ga0207702_100536454 191
183 3300026116 Ga0207674_10122060 Ga0207674_101220604 191
184 3300035171 Ga0373946_0135184 Ga0373946_0135184_269_886 191
185 3300035692 Ga0373935_0253586 Ga0373935_0253586_59_676 191
186 3300035724 Ga0373933_0115373 Ga0373933_0115373_21_638 191
187 3300036401 Ga0373937_0024322 Ga0373937_0024322_4076_4693 191
188 3300046459 Ga0495629_0044220 Ga0495629_0044220_685_1302 191
189 3300046462 Ga0495651_0525777 Ga0495651_0525777_93_710 191
190 3300046514 Ga0495618_0218775 Ga0495618_0218775_273_890 191
191 3300046516 Ga0495628_0389477 Ga0495628_0389477_226_843 191
192 3300046519 Ga0495632_0033886 Ga0495632_0033886_311_886 191
193 3300046675 Ga0495657_0295898 Ga0495657_0295898_215_832 191
194 3300046683 Ga0495658_0044914 Ga0495658_0044914_1274_1891 191
195 3300047319 Ga0495674_0475968 Ga0495674_0475968_368_985 191
196 3300047471 Ga0495684_0092845 Ga0495684_0092845_256_873 191
197 3300050496 nmdc:mga07m45_24997_c1 nmdc:mga07m45_24997_c1_1472_2047 191
198 3300053092 Ga0500583_0221545 Ga0500583_0221545_109_684 191
199 3300053129 Ga0500628_025429 Ga0500628_025429_383_958 191
200 3300053133 Ga0500655_013867 Ga0500655_013867_510_1085 191
201 3300053139 Ga0500568_0016606 Ga0500568_0016606_2440_3015 191
202 3300053142 Ga0500577_0008593 Ga0500577_0008593_905_1480 191
203 3300053151 Ga0500604_0088755 Ga0500604_0088755_80_655 191
204 3300053156 Ga0500622_0000293 Ga0500622_0000293_46444_47019 191
205 iso_pu_bacteria 2585428057 2587728842 191
206 3300014326 Ga0157380_10204039 Ga0157380_102040392 192
207 3300026089 Ga0207648_10083223 Ga0207648_100832232 192
208 3300041509 Ga0451843_1104350 Ga0451843_1104350_62_646 192
209 3300044656 Ga0466969_0070406 Ga0466969_0070406_499_1095 192
210 3300044693 Ga0466961_0002667 Ga0466961_0002667_1084_1680 192
211 3300044842 Ga0466957_0161795 Ga0466957_0161795_207_803 192
212 3300045976 Ga0466967_0939819 Ga0466967_0939819_143_739 192
213 3300046454 Ga0495592_0159446 Ga0495592_0159446_210_794 192
214 3300050492 nmdc:mga0yw44_162213_c1 nmdc:mga0yw44_162213_c1_359_952 192
215 3300053148 Ga0500590_055769 Ga0500590_055769_1025_1609 192
216 3300061719 Ga0466962_0027022 Ga0466962_0027022_931_1527 192
217 3300005355 Ga0070671_100067021 Ga0070671_1000670214 193
218 3300005459 Ga0068867_100002336 Ga0068867_10000233616 193
219 3300005467 Ga0070706_100013190 Ga0070706_1000131902 193
220 3300005468 Ga0070707_100434109 Ga0070707_1004341092 193
221 3300005549 Ga0070704_101062663 Ga0070704_1010626632 193
222 3300005616 Ga0068852_100218130 Ga0068852_1002181302 193
223 3300005618 Ga0068864_100209211 Ga0068864_1002092113 193
224 3300009148 Ga0105243_10001013 Ga0105243_100010136 193
225 3300009177 Ga0105248_10003994 Ga0105248_100039948 193
226 3300014745 Ga0157377_10000006 Ga0157377_1000000679 193
227 3300025910 Ga0207684_10046792 Ga0207684_100467922 193
228 3300025920 Ga0207649_10278194 Ga0207649_102781941 193
229 3300025931 Ga0207644_10171879 Ga0207644_101718792 193
230 3300025935 Ga0207709_10000918 Ga0207709_1000091823 193
231 3300025941 Ga0207711_10103830 Ga0207711_101038302 193
232 3300026089 Ga0207648_10000936 Ga0207648_1000093635 193
233 3300026142 Ga0207698_10008831 Ga0207698_100088317 193
234 3300028381 Ga0268264_10099392 Ga0268264_100993923 193
235 3300031731 Ga0307405_10138040 Ga0307405_101380402 193
236 3300031731 Ga0307405_10173049 Ga0307405_101730492 193
237 3300031901 Ga0307406_10024872 Ga0307406_100248721 193
238 3300031911 Ga0307412_10292275 Ga0307412_102922752 193
239 3300032002 Ga0307416_100166488 Ga0307416_1001664882 193
240 3300032002 Ga0307416_100240950 Ga0307416_1002409502 193
241 3300032126 Ga0307415_100027395 Ga0307415_1000273953 193
242 3300035116 Ga0373945_0033745 Ga0373945_0033745_121_753 193
243 3300037471 Ga0395905_0001177 Ga0395905_0001177_12012_12602 193
244 3300037471 Ga0395905_0096698 Ga0395905_0096698_1220_1846 193
245 3300044656 Ga0466969_0000010 Ga0466969_0000010_50981_51658 193
246 3300044656 Ga0466969_0211406 Ga0466969_0211406_244_846 193
247 3300044684 Ga0466966_0043768 Ga0466966_0043768_244_846 193
248 3300044693 Ga0466961_0063227 Ga0466961_0063227_1180_1857 193
249 3300044694 Ga0466963_0101521 Ga0466963_0101521_1046_1648 193
250 3300044706 Ga0466964_0050406 Ga0466964_0050406_564_1166 193
251 3300044719 Ga0466971_0397136 Ga0466971_0397136_32_622 193
252 3300044765 Ga0466970_0002900 Ga0466970_0002900_303_905 193
253 3300044765 Ga0466970_0185682 Ga0466970_0185682_143_820 193
254 3300044842 Ga0466957_0110896 Ga0466957_0110896_237_839 193
255 3300045049 Ga0466959_0000169 Ga0466959_0000169_17490_18092 193
256 3300045049 Ga0466959_0025563 Ga0466959_0025563_3678_4355 193
257 3300045836 Ga0466958_0151575 Ga0466958_0151575_687_1289 193
258 3300045976 Ga0466967_0436208 Ga0466967_0436208_183_785 193
259 3300048905 Ga0496102_0006709 Ga0496102_0006709_3980_4564 193
260 3300048907 Ga0496104_0101794 Ga0496104_0101794_446_1033 193
261 3300048911 Ga0496108_0182722 Ga0496108_0182722_859_1446 193
262 3300048915 Ga0496112_0038517 Ga0496112_0038517_684_1271 193
263 3300048916 Ga0496113_0219898 Ga0496113_0219898_849_1436 193
264 3300049523 Ga0501300_017303 Ga0501300_017303_62_646 193
265 3300049526 Ga0501303_022921 Ga0501303_022921_33_617 193
266 3300049653 Ga0501206_015943 Ga0501206_015943_301_885 193
267 3300049762 Ga0501265_007902 Ga0501265_007902_545_1129 193
268 3300053078 Ga0495612_0186495 Ga0495612_0186495_87_719 193
269 3300061719 Ga0466962_0066086 Ga0466962_0066086_561_1163 193
270 3300061719 Ga0466962_0295130 Ga0466962_0295130_69_659 193
271 iso_pu_bacteria 2588253510 2588291867 193
272 3300003215 JGI25153J46596_10007019 JGI25153J46596_100070198 194
273 3300005331 Ga0070670_100006074 Ga0070670_1000060743 194
274 3300005354 Ga0070675_100031570 Ga0070675_1000315702 194
275 3300005364 Ga0070673_100387946 Ga0070673_1003879462 194
276 3300005543 Ga0070672_100046972 Ga0070672_1000469723 194
277 3300005618 Ga0068864_100488682 Ga0068864_1004886822 194
278 3300005841 Ga0068863_100114674 Ga0068863_1001146743 194
279 3300009177 Ga0105248_10393162 Ga0105248_103931622 194
280 3300014325 Ga0163163_10329019 Ga0163163_103290192 194
281 3300017792 Ga0163161_10107259 Ga0163161_101072593 194
282 3300021384 Ga0213876_10035781 Ga0213876_100357812 194
283 3300025297 Ga0209758_1004256 Ga0209758_10042561 194
284 3300025909 Ga0207705_10124012 Ga0207705_101240123 194
285 3300025925 Ga0207650_10002949 Ga0207650_1000294911 194
286 3300025926 Ga0207659_10045449 Ga0207659_100454494 194
287 3300025931 Ga0207644_10050606 Ga0207644_100506064 194
288 3300025933 Ga0207706_10006464 Ga0207706_100064648 194
289 3300026088 Ga0207641_10348724 Ga0207641_103487242 194
290 3300026088 Ga0207641_10462974 Ga0207641_104629742 194
291 3300035092 Ga0373952_0014343 Ga0373952_0014343_963_1559 194
292 3300035172 Ga0373955_0391008 Ga0373955_0391008_174_812 194
293 3300035692 Ga0373935_0142049 Ga0373935_0142049_512_1150 194
294 3300037471 Ga0395905_0007409 Ga0395905_0007409_8210_8806 194
295 3300039437 Ga0436365_0002712 Ga0436365_0002712_3955_4572 194
296 3300044658 Ga0466972_0001299 Ga0466972_0001299_1364_1969 194
297 3300046683 Ga0495658_0087843 Ga0495658_0087843_621_1259 194
298 3300048913 Ga0496110_0252897 Ga0496110_0252897_417_1055 194
299 3300005328 Ga0070676_10020755 Ga0070676_100207551 195
300 3300005331 Ga0070670_100008070 Ga0070670_1000080704 195
301 3300005331 Ga0070670_100077964 Ga0070670_1000779641 195
302 3300005331 Ga0070670_100129878 Ga0070670_1001298782 195
303 3300005331 Ga0070670_100452825 Ga0070670_1004528252 195
304 3300005333 Ga0070677_10020310 Ga0070677_100203102 195
305 3300005334 Ga0068869_100017350 Ga0068869_1000173506 195
306 3300005335 Ga0070666_10146727 Ga0070666_101467272 195
307 3300005337 Ga0070682_100474233 Ga0070682_1004742331 195
308 3300005338 Ga0068868_100022466 Ga0068868_1000224663 195
309 3300005338 Ga0068868_100034136 Ga0068868_1000341361 195
310 3300005338 Ga0068868_100375780 Ga0068868_1003757802 195
311 3300005339 Ga0070660_100182252 Ga0070660_1001822522 195
312 3300005339 Ga0070660_100230035 Ga0070660_1002300352 195
313 3300005343 Ga0070687_100006034 Ga0070687_1000060341 195
314 3300005344 Ga0070661_100001667 Ga0070661_1000016676 195
315 3300005344 Ga0070661_100447340 Ga0070661_1004473402 195
316 3300005347 Ga0070668_100003853 Ga0070668_1000038532 195
317 3300005353 Ga0070669_100005123 Ga0070669_1000051235 195
318 3300005354 Ga0070675_100011995 Ga0070675_1000119954 195
319 3300005354 Ga0070675_100018260 Ga0070675_1000182605 195
320 3300005354 Ga0070675_100050187 Ga0070675_1000501871 195
321 3300005355 Ga0070671_100023972 Ga0070671_1000239723 195
322 3300005355 Ga0070671_100028965 Ga0070671_1000289655 195
323 3300005355 Ga0070671_100132032 Ga0070671_1001320323 195
324 3300005356 Ga0070674_100039156 Ga0070674_1000391563 195
325 3300005356 Ga0070674_100046859 Ga0070674_1000468593 195
326 3300005356 Ga0070674_100053652 Ga0070674_1000536523 195
327 3300005364 Ga0070673_100003566 Ga0070673_1000035665 195
328 3300005364 Ga0070673_100007794 Ga0070673_1000077943 195
329 3300005364 Ga0070673_100024223 Ga0070673_1000242232 195
330 3300005364 Ga0070673_100048699 Ga0070673_1000486992 195
331 3300005364 Ga0070673_100341072 Ga0070673_1003410721 195
332 3300005367 Ga0070667_100025553 Ga0070667_1000255533 195
333 3300005367 Ga0070667_100163858 Ga0070667_1001638583 195
334 3300005367 Ga0070667_100529486 Ga0070667_1005294861 195
335 3300005438 Ga0070701_10263334 Ga0070701_102633342 195
336 3300005455 Ga0070663_100901011 Ga0070663_1009010111 195
337 3300005456 Ga0070678_100020363 Ga0070678_1000203632 195
338 3300005456 Ga0070678_100129938 Ga0070678_1001299382 195
339 3300005457 Ga0070662_100007391 Ga0070662_1000073918 195
340 3300005457 Ga0070662_100018033 Ga0070662_1000180335 195
341 3300005459 Ga0068867_100004662 Ga0068867_1000046623 195
342 3300005459 Ga0068867_100010749 Ga0068867_1000107493 195
343 3300005459 Ga0068867_100017302 Ga0068867_1000173024 195
344 3300005459 Ga0068867_100774035 Ga0068867_1007740351 195
345 3300005466 Ga0070685_10571083 Ga0070685_105710831 195
346 3300005518 Ga0070699_100209236 Ga0070699_1002092362 195
347 3300005535 Ga0070684_100057588 Ga0070684_1000575883 195
348 3300005539 Ga0068853_100053324 Ga0068853_1000533243 195
349 3300005539 Ga0068853_100109927 Ga0068853_1001099272 195
350 3300005539 Ga0068853_100127632 Ga0068853_1001276322 195
351 3300005539 Ga0068853_100547769 Ga0068853_1005477692 195
352 3300005539 Ga0068853_100835793 Ga0068853_1008357931 195
353 3300005543 Ga0070672_100005430 Ga0070672_1000054307 195
354 3300005543 Ga0070672_100006558 Ga0070672_1000065583 195
355 3300005543 Ga0070672_100011962 Ga0070672_1000119624 195
356 3300005543 Ga0070672_100023123 Ga0070672_1000231233 195
357 3300005548 Ga0070665_100556828 Ga0070665_1005568282 195
358 3300005564 Ga0070664_100049125 Ga0070664_1000491253 195
359 3300005564 Ga0070664_100100514 Ga0070664_1001005143 195
360 3300005564 Ga0070664_100579453 Ga0070664_1005794532 195
361 3300005577 Ga0068857_100005818 Ga0068857_1000058183 195
362 3300005577 Ga0068857_100032809 Ga0068857_1000328095 195
363 3300005577 Ga0068857_100032823 Ga0068857_1000328231 195
364 3300005578 Ga0068854_100046890 Ga0068854_1000468902 195
365 3300005578 Ga0068854_100078529 Ga0068854_1000785293 195
366 3300005578 Ga0068854_100658631 Ga0068854_1006586312 195
367 3300005614 Ga0068856_100040549 Ga0068856_1000405493 195
368 3300005616 Ga0068852_100174474 Ga0068852_1001744743 195
369 3300005616 Ga0068852_100364211 Ga0068852_1003642112 195
370 3300005616 Ga0068852_100417914 Ga0068852_1004179142 195
371 3300005617 Ga0068859_100057456 Ga0068859_1000574563 195
372 3300005618 Ga0068864_100026599 Ga0068864_1000265992 195
373 3300005618 Ga0068864_100034603 Ga0068864_1000346033 195
374 3300005718 Ga0068866_10024004 Ga0068866_100240042 195
375 3300005719 Ga0068861_100007197 Ga0068861_1000071978 195
376 3300005834 Ga0068851_10023362 Ga0068851_100233621 195
377 3300005834 Ga0068851_10062308 Ga0068851_100623082 195
378 3300005834 Ga0068851_10125635 Ga0068851_101256352 195
379 3300005834 Ga0068851_10458412 Ga0068851_104584121 195
380 3300005840 Ga0068870_10480258 Ga0068870_104802581 195
381 3300005841 Ga0068863_100081253 Ga0068863_1000812533 195
382 3300005842 Ga0068858_100032248 Ga0068858_1000322483 195
383 3300005843 Ga0068860_100002908 Ga0068860_1000029081 195
384 3300005843 Ga0068860_100483870 Ga0068860_1004838702 195
385 3300005844 Ga0068862_100227262 Ga0068862_1002272621 195
386 3300006042 Ga0075368_10014629 Ga0075368_100146292 195
387 3300006048 Ga0075363_100022277 Ga0075363_1000222773 195
388 3300006051 Ga0075364_10317560 Ga0075364_103175601 195
389 3300006163 Ga0070715_10198814 Ga0070715_101988141 195
390 3300006177 Ga0075362_10047342 Ga0075362_100473422 195
391 3300006178 Ga0075367_10003398 Ga0075367_100033984 195
392 3300006178 Ga0075367_10008118 Ga0075367_100081183 195
393 3300006195 Ga0075366_10026111 Ga0075366_100261113 195
394 3300006195 Ga0075366_10342880 Ga0075366_103428801 195
395 3300006237 Ga0097621_100168888 Ga0097621_1001688881 195
396 3300006353 Ga0075370_10000519 Ga0075370_1000051910 195
397 3300006353 Ga0075370_10004658 Ga0075370_100046582 195
398 3300006353 Ga0075370_10005088 Ga0075370_100050885 195
399 3300006353 Ga0075370_10022523 Ga0075370_100225234 195
400 3300006353 Ga0075370_10030077 Ga0075370_100300773 195
401 3300006353 Ga0075370_10283454 Ga0075370_102834542 195
402 3300006353 Ga0075370_10346277 Ga0075370_103462772 195
403 3300006358 Ga0068871_100132099 Ga0068871_1001320992 195
404 3300006881 Ga0068865_100452476 Ga0068865_1004524762 195
405 3300006931 Ga0097620_100057455 Ga0097620_1000574553 195
406 3300009093 Ga0105240_10597290 Ga0105240_105972902 195
407 3300009098 Ga0105245_10023807 Ga0105245_100238075 195
408 3300009098 Ga0105245_10095933 Ga0105245_100959332 195
409 3300009098 Ga0105245_10208999 Ga0105245_102089992 195
410 3300009148 Ga0105243_10010176 Ga0105243_100101764 195
411 3300009174 Ga0105241_10460618 Ga0105241_104606182 195
412 3300009176 Ga0105242_10248653 Ga0105242_102486532 195
413 3300009177 Ga0105248_10749489 Ga0105248_107494892 195
414 3300009545 Ga0105237_10001435 Ga0105237_100014355 195
415 3300009551 Ga0105238_10005749 Ga0105238_100057498 195
416 3300009553 Ga0105249_10044249 Ga0105249_100442493 195
417 3300010375 Ga0105239_10001553 Ga0105239_100015535 195
418 3300010375 Ga0105239_10033378 Ga0105239_100333785 195
419 3300013104 Ga0157370_10098030 Ga0157370_100980303 195
420 3300013306 Ga0163162_10159454 Ga0163162_101594542 195
421 3300013306 Ga0163162_10593928 Ga0163162_105939282 195
422 3300013307 Ga0157372_10057147 Ga0157372_100571473 195
423 3300013308 Ga0157375_10010086 Ga0157375_100100868 195
424 3300013308 Ga0157375_10034712 Ga0157375_100347123 195
425 3300014326 Ga0157380_10122316 Ga0157380_101223162 195
426 3300014326 Ga0157380_10535555 Ga0157380_105355552 195
427 3300014968 Ga0157379_10007142 Ga0157379_100071423 195
428 3300014968 Ga0157379_10026336 Ga0157379_100263363 195
429 3300014968 Ga0157379_10032199 Ga0157379_100321993 195
430 3300014969 Ga0157376_10313146 Ga0157376_103131462 195
431 3300014969 Ga0157376_10340742 Ga0157376_103407421 195
432 3300025304 Ga0209257_1027771 Ga0209257_10277712 195
433 3300025315 Ga0207697_10044945 Ga0207697_100449452 195
434 3300025321 Ga0207656_10029458 Ga0207656_100294582 195
435 3300025893 Ga0207682_10010639 Ga0207682_100106393 195
436 3300025899 Ga0207642_10012289 Ga0207642_100122894 195
437 3300025899 Ga0207642_10125355 Ga0207642_101253552 195
438 3300025905 Ga0207685_10193437 Ga0207685_101934371 195
439 3300025907 Ga0207645_10013620 Ga0207645_100136205 195
440 3300025907 Ga0207645_10202144 Ga0207645_102021442 195
441 3300025909 Ga0207705_10026166 Ga0207705_100261665 195
442 3300025909 Ga0207705_10355901 Ga0207705_103559011 195
443 3300025910 Ga0207684_10008994 Ga0207684_100089944 195
444 3300025911 Ga0207654_10137993 Ga0207654_101379932 195
445 3300025911 Ga0207654_10236623 Ga0207654_102366232 195
446 3300025913 Ga0207695_10101950 Ga0207695_101019501 195
447 3300025913 Ga0207695_10131577 Ga0207695_101315772 195
448 3300025914 Ga0207671_10129088 Ga0207671_101290882 195
449 3300025918 Ga0207662_10016086 Ga0207662_100160865 195
450 3300025918 Ga0207662_10319990 Ga0207662_103199901 195
451 3300025919 Ga0207657_10055184 Ga0207657_100551843 195
452 3300025922 Ga0207646_10056675 Ga0207646_100566753 195
453 3300025923 Ga0207681_10014947 Ga0207681_100149474 195
454 3300025924 Ga0207694_10059865 Ga0207694_100598652 195
455 3300025924 Ga0207694_11009785 Ga0207694_110097851 195
456 3300025925 Ga0207650_10001509 Ga0207650_100015093 195
457 3300025925 Ga0207650_10009021 Ga0207650_100090213 195
458 3300025926 Ga0207659_10005000 Ga0207659_100050003 195
459 3300025926 Ga0207659_10014723 Ga0207659_100147234 195
460 3300025927 Ga0207687_10013260 Ga0207687_100132605 195
461 3300025931 Ga0207644_10015344 Ga0207644_100153443 195
462 3300025931 Ga0207644_10024937 Ga0207644_100249371 195
463 3300025931 Ga0207644_10154327 Ga0207644_101543272 195
464 3300025931 Ga0207644_10727169 Ga0207644_107271691 195
465 3300025932 Ga0207690_10158006 Ga0207690_101580062 195
466 3300025933 Ga0207706_10006915 Ga0207706_100069157 195
467 3300025933 Ga0207706_10392194 Ga0207706_103921941 195
468 3300025935 Ga0207709_10035746 Ga0207709_100357464 195
469 3300025937 Ga0207669_10088077 Ga0207669_100880772 195
470 3300025938 Ga0207704_10064898 Ga0207704_100648982 195
471 3300025940 Ga0207691_10001450 Ga0207691_1000145017 195
472 3300025940 Ga0207691_10003420 Ga0207691_100034204 195
473 3300025940 Ga0207691_10013320 Ga0207691_100133208 195
474 3300025940 Ga0207691_10024373 Ga0207691_100243735 195
475 3300025940 Ga0207691_10334637 Ga0207691_103346372 195
476 3300025942 Ga0207689_10008839 Ga0207689_100088398 195
477 3300025942 Ga0207689_10075066 Ga0207689_100750662 195
478 3300025942 Ga0207689_10780719 Ga0207689_107807191 195
479 3300025944 Ga0207661_10150338 Ga0207661_101503382 195
480 3300025945 Ga0207679_10006305 Ga0207679_100063056 195
481 3300025945 Ga0207679_10014460 Ga0207679_100144604 195
482 3300025960 Ga0207651_10021326 Ga0207651_100213262 195
483 3300025960 Ga0207651_10027746 Ga0207651_100277462 195
484 3300025960 Ga0207651_10053388 Ga0207651_100533882 195
485 3300025960 Ga0207651_10210703 Ga0207651_102107032 195
486 3300025961 Ga0207712_10019369 Ga0207712_100193693 195
487 3300025972 Ga0207668_10006769 Ga0207668_100067698 195
488 3300025981 Ga0207640_10133809 Ga0207640_101338092 195
489 3300025981 Ga0207640_10155096 Ga0207640_101550962 195
490 3300025981 Ga0207640_10491242 Ga0207640_104912422 195
491 3300025986 Ga0207658_10019709 Ga0207658_100197094 195
492 3300025986 Ga0207658_10502215 Ga0207658_105022152 195
493 3300025986 Ga0207658_10503254 Ga0207658_105032542 195
494 3300026023 Ga0207677_10008949 Ga0207677_100089493 195
495 3300026023 Ga0207677_10009887 Ga0207677_100098872 195
496 3300026023 Ga0207677_10101836 Ga0207677_101018362 195
497 3300026035 Ga0207703_10026556 Ga0207703_100265563 195
498 3300026041 Ga0207639_10032785 Ga0207639_100327854 195
499 3300026041 Ga0207639_10289361 Ga0207639_102893612 195
500 3300026041 Ga0207639_10600380 Ga0207639_106003802 195
501 3300026067 Ga0207678_10515338 Ga0207678_105153382 195
502 3300026078 Ga0207702_10089332 Ga0207702_100893323 195
503 3300026088 Ga0207641_10045920 Ga0207641_100459204 195
504 3300026088 Ga0207641_10071563 Ga0207641_100715633 195
505 3300026088 Ga0207641_10391844 Ga0207641_103918442 195
506 3300026089 Ga0207648_10005574 Ga0207648_100055745 195
507 3300026089 Ga0207648_10015155 Ga0207648_100151554 195
508 3300026089 Ga0207648_10027227 Ga0207648_100272275 195
509 3300026089 Ga0207648_10030658 Ga0207648_100306585 195
510 3300026095 Ga0207676_10004408 Ga0207676_100044083 195
511 3300026095 Ga0207676_10271851 Ga0207676_102718512 195
512 3300026116 Ga0207674_10012525 Ga0207674_1001252511 195
513 3300026116 Ga0207674_10633212 Ga0207674_106332122 195
514 3300026118 Ga0207675_100010737 Ga0207675_1000107378 195
515 3300026118 Ga0207675_100351726 Ga0207675_1003517262 195
516 3300026121 Ga0207683_10056908 Ga0207683_100569084 195
517 3300026121 Ga0207683_10071631 Ga0207683_100716314 195
518 3300026121 Ga0207683_10140114 Ga0207683_101401141 195
519 3300026142 Ga0207698_10045653 Ga0207698_100456533 195
520 3300026142 Ga0207698_10071950 Ga0207698_100719502 195
521 3300026142 Ga0207698_10340459 Ga0207698_103404592 195
522 3300026142 Ga0207698_10649096 Ga0207698_106490962 195
523 3300027866 Ga0209813_10085588 Ga0209813_100855882 195
524 3300028379 Ga0268266_10104102 Ga0268266_101041023 195
525 3300028381 Ga0268264_10012844 Ga0268264_100128442 195
526 3300028381 Ga0268264_10365218 Ga0268264_103652183 195
527 3300028786 Ga0307517_10025918 Ga0307517_100259187 195
528 3300028794 Ga0307515_10026336 Ga0307515_100263363 195
529 3300031456 Ga0307513_10559587 Ga0307513_105595871 195
530 3300031507 Ga0307509_10168165 Ga0307509_101681654 195
531 3300031548 Ga0307408_100040814 Ga0307408_1000408144 195
532 3300031548 Ga0307408_100479211 Ga0307408_1004792112 195
533 3300031730 Ga0307516_10000723 Ga0307516_1000072320 195
534 3300031730 Ga0307516_10144069 Ga0307516_101440692 195
535 3300031731 Ga0307405_10004869 Ga0307405_100048692 195
536 3300031824 Ga0307413_10047355 Ga0307413_100473552 195
537 3300031852 Ga0307410_10189644 Ga0307410_101896441 195
538 3300031901 Ga0307406_10147016 Ga0307406_101470162 195
539 3300031911 Ga0307412_10367741 Ga0307412_103677412 195
540 3300031911 Ga0307412_10396936 Ga0307412_103969361 195
541 3300031995 Ga0307409_100685375 Ga0307409_1006853751 195
542 3300032002 Ga0307416_100202106 Ga0307416_1002021063 195
543 3300032002 Ga0307416_100636426 Ga0307416_1006364262 195
544 3300032004 Ga0307414_10227989 Ga0307414_102279892 195
545 3300032005 Ga0307411_10140987 Ga0307411_101409872 195
546 3300035691 Ga0373931_0205102 Ga0373931_0205102_541_1143 195
547 3300035695 Ga0373927_0091669 Ga0373927_0091669_1232_1870 195
548 3300037471 Ga0395905_0000078 Ga0395905_0000078_33579_34208 195
549 3300037471 Ga0395905_0054613 Ga0395905_0054613_2252_2884 195
550 3300039437 Ga0436365_0306544 Ga0436365_0306544_817_1434 195
551 3300044658 Ga0466972_0283307 Ga0466972_0283307_76_693 195
552 3300044683 Ga0466965_0043499 Ga0466965_0043499_706_1323 195
553 3300046522 Ga0495643_0134961 Ga0495643_0134961_497_1096 195
554 3300046543 Ga0495645_0110568 Ga0495645_0110568_1089_1715 195
555 3300047443 Ga0495687_000070 Ga0495687_000070_82031_82630 195
556 3300048911 Ga0496108_0173708 Ga0496108_0173708_643_1269 195
557 3300048912 Ga0496109_0130651 Ga0496109_0130651_1102_1731 195
558 3300048912 Ga0496109_0511104 Ga0496109_0511104_294_920 195
559 3300048913 Ga0496110_0339284 Ga0496110_0339284_537_1166 195
560 3300048916 Ga0496113_0747297 Ga0496113_0747297_137_745 195
561 3300048917 Ga0496114_0094562 Ga0496114_0094562_1387_2025 195
562 3300048928 Ga0496125_0241988 Ga0496125_0241988_525_1130 195
563 3300050490 nmdc:mga03n38_61554_c1 nmdc:mga03n38_61554_c1_902_1501 195
564 3300050492 nmdc:mga0yw44_49238_c1 nmdc:mga0yw44_49238_c1_903_1502 195
565 3300050493 nmdc:mga0k408_137755_c1 nmdc:mga0k408_137755_c1_565_1164 195
566 3300050493 nmdc:mga0k408_62782_c1 nmdc:mga0k408_62782_c1_1057_1656 195
567 3300050494 nmdc:mga06z11_10448_c1 nmdc:mga06z11_10448_c1_1321_1920 195
568 3300050494 nmdc:mga06z11_60682_c1 nmdc:mga06z11_60682_c1_1143_1742 195
569 3300050495 nmdc:mga04h51_32983_c1 nmdc:mga04h51_32983_c1_294_893 195
570 3300050496 nmdc:mga07m45_13444_c1 nmdc:mga07m45_13444_c1_3497_4096 195
571 3300050496 nmdc:mga07m45_186627_c1 nmdc:mga07m45_186627_c1_121_720 195
572 3300050496 nmdc:mga07m45_1976_c1 nmdc:mga07m45_1976_c1_2315_2914 195
573 3300050496 nmdc:mga07m45_43128_c1 nmdc:mga07m45_43128_c1_309_908 195
574 3300050496 nmdc:mga07m45_97434_c1 nmdc:mga07m45_97434_c1_1033_1665 195
575 3300050516 nmdc:mga0sz30_42072_c1 nmdc:mga0sz30_42072_c1_505_1104 195
576 iso_pu_bacteria 2643221592 2643971481 195
577 iso_pu_bacteria 2643221625 2644141016 195
578 iso_pu_bacteria 2643221648 2644276808 195
579 3300031456 Ga0307513_10156076 Ga0307513_101560761 196
580 3300053137 Ga0500561_0131941 Ga0500561_0131941_44_727 197
581 3300053726 Ga0500584_117047 Ga0500584_117047_252_845 197
582 3300005262 Ga0065165_1003998 Ga0065165_100399810 199
583 3300025273 Ga0209673_1009410 Ga0209673_10094103 199
584 3300025298 Ga0209050_1000202 Ga0209050_100020265 199
585 3300025303 Ga0209051_1042523 Ga0209051_10425232 199
586 3300002773 JGI25152J39213_1002894 JGI25152J39213_10028946 200
587 3300003215 JGI25153J46596_10011594 JGI25153J46596_100115942 200
588 3300003771 Ga0055526_1002792 Ga0055526_10027926 200
589 3300025245 Ga0207425_1000905 Ga0207425_100090513 200
590 3300025258 Ga0209129_1000038 Ga0209129_1000038225 200
591 3300025258 Ga0209129_1000154 Ga0209129_1000154105 200
592 3300025273 Ga0209673_1008207 Ga0209673_10082073 200
593 3300025295 Ga0209564_1000162 Ga0209564_1000162127 200
594 3300025297 Ga0209758_1000152 Ga0209758_100015228 200
595 3300025299 Ga0209256_1035992 Ga0209256_10359922 200
596 3300025304 Ga0209257_1047002 Ga0209257_10470021 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

49

103

0.96

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

48

107

0.94

PF13560

HTH_31

Helix-turn-helix domain

44

105

0.94

PF07883

Cupin_2

Cupin domain

148

220

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.9681 19 70
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9592 15 76
8ezt-assembly1.cif.gz_D-2 crystal structure of hipb(lp) from legionella pneumophila 0.9561 18 72
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9516 15 76
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9471 18 77
ID Description Score Start End Superfamily
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9681 19 70 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9592 15 76 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9516 15 76 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9471 18 77 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9385 19 77 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A2V7C948-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9791 14 76 GO:0003677
GO:0003700
GO:0005829
AF-A0A2J6MKE6-F1-model_v4 XRE family transcriptional regulator 0.9784 14 80 GO:0003677
GO:0003700
GO:0005829
AF-A0A6M7UIA0-F1-model_v4 XRE family transcriptional regulator 0.9752 14 80 GO:0003677
GO:0003700
GO:0005829
AF-A0A1M3MDD5-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9742 14 80 GO:0003677
GO:0003700
GO:0005829
AF-A0A2A4VCF4-F1-model_v4 DNA-binding protein 0.9712 17 79 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
85.52 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map