F467607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 596 | 281 | 589 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300053137|Ga0500561_0131941|Ga0500561_0131941_44_727 |
| Length | 227 |
| Sequence | MHIAQRAVRSIGEASVPSSCLAPSGHNAALMSEPAAPSSATASHLARNLVSLRHARGLTQDGLAKSAALPRSTIATLESGDGNPSLSVLVKVAGALGVPIDELLASPRAMVRHWAADEVALRSRPAGKGRGVALRVLVPESVPDEMMEVMDFEPGAVMGGTPHLPGTREFFTCLDGRVNLMVAGERYTLAEGEVLAFPGNLPHSYQNADALQPARGISLVVLAKAGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 7 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 203 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 204 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 249 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 250 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 260 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 263 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 264 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 265 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 270 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 271 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 272 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 273 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 274 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 276 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 278 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 280 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 281 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 0 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.08 |
| Nodule | 0 |
| Rhizoplane | 2.68 |
| Rhizosphere | 78.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1002894 | 3300002773 | Bacteria | 6130 |
| 2 | JGI25153J46596_10007019 | 3300003215 | Bacteria | 5609 |
| 3 | JGI25153J46596_10011594 | 3300003215 | Bacteria | 3881 |
| 4 | rootL2_10058867 | 3300003322 | Bacteria | 2962 |
| 5 | Ga0055526_1002792 | 3300003771 | Bacteria | 11561 |
| 6 | Ga0065165_1003998 | 3300005262 | Bacteria | 9638 |
| 7 | Ga0070676_10020755 | 3300005328 | Bacteria | 3672 |
| 8 | Ga0070690_100342553 | 3300005330 | Bacteria | 1083 |
| 9 | Ga0070670_100006074 | 3300005331 | Bacteria | 10215 |
| 10 | Ga0070670_100008070 | 3300005331 | Bacteria | 8955 |
| 11 | Ga0070670_100077964 | 3300005331 | Bacteria | 2846 |
| 12 | Ga0070670_100129878 | 3300005331 | Bacteria | 2175 |
| 13 | Ga0070670_100331550 | 3300005331 | Bacteria | 1334 |
| 14 | Ga0070670_100452825 | 3300005331 | Bacteria | 1138 |
| 15 | Ga0070670_100593974 | 3300005331 | Bacteria | 990 |
| 16 | Ga0070677_10020310 | 3300005333 | Bacteria | 2418 |
| 17 | Ga0068869_100017350 | 3300005334 | Bacteria | 4877 |
| 18 | Ga0070666_10146727 | 3300005335 | Bacteria | 1645 |
| 19 | Ga0070682_100474233 | 3300005337 | Bacteria | 964 |
| 20 | Ga0068868_100022466 | 3300005338 | Bacteria | 4760 |
| 21 | Ga0068868_100034136 | 3300005338 | Bacteria | 3926 |
| 22 | Ga0068868_100055847 | 3300005338 | Bacteria | 3117 |
| 23 | Ga0068868_100375780 | 3300005338 | Bacteria | 1222 |
| 24 | Ga0070660_100182252 | 3300005339 | Bacteria | 1700 |
| 25 | Ga0070660_100230035 | 3300005339 | Bacteria | 1508 |
| 26 | Ga0070687_100006034 | 3300005343 | Bacteria | 4939 |
| 27 | Ga0070661_100001667 | 3300005344 | Bacteria | 15398 |
| 28 | Ga0070661_100447340 | 3300005344 | Bacteria | 1028 |
| 29 | Ga0070668_100003853 | 3300005347 | Bacteria | 11069 |
| 30 | Ga0070669_100005123 | 3300005353 | Bacteria | 9478 |
| 31 | Ga0070675_100011995 | 3300005354 | Bacteria | 6792 |
| 32 | Ga0070675_100018260 | 3300005354 | Bacteria | 5583 |
| 33 | Ga0070675_100031570 | 3300005354 | Bacteria | 4283 |
| 34 | Ga0070675_100050187 | 3300005354 | Bacteria | 3426 |
| 35 | Ga0070671_100020822 | 3300005355 | Bacteria | 5349 |
| 36 | Ga0070671_100023972 | 3300005355 | Bacteria | 4993 |
| 37 | Ga0070671_100028965 | 3300005355 | Bacteria | 4565 |
| 38 | Ga0070671_100067021 | 3300005355 | Bacteria | 2992 |
| 39 | Ga0070671_100132032 | 3300005355 | Bacteria | 2103 |
| 40 | Ga0070674_100008283 | 3300005356 | Bacteria | 6184 |
| 41 | Ga0070674_100039156 | 3300005356 | Bacteria | 3200 |
| 42 | Ga0070674_100046859 | 3300005356 | Bacteria | 2960 |
| 43 | Ga0070674_100053652 | 3300005356 | Bacteria | 2785 |
| 44 | Ga0070674_100056094 | 3300005356 | Bacteria | 2731 |
| 45 | Ga0070673_100003566 | 3300005364 | Bacteria | 9717 |
| 46 | Ga0070673_100007794 | 3300005364 | Bacteria | 7088 |
| 47 | Ga0070673_100024223 | 3300005364 | Bacteria | 4447 |
| 48 | Ga0070673_100048699 | 3300005364 | Bacteria | 3306 |
| 49 | Ga0070673_100341072 | 3300005364 | Bacteria | 1328 |
| 50 | Ga0070673_100371090 | 3300005364 | Bacteria | 1274 |
| 51 | Ga0070673_100387946 | 3300005364 | Bacteria | 1246 |
| 52 | Ga0070673_100480416 | 3300005364 | Bacteria | 1121 |
| 53 | Ga0070688_100833926 | 3300005365 | Bacteria | 723 |
| 54 | Ga0070667_100021565 | 3300005367 | Bacteria | 5347 |
| 55 | Ga0070667_100025553 | 3300005367 | Bacteria | 4910 |
| 56 | Ga0070667_100163858 | 3300005367 | Bacteria | 1960 |
| 57 | Ga0070667_100529486 | 3300005367 | Bacteria | 1082 |
| 58 | Ga0070714_100167860 | 3300005435 | Unclassified | 1990 |
| 59 | Ga0070701_10263334 | 3300005438 | Bacteria | 1046 |
| 60 | Ga0070708_100284328 | 3300005445 | Bacteria | 1557 |
| 61 | Ga0070663_100901011 | 3300005455 | Bacteria | 764 |
| 62 | Ga0070678_100006937 | 3300005456 | Bacteria | 6682 |
| 63 | Ga0070678_100020363 | 3300005456 | Bacteria | 4351 |
| 64 | Ga0070678_100114754 | 3300005456 | Bacteria | 2113 |
| 65 | Ga0070678_100129938 | 3300005456 | Bacteria | 1999 |
| 66 | Ga0070662_100007391 | 3300005457 | Bacteria | 7120 |
| 67 | Ga0070662_100018033 | 3300005457 | Bacteria | 4769 |
| 68 | Ga0068867_100002336 | 3300005459 | Bacteria | 13350 |
| 69 | Ga0068867_100004396 | 3300005459 | Bacteria | 9918 |
| 70 | Ga0068867_100004662 | 3300005459 | Bacteria | 9645 |
| 71 | Ga0068867_100010749 | 3300005459 | Bacteria | 6455 |
| 72 | Ga0068867_100017302 | 3300005459 | Bacteria | 5120 |
| 73 | Ga0068867_100774035 | 3300005459 | Bacteria | 854 |
| 74 | Ga0070685_10571083 | 3300005466 | Bacteria | 810 |
| 75 | Ga0070706_100013190 | 3300005467 | Bacteria | 7646 |
| 76 | Ga0070707_100434109 | 3300005468 | Bacteria | 1274 |
| 77 | Ga0070699_100209236 | 3300005518 | Bacteria | 1736 |
| 78 | Ga0070684_100057588 | 3300005535 | Bacteria | 3393 |
| 79 | Ga0068853_100053324 | 3300005539 | Bacteria | 3483 |
| 80 | Ga0068853_100109927 | 3300005539 | Bacteria | 2448 |
| 81 | Ga0068853_100127632 | 3300005539 | Bacteria | 2274 |
| 82 | Ga0068853_100547769 | 3300005539 | Bacteria | 1096 |
| 83 | Ga0068853_100835793 | 3300005539 | Bacteria | 883 |
| 84 | Ga0070672_100005430 | 3300005543 | Bacteria | 8448 |
| 85 | Ga0070672_100006558 | 3300005543 | Bacteria | 7828 |
| 86 | Ga0070672_100011962 | 3300005543 | Bacteria | 6068 |
| 87 | Ga0070672_100014096 | 3300005543 | Bacteria | 5658 |
| 88 | Ga0070672_100023123 | 3300005543 | Bacteria | 4577 |
| 89 | Ga0070672_100046972 | 3300005543 | Bacteria | 3348 |
| 90 | Ga0070672_100192566 | 3300005543 | Bacteria | 1703 |
| 91 | Ga0070665_100028143 | 3300005548 | Bacteria | 5660 |
| 92 | Ga0070665_100556828 | 3300005548 | Bacteria | 1159 |
| 93 | Ga0070704_101062663 | 3300005549 | Bacteria | 734 |
| 94 | Ga0068855_100061498 | 3300005563 | Bacteria | 4387 |
| 95 | Ga0070664_100049125 | 3300005564 | Bacteria | 3567 |
| 96 | Ga0070664_100100514 | 3300005564 | Bacteria | 2514 |
| 97 | Ga0070664_100579453 | 3300005564 | Bacteria | 1039 |
| 98 | Ga0068857_100005818 | 3300005577 | Bacteria | 10530 |
| 99 | Ga0068857_100032809 | 3300005577 | Bacteria | 4590 |
| 100 | Ga0068857_100032823 | 3300005577 | Bacteria | 4588 |
| 101 | Ga0068854_100046890 | 3300005578 | Bacteria | 3078 |
| 102 | Ga0068854_100078529 | 3300005578 | Bacteria | 2432 |
| 103 | Ga0068854_100658631 | 3300005578 | Bacteria | 900 |
| 104 | Ga0068856_100040549 | 3300005614 | Bacteria | 4574 |
| 105 | Ga0068856_100274486 | 3300005614 | Bacteria | 1702 |
| 106 | Ga0068852_100174474 | 3300005616 | Bacteria | 2017 |
| 107 | Ga0068852_100218130 | 3300005616 | Bacteria | 1813 |
| 108 | Ga0068852_100364211 | 3300005616 | Bacteria | 1415 |
| 109 | Ga0068852_100417914 | 3300005616 | Bacteria | 1322 |
| 110 | Ga0068852_101022815 | 3300005616 | Bacteria | 845 |
| 111 | Ga0068859_100057456 | 3300005617 | Bacteria | 3919 |
| 112 | Ga0068859_100098215 | 3300005617 | Bacteria | 2982 |
| 113 | Ga0068859_100179968 | 3300005617 | Bacteria | 2197 |
| 114 | Ga0068859_101058299 | 3300005617 | Bacteria | 892 |
| 115 | Ga0068864_100026599 | 3300005618 | Bacteria | 4880 |
| 116 | Ga0068864_100034603 | 3300005618 | Bacteria | 4298 |
| 117 | Ga0068864_100117254 | 3300005618 | Bacteria | 2376 |
| 118 | Ga0068864_100209211 | 3300005618 | Bacteria | 1795 |
| 119 | Ga0068864_100488682 | 3300005618 | Bacteria | 1183 |
| 120 | Ga0068866_10024004 | 3300005718 | Bacteria | 2843 |
| 121 | Ga0068866_10076369 | 3300005718 | Bacteria | 1786 |
| 122 | Ga0068861_100007197 | 3300005719 | Bacteria | 7623 |
| 123 | Ga0068861_100013009 | 3300005719 | Bacteria | 5816 |
| 124 | Ga0068851_10023362 | 3300005834 | Bacteria | 3021 |
| 125 | Ga0068851_10062308 | 3300005834 | Bacteria | 1913 |
| 126 | Ga0068851_10125635 | 3300005834 | Bacteria | 1383 |
| 127 | Ga0068851_10458412 | 3300005834 | Bacteria | 759 |
| 128 | Ga0068870_10480258 | 3300005840 | Bacteria | 825 |
| 129 | Ga0068863_100081253 | 3300005841 | Bacteria | 3070 |
| 130 | Ga0068863_100114674 | 3300005841 | Bacteria | 2567 |
| 131 | Ga0068863_100179110 | 3300005841 | Bacteria | 2035 |
| 132 | Ga0068863_100728586 | 3300005841 | Bacteria | 987 |
| 133 | Ga0068858_100032248 | 3300005842 | Bacteria | 4866 |
| 134 | Ga0068858_100249105 | 3300005842 | Bacteria | 1687 |
| 135 | Ga0068860_100001710 | 3300005843 | Bacteria | 23445 |
| 136 | Ga0068860_100002908 | 3300005843 | Bacteria | 17738 |
| 137 | Ga0068860_100483870 | 3300005843 | Bacteria | 1234 |
| 138 | Ga0068862_100227262 | 3300005844 | Bacteria | 1692 |
| 139 | Ga0075368_10014629 | 3300006042 | Bacteria | 2902 |
| 140 | Ga0075363_100022277 | 3300006048 | Bacteria | 3202 |
| 141 | Ga0075363_100176678 | 3300006048 | Bacteria | 1214 |
| 142 | Ga0075364_10317560 | 3300006051 | Bacteria | 1061 |
| 143 | Ga0070715_10198814 | 3300006163 | Bacteria | 1017 |
| 144 | Ga0075362_10029350 | 3300006177 | Bacteria | 2369 |
| 145 | Ga0075362_10047342 | 3300006177 | Bacteria | 1915 |
| 146 | Ga0075362_10136391 | 3300006177 | Bacteria | 1170 |
| 147 | Ga0075367_10003398 | 3300006178 | Bacteria | 7585 |
| 148 | Ga0075367_10008118 | 3300006178 | Bacteria | 5420 |
| 149 | Ga0075367_10054103 | 3300006178 | Bacteria | 2380 |
| 150 | Ga0075366_10015836 | 3300006195 | Bacteria | 4329 |
| 151 | Ga0075366_10026111 | 3300006195 | Bacteria | 3419 |
| 152 | Ga0075366_10342880 | 3300006195 | Bacteria | 916 |
| 153 | Ga0097621_100035713 | 3300006237 | Bacteria | 3973 |
| 154 | Ga0097621_100045759 | 3300006237 | Bacteria | 3536 |
| 155 | Ga0097621_100168888 | 3300006237 | Bacteria | 1884 |
| 156 | Ga0075370_10000519 | 3300006353 | Bacteria | 14695 |
| 157 | Ga0075370_10004616 | 3300006353 | Bacteria | 6720 |
| 158 | Ga0075370_10004658 | 3300006353 | Bacteria | 6688 |
| 159 | Ga0075370_10005088 | 3300006353 | Bacteria | 6480 |
| 160 | Ga0075370_10022523 | 3300006353 | Bacteria | 3460 |
| 161 | Ga0075370_10030077 | 3300006353 | Bacteria | 3029 |
| 162 | Ga0075370_10283454 | 3300006353 | Bacteria | 984 |
| 163 | Ga0075370_10346277 | 3300006353 | Bacteria | 887 |
| 164 | Ga0075370_10493036 | 3300006353 | Unclassified | 739 |
| 165 | Ga0068871_100132099 | 3300006358 | Bacteria | 2117 |
| 166 | Ga0068871_100155407 | 3300006358 | Unclassified | 1953 |
| 167 | Ga0068871_100925491 | 3300006358 | Bacteria | 809 |
| 168 | Ga0075430_100477103 | 3300006846 | Bacteria | 1029 |
| 169 | Ga0068865_100016577 | 3300006881 | Bacteria | 4718 |
| 170 | Ga0068865_100047168 | 3300006881 | Bacteria | 2959 |
| 171 | Ga0068865_100452476 | 3300006881 | Bacteria | 1062 |
| 172 | Ga0097620_100057455 | 3300006931 | Bacteria | 3919 |
| 173 | Ga0097620_100098215 | 3300006931 | Bacteria | 2982 |
| 174 | Ga0097620_100179960 | 3300006931 | Bacteria | 2197 |
| 175 | Ga0097620_101058194 | 3300006931 | Bacteria | 892 |
| 176 | Ga0105240_10597290 | 3300009093 | Bacteria | 1216 |
| 177 | Ga0105245_10023807 | 3300009098 | Bacteria | 5376 |
| 178 | Ga0105245_10095933 | 3300009098 | Bacteria | 2736 |
| 179 | Ga0105245_10208999 | 3300009098 | Bacteria | 1878 |
| 180 | Ga0114129_10025979 | 3300009147 | Bacteria | 8293 |
| 181 | Ga0105243_10001013 | 3300009148 | Bacteria | 25972 |
| 182 | Ga0105243_10010176 | 3300009148 | Bacteria | 7152 |
| 183 | Ga0105241_10082578 | 3300009174 | Unclassified | 2519 |
| 184 | Ga0105241_10460618 | 3300009174 | Bacteria | 1126 |
| 185 | Ga0105242_10248653 | 3300009176 | Bacteria | 1601 |
| 186 | Ga0105248_10003994 | 3300009177 | Bacteria | 16307 |
| 187 | Ga0105248_10066500 | 3300009177 | Bacteria | 4047 |
| 188 | Ga0105248_10393162 | 3300009177 | Bacteria | 1561 |
| 189 | Ga0105248_10749489 | 3300009177 | Bacteria | 1102 |
| 190 | Ga0105248_10960900 | 3300009177 | Bacteria | 965 |
| 191 | Ga0105237_10001435 | 3300009545 | Bacteria | 31496 |
| 192 | Ga0105237_10018178 | 3300009545 | Bacteria | 7277 |
| 193 | Ga0105238_10005749 | 3300009551 | Bacteria | 12267 |
| 194 | Ga0105249_10044249 | 3300009553 | Bacteria | 4049 |
| 195 | Ga0105239_10001553 | 3300010375 | Bacteria | 30349 |
| 196 | Ga0105239_10033378 | 3300010375 | Bacteria | 5653 |
| 197 | Ga0157370_10098030 | 3300013104 | Bacteria | 2750 |
| 198 | Ga0157369_10053347 | 3300013105 | Bacteria | 4371 |
| 199 | Ga0157369_11178506 | 3300013105 | Bacteria | 782 |
| 200 | Ga0157378_10033598 | 3300013297 | Bacteria | 4536 |
| 201 | Ga0163162_10006598 | 3300013306 | Bacteria | 11239 |
| 202 | Ga0163162_10159454 | 3300013306 | Bacteria | 2377 |
| 203 | Ga0163162_10232322 | 3300013306 | Bacteria | 1975 |
| 204 | Ga0163162_10593928 | 3300013306 | Bacteria | 1234 |
| 205 | Ga0163162_10658766 | 3300013306 | Bacteria | 1170 |
| 206 | Ga0157372_10057147 | 3300013307 | Bacteria | 4361 |
| 207 | Ga0157372_10128218 | 3300013307 | Bacteria | 2918 |
| 208 | Ga0157375_10010086 | 3300013308 | Bacteria | 8306 |
| 209 | Ga0157375_10034712 | 3300013308 | Bacteria | 4807 |
| 210 | Ga0157375_10046443 | 3300013308 | Bacteria | 4234 |
| 211 | Ga0157375_10159021 | 3300013308 | Bacteria | 2400 |
| 212 | Ga0157375_10423194 | 3300013308 | Bacteria | 1498 |
| 213 | Ga0163163_10000524 | 3300014325 | Bacteria | 34246 |
| 214 | Ga0163163_10275283 | 3300014325 | Bacteria | 1734 |
| 215 | Ga0163163_10329019 | 3300014325 | Bacteria | 1582 |
| 216 | Ga0157380_10041577 | 3300014326 | Bacteria | 3588 |
| 217 | Ga0157380_10122316 | 3300014326 | Bacteria | 2206 |
| 218 | Ga0157380_10204039 | 3300014326 | Bacteria | 1756 |
| 219 | Ga0157380_10535555 | 3300014326 | Bacteria | 1145 |
| 220 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 221 | Ga0157377_10162329 | 3300014745 | Bacteria | 1391 |
| 222 | Ga0157379_10007142 | 3300014968 | Bacteria | 9657 |
| 223 | Ga0157379_10026336 | 3300014968 | Bacteria | 5177 |
| 224 | Ga0157379_10032199 | 3300014968 | Bacteria | 4673 |
| 225 | Ga0157379_10046335 | 3300014968 | Bacteria | 3879 |
| 226 | Ga0157379_10261844 | 3300014968 | Bacteria | 1571 |
| 227 | Ga0157376_10015732 | 3300014969 | Bacteria | 5724 |
| 228 | Ga0157376_10313146 | 3300014969 | Bacteria | 1490 |
| 229 | Ga0157376_10340742 | 3300014969 | Bacteria | 1432 |
| 230 | Ga0163161_10072629 | 3300017792 | Bacteria | 2520 |
| 231 | Ga0163161_10107259 | 3300017792 | Bacteria | 2085 |
| 232 | Ga0163161_10480410 | 3300017792 | Bacteria | 1009 |
| 233 | Ga0213876_10035781 | 3300021384 | Bacteria | 2619 |
| 234 | Ga0207425_1000905 | 3300025245 | Bacteria | 14290 |
| 235 | Ga0209129_1000038 | 3300025258 | Bacteria | 322778 |
| 236 | Ga0209129_1000154 | 3300025258 | Bacteria | 109449 |
| 237 | Ga0209233_1009228 | 3300025261 | Bacteria | 3013 |
| 238 | Ga0209673_1008207 | 3300025273 | Bacteria | 4682 |
| 239 | Ga0209673_1009410 | 3300025273 | Bacteria | 4235 |
| 240 | Ga0209564_1000162 | 3300025295 | Bacteria | 162265 |
| 241 | Ga0209758_1000152 | 3300025297 | Bacteria | 162418 |
| 242 | Ga0209758_1004256 | 3300025297 | Bacteria | 12104 |
| 243 | Ga0209050_1000202 | 3300025298 | Bacteria | 133468 |
| 244 | Ga0209256_1035992 | 3300025299 | Bacteria | 1302 |
| 245 | Ga0209051_1042523 | 3300025303 | Bacteria | 1605 |
| 246 | Ga0209257_1027771 | 3300025304 | Bacteria | 1876 |
| 247 | Ga0209257_1047002 | 3300025304 | Bacteria | 1244 |
| 248 | Ga0207697_10044945 | 3300025315 | Bacteria | 1817 |
| 249 | Ga0207656_10029458 | 3300025321 | Bacteria | 2261 |
| 250 | Ga0207682_10010639 | 3300025893 | Bacteria | 3600 |
| 251 | Ga0207642_10012289 | 3300025899 | Bacteria | 3087 |
| 252 | Ga0207642_10125355 | 3300025899 | Bacteria | 1332 |
| 253 | Ga0207685_10193437 | 3300025905 | Bacteria | 951 |
| 254 | Ga0207645_10013620 | 3300025907 | Bacteria | 5473 |
| 255 | Ga0207645_10202144 | 3300025907 | Bacteria | 1307 |
| 256 | Ga0207705_10026166 | 3300025909 | Bacteria | 4163 |
| 257 | Ga0207705_10124012 | 3300025909 | Bacteria | 1919 |
| 258 | Ga0207705_10355901 | 3300025909 | Bacteria | 1128 |
| 259 | Ga0207684_10008994 | 3300025910 | Bacteria | 8856 |
| 260 | Ga0207684_10046792 | 3300025910 | Bacteria | 3670 |
| 261 | Ga0207654_10137993 | 3300025911 | Bacteria | 1551 |
| 262 | Ga0207654_10236623 | 3300025911 | Bacteria | 1218 |
| 263 | Ga0207695_10101950 | 3300025913 | Bacteria | 2864 |
| 264 | Ga0207695_10131577 | 3300025913 | Bacteria | 2459 |
| 265 | Ga0207671_10129088 | 3300025914 | Bacteria | 1939 |
| 266 | Ga0207663_10524559 | 3300025916 | Unclassified | 923 |
| 267 | Ga0207662_10016086 | 3300025918 | Bacteria | 4216 |
| 268 | Ga0207662_10319990 | 3300025918 | Bacteria | 1035 |
| 269 | Ga0207657_10055184 | 3300025919 | Bacteria | 3433 |
| 270 | Ga0207649_10278194 | 3300025920 | Bacteria | 1216 |
| 271 | Ga0207646_10056675 | 3300025922 | Bacteria | 3502 |
| 272 | Ga0207681_10014947 | 3300025923 | Bacteria | 4835 |
| 273 | Ga0207694_10059865 | 3300025924 | Bacteria | 2962 |
| 274 | Ga0207694_11009785 | 3300025924 | Unclassified | 704 |
| 275 | Ga0207650_10001509 | 3300025925 | Bacteria | 16629 |
| 276 | Ga0207650_10002949 | 3300025925 | Bacteria | 11735 |
| 277 | Ga0207650_10009021 | 3300025925 | Bacteria | 6819 |
| 278 | Ga0207650_10329614 | 3300025925 | Bacteria | 1252 |
| 279 | Ga0207650_10655027 | 3300025925 | Bacteria | 885 |
| 280 | Ga0207659_10005000 | 3300025926 | Bacteria | 8035 |
| 281 | Ga0207659_10014723 | 3300025926 | Bacteria | 5053 |
| 282 | Ga0207659_10045449 | 3300025926 | Bacteria | 3096 |
| 283 | Ga0207687_10013260 | 3300025927 | Bacteria | 5380 |
| 284 | Ga0207644_10015344 | 3300025931 | Bacteria | 5140 |
| 285 | Ga0207644_10024937 | 3300025931 | Bacteria | 4108 |
| 286 | Ga0207644_10041298 | 3300025931 | Bacteria | 3262 |
| 287 | Ga0207644_10050606 | 3300025931 | Bacteria | 2979 |
| 288 | Ga0207644_10154327 | 3300025931 | Bacteria | 1779 |
| 289 | Ga0207644_10171879 | 3300025931 | Bacteria | 1692 |
| 290 | Ga0207644_10178513 | 3300025931 | Bacteria | 1663 |
| 291 | Ga0207644_10727169 | 3300025931 | Bacteria | 828 |
| 292 | Ga0207690_10158006 | 3300025932 | Bacteria | 1687 |
| 293 | Ga0207690_10445961 | 3300025932 | Bacteria | 1039 |
| 294 | Ga0207706_10006464 | 3300025933 | Bacteria | 10882 |
| 295 | Ga0207706_10006915 | 3300025933 | Bacteria | 10492 |
| 296 | Ga0207706_10392194 | 3300025933 | Bacteria | 1204 |
| 297 | Ga0207709_10000918 | 3300025935 | Bacteria | 22222 |
| 298 | Ga0207709_10035746 | 3300025935 | Bacteria | 2939 |
| 299 | Ga0207670_10246149 | 3300025936 | Bacteria | 1379 |
| 300 | Ga0207670_10606422 | 3300025936 | Bacteria | 899 |
| 301 | Ga0207669_10002932 | 3300025937 | Bacteria | 7325 |
| 302 | Ga0207669_10088077 | 3300025937 | Bacteria | 2012 |
| 303 | Ga0207669_10172978 | 3300025937 | Bacteria | 1539 |
| 304 | Ga0207704_10064898 | 3300025938 | Bacteria | 2284 |
| 305 | Ga0207691_10001450 | 3300025940 | Bacteria | 23610 |
| 306 | Ga0207691_10003420 | 3300025940 | Bacteria | 15434 |
| 307 | Ga0207691_10013320 | 3300025940 | Bacteria | 7877 |
| 308 | Ga0207691_10023385 | 3300025940 | Bacteria | 5816 |
| 309 | Ga0207691_10024373 | 3300025940 | Bacteria | 5691 |
| 310 | Ga0207691_10292872 | 3300025940 | Bacteria | 1399 |
| 311 | Ga0207691_10334637 | 3300025940 | Bacteria | 1297 |
| 312 | Ga0207711_10022609 | 3300025941 | Bacteria | 5260 |
| 313 | Ga0207711_10103830 | 3300025941 | Bacteria | 2517 |
| 314 | Ga0207689_10008839 | 3300025942 | Bacteria | 8749 |
| 315 | Ga0207689_10063606 | 3300025942 | Bacteria | 3035 |
| 316 | Ga0207689_10075066 | 3300025942 | Bacteria | 2779 |
| 317 | Ga0207689_10780719 | 3300025942 | Bacteria | 806 |
| 318 | Ga0207661_10150338 | 3300025944 | Bacteria | 2012 |
| 319 | Ga0207679_10006305 | 3300025945 | Bacteria | 7489 |
| 320 | Ga0207679_10014460 | 3300025945 | Bacteria | 5191 |
| 321 | Ga0207651_10021326 | 3300025960 | Bacteria | 3935 |
| 322 | Ga0207651_10027746 | 3300025960 | Bacteria | 3562 |
| 323 | Ga0207651_10053388 | 3300025960 | Bacteria | 2762 |
| 324 | Ga0207651_10210703 | 3300025960 | Bacteria | 1564 |
| 325 | Ga0207651_10577451 | 3300025960 | Bacteria | 980 |
| 326 | Ga0207712_10019369 | 3300025961 | Bacteria | 4443 |
| 327 | Ga0207712_10246745 | 3300025961 | Bacteria | 1441 |
| 328 | Ga0207712_10727587 | 3300025961 | Bacteria | 868 |
| 329 | Ga0207668_10006769 | 3300025972 | Bacteria | 6784 |
| 330 | Ga0207640_10133809 | 3300025981 | Bacteria | 1796 |
| 331 | Ga0207640_10155096 | 3300025981 | Bacteria | 1687 |
| 332 | Ga0207640_10491242 | 3300025981 | Unclassified | 1020 |
| 333 | Ga0207658_10019709 | 3300025986 | Bacteria | 4666 |
| 334 | Ga0207658_10162538 | 3300025986 | Bacteria | 1831 |
| 335 | Ga0207658_10502215 | 3300025986 | Bacteria | 1080 |
| 336 | Ga0207658_10503254 | 3300025986 | Bacteria | 1079 |
| 337 | Ga0207677_10008949 | 3300026023 | Bacteria | 5617 |
| 338 | Ga0207677_10009887 | 3300026023 | Bacteria | 5379 |
| 339 | Ga0207677_10076447 | 3300026023 | Bacteria | 2384 |
| 340 | Ga0207677_10101836 | 3300026023 | Bacteria | 2116 |
| 341 | Ga0207703_10026556 | 3300026035 | Bacteria | 4558 |
| 342 | Ga0207703_10131606 | 3300026035 | Bacteria | 2161 |
| 343 | Ga0207639_10032785 | 3300026041 | Bacteria | 3827 |
| 344 | Ga0207639_10289361 | 3300026041 | Bacteria | 1444 |
| 345 | Ga0207639_10600380 | 3300026041 | Bacteria | 1015 |
| 346 | Ga0207678_10515338 | 3300026067 | Bacteria | 1043 |
| 347 | Ga0207702_10053645 | 3300026078 | Bacteria | 3414 |
| 348 | Ga0207702_10089332 | 3300026078 | Bacteria | 2694 |
| 349 | Ga0207641_10045920 | 3300026088 | Bacteria | 3680 |
| 350 | Ga0207641_10071563 | 3300026088 | Bacteria | 2983 |
| 351 | Ga0207641_10348724 | 3300026088 | Bacteria | 1410 |
| 352 | Ga0207641_10391844 | 3300026088 | Bacteria | 1332 |
| 353 | Ga0207641_10462974 | 3300026088 | Bacteria | 1227 |
| 354 | Ga0207641_10713588 | 3300026088 | Bacteria | 988 |
| 355 | Ga0207648_10000439 | 3300026089 | Bacteria | 46028 |
| 356 | Ga0207648_10000936 | 3300026089 | Bacteria | 32936 |
| 357 | Ga0207648_10005574 | 3300026089 | Bacteria | 12665 |
| 358 | Ga0207648_10015155 | 3300026089 | Bacteria | 7095 |
| 359 | Ga0207648_10027227 | 3300026089 | Bacteria | 5077 |
| 360 | Ga0207648_10030658 | 3300026089 | Bacteria | 4760 |
| 361 | Ga0207648_10083223 | 3300026089 | Bacteria | 2791 |
| 362 | Ga0207676_10004408 | 3300026095 | Bacteria | 9951 |
| 363 | Ga0207676_10028624 | 3300026095 | Bacteria | 4164 |
| 364 | Ga0207676_10078525 | 3300026095 | Bacteria | 2674 |
| 365 | Ga0207676_10271851 | 3300026095 | Bacteria | 1535 |
| 366 | Ga0207674_10012525 | 3300026116 | Bacteria | 9476 |
| 367 | Ga0207674_10122060 | 3300026116 | Bacteria | 2572 |
| 368 | Ga0207674_10633212 | 3300026116 | Bacteria | 1033 |
| 369 | Ga0207675_100010737 | 3300026118 | Bacteria | 8579 |
| 370 | Ga0207675_100090736 | 3300026118 | Bacteria | 2873 |
| 371 | Ga0207675_100351726 | 3300026118 | Bacteria | 1444 |
| 372 | Ga0207683_10009710 | 3300026121 | Bacteria | 8207 |
| 373 | Ga0207683_10056908 | 3300026121 | Bacteria | 3432 |
| 374 | Ga0207683_10071631 | 3300026121 | Bacteria | 3064 |
| 375 | Ga0207683_10140114 | 3300026121 | Bacteria | 2179 |
| 376 | Ga0207698_10008831 | 3300026142 | Bacteria | 6388 |
| 377 | Ga0207698_10045653 | 3300026142 | Bacteria | 3302 |
| 378 | Ga0207698_10071950 | 3300026142 | Bacteria | 2746 |
| 379 | Ga0207698_10340459 | 3300026142 | Bacteria | 1413 |
| 380 | Ga0207698_10649096 | 3300026142 | Unclassified | 1045 |
| 381 | Ga0207698_10938373 | 3300026142 | Bacteria | 874 |
| 382 | Ga0209813_10085588 | 3300027866 | Bacteria | 1050 |
| 383 | Ga0268266_10088047 | 3300028379 | Bacteria | 2717 |
| 384 | Ga0268266_10104102 | 3300028379 | Bacteria | 2506 |
| 385 | Ga0268264_10012844 | 3300028381 | Bacteria | 6892 |
| 386 | Ga0268264_10099392 | 3300028381 | Bacteria | 2525 |
| 387 | Ga0268264_10365218 | 3300028381 | Bacteria | 1378 |
| 388 | Ga0268264_10387759 | 3300028381 | Bacteria | 1339 |
| 389 | Ga0268264_10543912 | 3300028381 | Bacteria | 1138 |
| 390 | Ga0307517_10025918 | 3300028786 | Bacteria | 7138 |
| 391 | Ga0307515_10000109 | 3300028794 | Bacteria | 195895 |
| 392 | Ga0307515_10003984 | 3300028794 | Bacteria | 30816 |
| 393 | Ga0307515_10026336 | 3300028794 | Bacteria | 10016 |
| 394 | Ga0307515_10072877 | 3300028794 | Bacteria | 4626 |
| 395 | Ga0307512_10050741 | 3300030522 | Bacteria | 3328 |
| 396 | Ga0307512_10181132 | 3300030522 | Bacteria | 1184 |
| 397 | Ga0307512_10305691 | 3300030522 | Bacteria | 736 |
| 398 | Ga0265320_10063660 | 3300031240 | Bacteria | 1754 |
| 399 | Ga0307513_10012800 | 3300031456 | Bacteria | 10329 |
| 400 | Ga0307513_10156076 | 3300031456 | Bacteria | 2182 |
| 401 | Ga0307513_10559587 | 3300031456 | Bacteria | 855 |
| 402 | Ga0307509_10000157 | 3300031507 | Bacteria | 106022 |
| 403 | Ga0307509_10001408 | 3300031507 | Bacteria | 40683 |
| 404 | Ga0307509_10029770 | 3300031507 | Bacteria | 6054 |
| 405 | Ga0307509_10076765 | 3300031507 | Bacteria | 3465 |
| 406 | Ga0307509_10168165 | 3300031507 | Bacteria | 2077 |
| 407 | Ga0307408_100040814 | 3300031548 | Bacteria | 3288 |
| 408 | Ga0307408_100479211 | 3300031548 | Bacteria | 1085 |
| 409 | Ga0307508_10000237 | 3300031616 | Bacteria | 67014 |
| 410 | Ga0307508_10000291 | 3300031616 | Bacteria | 61434 |
| 411 | Ga0307508_10052501 | 3300031616 | Bacteria | 3620 |
| 412 | Ga0307514_10002703 | 3300031649 | Bacteria | 17950 |
| 413 | Ga0307514_10346786 | 3300031649 | Bacteria | 795 |
| 414 | Ga0307516_10000723 | 3300031730 | Bacteria | 45058 |
| 415 | Ga0307516_10144069 | 3300031730 | Bacteria | 2149 |
| 416 | Ga0307405_10004869 | 3300031731 | Bacteria | 6409 |
| 417 | Ga0307405_10138040 | 3300031731 | Bacteria | 1695 |
| 418 | Ga0307405_10173049 | 3300031731 | Bacteria | 1542 |
| 419 | Ga0307413_10047355 | 3300031824 | Bacteria | 2563 |
| 420 | Ga0307518_10350242 | 3300031838 | Bacteria | 860 |
| 421 | Ga0307410_10189644 | 3300031852 | Bacteria | 1562 |
| 422 | Ga0307406_10024872 | 3300031901 | Bacteria | 3581 |
| 423 | Ga0307406_10147016 | 3300031901 | Bacteria | 1676 |
| 424 | Ga0307412_10292275 | 3300031911 | Bacteria | 1284 |
| 425 | Ga0307412_10367741 | 3300031911 | Bacteria | 1160 |
| 426 | Ga0307412_10396936 | 3300031911 | Bacteria | 1121 |
| 427 | Ga0307409_100685375 | 3300031995 | Bacteria | 1022 |
| 428 | Ga0307409_100951606 | 3300031995 | Bacteria | 875 |
| 429 | Ga0307416_100166488 | 3300032002 | Bacteria | 2045 |
| 430 | Ga0307416_100202106 | 3300032002 | Bacteria | 1886 |
| 431 | Ga0307416_100240950 | 3300032002 | Bacteria | 1752 |
| 432 | Ga0307416_100636426 | 3300032002 | Bacteria | 1150 |
| 433 | Ga0307414_10227989 | 3300032004 | Bacteria | 1534 |
| 434 | Ga0307411_10140987 | 3300032005 | Bacteria | 1777 |
| 435 | Ga0307415_100027395 | 3300032126 | Bacteria | 3610 |
| 436 | Ga0307507_10030539 | 3300033179 | Bacteria | 5682 |
| 437 | Ga0307507_10036600 | 3300033179 | Bacteria | 5013 |
| 438 | Ga0307507_10235578 | 3300033179 | Bacteria | 1206 |
| 439 | Ga0307510_10056823 | 3300033180 | Bacteria | 4068 |
| 440 | Ga0307510_10145368 | 3300033180 | Bacteria | 2004 |
| 441 | Ga0307510_10324240 | 3300033180 | Bacteria | 996 |
| 442 | Ga0373949_0055251 | 3300035090 | Bacteria | 1010 |
| 443 | Ga0373952_0014343 | 3300035092 | Bacteria | 1585 |
| 444 | Ga0373945_0033745 | 3300035116 | Bacteria | 1821 |
| 445 | Ga0373946_0135184 | 3300035171 | Bacteria | 1138 |
| 446 | Ga0373955_0391008 | 3300035172 | Bacteria | 844 |
| 447 | Ga0373931_0205102 | 3300035691 | Bacteria | 1180 |
| 448 | Ga0373935_0142049 | 3300035692 | Bacteria | 1623 |
| 449 | Ga0373935_0253586 | 3300035692 | Bacteria | 1232 |
| 450 | Ga0373927_0091669 | 3300035695 | Bacteria | 1974 |
| 451 | Ga0373933_0115373 | 3300035724 | Bacteria | 1678 |
| 452 | Ga0373937_0024322 | 3300036401 | Bacteria | 5461 |
| 453 | Ga0373925_0065615 | 3300037068 | Bacteria | 2735 |
| 454 | Ga0395900_0002836 | 3300037418 | Bacteria | 18919 |
| 455 | Ga0395898_0021746 | 3300037466 | Bacteria | 6501 |
| 456 | Ga0395905_0000078 | 3300037471 | Bacteria | 161593 |
| 457 | Ga0395905_0001177 | 3300037471 | Bacteria | 32676 |
| 458 | Ga0395905_0007409 | 3300037471 | Bacteria | 10909 |
| 459 | Ga0395905_0028557 | 3300037471 | Bacteria | 5258 |
| 460 | Ga0395905_0054613 | 3300037471 | Bacteria | 3738 |
| 461 | Ga0395905_0096698 | 3300037471 | Bacteria | 2772 |
| 462 | Ga0395905_0118492 | 3300037471 | Bacteria | 2488 |
| 463 | Ga0395905_1301765 | 3300037471 | Bacteria | 631 |
| 464 | Ga0436365_0002712 | 3300039437 | Bacteria | 6007 |
| 465 | Ga0436365_0306544 | 3300039437 | Bacteria | 1737 |
| 466 | Ga0439461_0044131 | 3300041410 | Bacteria | 972 |
| 467 | Ga0451843_1104350 | 3300041509 | Bacteria | 727 |
| 468 | Ga0439431_0017356 | 3300041997 | Bacteria | 1691 |
| 469 | Ga0466969_0000010 | 3300044656 | Bacteria | 117215 |
| 470 | Ga0466969_0005174 | 3300044656 | Bacteria | 6935 |
| 471 | Ga0466969_0070406 | 3300044656 | Bacteria | 1682 |
| 472 | Ga0466969_0211406 | 3300044656 | Bacteria | 883 |
| 473 | Ga0466972_0000231 | 3300044658 | Bacteria | 38797 |
| 474 | Ga0466972_0001299 | 3300044658 | Bacteria | 12074 |
| 475 | Ga0466972_0035506 | 3300044658 | Bacteria | 2439 |
| 476 | Ga0466972_0283307 | 3300044658 | Bacteria | 774 |
| 477 | Ga0466965_0003639 | 3300044683 | Bacteria | 6790 |
| 478 | Ga0466965_0043499 | 3300044683 | Bacteria | 2217 |
| 479 | Ga0466966_0007831 | 3300044684 | Bacteria | 7071 |
| 480 | Ga0466966_0043768 | 3300044684 | Bacteria | 2868 |
| 481 | Ga0466961_0002667 | 3300044693 | Bacteria | 11070 |
| 482 | Ga0466961_0063227 | 3300044693 | Bacteria | 2351 |
| 483 | Ga0466961_0073919 | 3300044693 | Bacteria | 2161 |
| 484 | Ga0466963_0101521 | 3300044694 | Bacteria | 1969 |
| 485 | Ga0466964_0022474 | 3300044706 | Bacteria | 2447 |
| 486 | Ga0466964_0031942 | 3300044706 | Bacteria | 2090 |
| 487 | Ga0466964_0050406 | 3300044706 | Bacteria | 1706 |
| 488 | Ga0466971_0397136 | 3300044719 | Bacteria | 672 |
| 489 | Ga0466968_0006862 | 3300044735 | Bacteria | 4309 |
| 490 | Ga0466968_0040857 | 3300044735 | Bacteria | 1956 |
| 491 | Ga0466970_0002900 | 3300044765 | Bacteria | 8310 |
| 492 | Ga0466970_0185682 | 3300044765 | Bacteria | 1154 |
| 493 | Ga0466970_0215940 | 3300044765 | Bacteria | 1069 |
| 494 | Ga0466970_0313634 | 3300044765 | Bacteria | 886 |
| 495 | Ga0466957_0110896 | 3300044842 | Bacteria | 1739 |
| 496 | Ga0466957_0161795 | 3300044842 | Bacteria | 1454 |
| 497 | Ga0466959_0000169 | 3300045049 | Bacteria | 43342 |
| 498 | Ga0466959_0011339 | 3300045049 | Bacteria | 6402 |
| 499 | Ga0466959_0025563 | 3300045049 | Bacteria | 4377 |
| 500 | Ga0466958_0151575 | 3300045836 | Bacteria | 1462 |
| 501 | Ga0466967_0436208 | 3300045976 | Bacteria | 1278 |
| 502 | Ga0466967_0939819 | 3300045976 | Bacteria | 860 |
| 503 | Ga0495592_0000350 | 3300046454 | Bacteria | 37566 |
| 504 | Ga0495592_0159446 | 3300046454 | Bacteria | 1554 |
| 505 | Ga0495629_0044220 | 3300046459 | Bacteria | 3126 |
| 506 | Ga0495651_0525777 | 3300046462 | Bacteria | 754 |
| 507 | Ga0495606_0398380 | 3300046507 | Bacteria | 718 |
| 508 | Ga0495618_0218775 | 3300046514 | Bacteria | 1202 |
| 509 | Ga0495628_0389477 | 3300046516 | Bacteria | 1020 |
| 510 | Ga0495632_0033886 | 3300046519 | Bacteria | 2618 |
| 511 | Ga0495632_0142380 | 3300046519 | Bacteria | 1111 |
| 512 | Ga0495643_0134961 | 3300046522 | Bacteria | 1236 |
| 513 | Ga0495666_0031176 | 3300046526 | Bacteria | 2613 |
| 514 | Ga0495645_0110568 | 3300046543 | Bacteria | 1945 |
| 515 | Ga0495625_0086404 | 3300046660 | Bacteria | 2176 |
| 516 | Ga0495657_0295898 | 3300046675 | Bacteria | 966 |
| 517 | Ga0495647_0057243 | 3300046681 | Bacteria | 1530 |
| 518 | Ga0495658_0034403 | 3300046683 | Bacteria | 2780 |
| 519 | Ga0495658_0044914 | 3300046683 | Bacteria | 2477 |
| 520 | Ga0495658_0087843 | 3300046683 | Bacteria | 1836 |
| 521 | Ga0495671_0077336 | 3300046692 | Bacteria | 1631 |
| 522 | Ga0495604_0643368 | 3300047317 | Bacteria | 677 |
| 523 | Ga0495674_0475968 | 3300047319 | Bacteria | 1001 |
| 524 | Ga0495687_000070 | 3300047443 | Bacteria | 159227 |
| 525 | Ga0495684_0092845 | 3300047471 | Bacteria | 2286 |
| 526 | Ga0496101_0319700 | 3300048904 | Bacteria | 1217 |
| 527 | Ga0496102_0006709 | 3300048905 | Bacteria | 9831 |
| 528 | Ga0496104_0101794 | 3300048907 | Bacteria | 2751 |
| 529 | Ga0496104_1492513 | 3300048907 | Bacteria | 579 |
| 530 | Ga0496108_0173708 | 3300048911 | Bacteria | 1865 |
| 531 | Ga0496108_0182722 | 3300048911 | Bacteria | 1816 |
| 532 | Ga0496108_0461946 | 3300048911 | Bacteria | 1109 |
| 533 | Ga0496109_0130651 | 3300048912 | Bacteria | 2344 |
| 534 | Ga0496109_0511104 | 3300048912 | Bacteria | 1134 |
| 535 | Ga0496110_0252897 | 3300048913 | Bacteria | 1604 |
| 536 | Ga0496110_0339284 | 3300048913 | Bacteria | 1369 |
| 537 | Ga0496111_0471242 | 3300048914 | Bacteria | 926 |
| 538 | Ga0496112_0038517 | 3300048915 | Bacteria | 4668 |
| 539 | Ga0496113_0219898 | 3300048916 | Bacteria | 1513 |
| 540 | Ga0496113_0747297 | 3300048916 | Unclassified | 779 |
| 541 | Ga0496114_0094562 | 3300048917 | Bacteria | 2542 |
| 542 | Ga0496125_0241988 | 3300048928 | Bacteria | 1145 |
| 543 | Ga0501300_017303 | 3300049523 | Bacteria | 1052 |
| 544 | Ga0501303_022921 | 3300049526 | Bacteria | 678 |
| 545 | Ga0501034_0089826 | 3300049571 | Bacteria | 3070 |
| 546 | Ga0501036_0273193 | 3300049572 | Bacteria | 1415 |
| 547 | Ga0501037_0698921 | 3300049573 | Bacteria | 675 |
| 548 | Ga0501043_0048842 | 3300049579 | Bacteria | 3326 |
| 549 | Ga0501046_0327396 | 3300049580 | Bacteria | 1115 |
| 550 | Ga0501073_0091268 | 3300049589 | Bacteria | 2117 |
| 551 | Ga0501206_015943 | 3300049653 | Bacteria | 1042 |
| 552 | Ga0501080_0147212 | 3300049742 | Bacteria | 2177 |
| 553 | Ga0501265_007902 | 3300049762 | Bacteria | 1259 |
| 554 | nmdc:mga03n38_61554_c1 | 3300050490 | Bacteria | 1710 |
| 555 | nmdc:mga0yw44_162213_c1 | 3300050492 | Bacteria | 1464 |
| 556 | nmdc:mga0yw44_49238_c1 | 3300050492 | Bacteria | 2542 |
| 557 | nmdc:mga0k408_137755_c1 | 3300050493 | Bacteria | 1451 |
| 558 | nmdc:mga0k408_59828_c1 | 3300050493 | Bacteria | 2214 |
| 559 | nmdc:mga0k408_62782_c1 | 3300050493 | Bacteria | 2161 |
| 560 | nmdc:mga0k408_80165_c1 | 3300050493 | Bacteria | 1910 |
| 561 | nmdc:mga06z11_10448_c1 | 3300050494 | Bacteria | 3959 |
| 562 | nmdc:mga06z11_60682_c1 | 3300050494 | Bacteria | 1970 |
| 563 | nmdc:mga04h51_32983_c1 | 3300050495 | Bacteria | 1646 |
| 564 | nmdc:mga07m45_13444_c1 | 3300050496 | Bacteria | 4345 |
| 565 | nmdc:mga07m45_186627_c1 | 3300050496 | Bacteria | 1206 |
| 566 | nmdc:mga07m45_1976_c1 | 3300050496 | Bacteria | 9492 |
| 567 | nmdc:mga07m45_24997_c1 | 3300050496 | Bacteria | 3274 |
| 568 | nmdc:mga07m45_43128_c1 | 3300050496 | Bacteria | 2529 |
| 569 | nmdc:mga07m45_97434_c1 | 3300050496 | Bacteria | 1688 |
| 570 | nmdc:mga05p37_42453_c1 | 3300050507 | Bacteria | 5587 |
| 571 | nmdc:mga0sz30_42072_c1 | 3300050516 | Bacteria | 1337 |
| 572 | Ga0495612_0186495 | 3300053078 | Bacteria | 912 |
| 573 | Ga0500578_0000327 | 3300053086 | Bacteria | 57988 |
| 574 | Ga0500583_0013937 | 3300053092 | Bacteria | 3130 |
| 575 | Ga0500583_0221545 | 3300053092 | Bacteria | 938 |
| 576 | Ga0500628_025429 | 3300053129 | Bacteria | 1238 |
| 577 | Ga0500655_013867 | 3300053133 | Bacteria | 1473 |
| 578 | Ga0500561_0131941 | 3300053137 | Bacteria | 769 |
| 579 | Ga0500564_162004 | 3300053138 | Bacteria | 946 |
| 580 | Ga0500568_0016606 | 3300053139 | Bacteria | 3267 |
| 581 | Ga0500577_0008593 | 3300053142 | Bacteria | 2921 |
| 582 | Ga0500590_055769 | 3300053148 | Bacteria | 1998 |
| 583 | Ga0500604_0088755 | 3300053151 | Bacteria | 1007 |
| 584 | Ga0500622_0000293 | 3300053156 | Bacteria | 51215 |
| 585 | Ga0500584_117047 | 3300053726 | Bacteria | 1065 |
| 586 | Ga0466962_0027022 | 3300061719 | Bacteria | 2755 |
| 587 | Ga0466962_0066086 | 3300061719 | Bacteria | 1726 |
| 588 | Ga0466962_0264052 | 3300061719 | Bacteria | 848 |
| 589 | Ga0466962_0295130 | 3300061719 | Bacteria | 801 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_1492513 | Ga0496104_1492513_27_515 | 162 |
| 2 | 3300005330 | Ga0070690_100342553 | Ga0070690_1003425531 | 187 |
| 3 | 3300009174 | Ga0105241_10082578 | Ga0105241_100825785 | 187 |
| 4 | 3300013307 | Ga0157372_10128218 | Ga0157372_101282182 | 187 |
| 5 | 3300025932 | Ga0207690_10445961 | Ga0207690_104459612 | 187 |
| 6 | 3300049571 | Ga0501034_0089826 | Ga0501034_0089826_24_593 | 187 |
| 7 | 3300049572 | Ga0501036_0273193 | Ga0501036_0273193_399_968 | 187 |
| 8 | 3300049573 | Ga0501037_0698921 | Ga0501037_0698921_54_623 | 187 |
| 9 | 3300049579 | Ga0501043_0048842 | Ga0501043_0048842_530_1099 | 187 |
| 10 | 3300049580 | Ga0501046_0327396 | Ga0501046_0327396_272_841 | 187 |
| 11 | 3300049589 | Ga0501073_0091268 | Ga0501073_0091268_871_1440 | 187 |
| 12 | 3300049742 | Ga0501080_0147212 | Ga0501080_0147212_1194_1763 | 187 |
| 13 | iso_pu_bacteria | 2585428058 | 2587732529 | 187 |
| 14 | 3300005331 | Ga0070670_100593974 | Ga0070670_1005939742 | 188 |
| 15 | 3300005338 | Ga0068868_100055847 | Ga0068868_1000558473 | 188 |
| 16 | 3300005356 | Ga0070674_100008283 | Ga0070674_1000082836 | 188 |
| 17 | 3300005364 | Ga0070673_100371090 | Ga0070673_1003710902 | 188 |
| 18 | 3300005365 | Ga0070688_100833926 | Ga0070688_1008339261 | 188 |
| 19 | 3300005367 | Ga0070667_100021565 | Ga0070667_1000215652 | 188 |
| 20 | 3300005435 | Ga0070714_100167860 | Ga0070714_1001678602 | 188 |
| 21 | 3300005456 | Ga0070678_100006937 | Ga0070678_1000069374 | 188 |
| 22 | 3300005543 | Ga0070672_100192566 | Ga0070672_1001925662 | 188 |
| 23 | 3300005548 | Ga0070665_100028143 | Ga0070665_1000281434 | 188 |
| 24 | 3300005563 | Ga0068855_100061498 | Ga0068855_1000614985 | 188 |
| 25 | 3300005841 | Ga0068863_100728586 | Ga0068863_1007285861 | 188 |
| 26 | 3300006358 | Ga0068871_100155407 | Ga0068871_1001554073 | 188 |
| 27 | 3300006881 | Ga0068865_100047168 | Ga0068865_1000471684 | 188 |
| 28 | 3300009177 | Ga0105248_10960900 | Ga0105248_109609002 | 188 |
| 29 | 3300013105 | Ga0157369_10053347 | Ga0157369_100533473 | 188 |
| 30 | 3300013306 | Ga0163162_10658766 | Ga0163162_106587662 | 188 |
| 31 | 3300013308 | Ga0157375_10046443 | Ga0157375_100464435 | 188 |
| 32 | 3300013308 | Ga0157375_10423194 | Ga0157375_104231942 | 188 |
| 33 | 3300014969 | Ga0157376_10015732 | Ga0157376_100157322 | 188 |
| 34 | 3300017792 | Ga0163161_10480410 | Ga0163161_104804102 | 188 |
| 35 | 3300025916 | Ga0207663_10524559 | Ga0207663_105245592 | 188 |
| 36 | 3300025925 | Ga0207650_10655027 | Ga0207650_106550272 | 188 |
| 37 | 3300025936 | Ga0207670_10246149 | Ga0207670_102461492 | 188 |
| 38 | 3300025936 | Ga0207670_10606422 | Ga0207670_106064222 | 188 |
| 39 | 3300025937 | Ga0207669_10002932 | Ga0207669_100029322 | 188 |
| 40 | 3300025940 | Ga0207691_10292872 | Ga0207691_102928722 | 188 |
| 41 | 3300025960 | Ga0207651_10577451 | Ga0207651_105774511 | 188 |
| 42 | 3300025961 | Ga0207712_10727587 | Ga0207712_107275872 | 188 |
| 43 | 3300025986 | Ga0207658_10162538 | Ga0207658_101625382 | 188 |
| 44 | 3300026023 | Ga0207677_10076447 | Ga0207677_100764472 | 188 |
| 45 | 3300026088 | Ga0207641_10713588 | Ga0207641_107135881 | 188 |
| 46 | 3300026121 | Ga0207683_10009710 | Ga0207683_100097107 | 188 |
| 47 | 3300028379 | Ga0268266_10088047 | Ga0268266_100880472 | 188 |
| 48 | 3300030522 | Ga0307512_10181132 | Ga0307512_101811322 | 188 |
| 49 | 3300030522 | Ga0307512_10305691 | Ga0307512_103056911 | 188 |
| 50 | 3300031507 | Ga0307509_10000157 | Ga0307509_100001572 | 188 |
| 51 | 3300031507 | Ga0307509_10001408 | Ga0307509_1000140812 | 188 |
| 52 | 3300031616 | Ga0307508_10000291 | Ga0307508_1000029110 | 188 |
| 53 | 3300031649 | Ga0307514_10346786 | Ga0307514_103467861 | 188 |
| 54 | 3300031838 | Ga0307518_10350242 | Ga0307518_103502422 | 188 |
| 55 | 3300033179 | Ga0307507_10235578 | Ga0307507_102355782 | 188 |
| 56 | 3300033180 | Ga0307510_10056823 | Ga0307510_100568232 | 188 |
| 57 | 3300033180 | Ga0307510_10145368 | Ga0307510_101453682 | 188 |
| 58 | 3300033180 | Ga0307510_10324240 | Ga0307510_103242402 | 188 |
| 59 | 3300037418 | Ga0395900_0002836 | Ga0395900_0002836_11533_12108 | 188 |
| 60 | 3300037466 | Ga0395898_0021746 | Ga0395898_0021746_2012_2587 | 188 |
| 61 | 3300037471 | Ga0395905_0118492 | Ga0395905_0118492_302_883 | 188 |
| 62 | 3300037471 | Ga0395905_1301765 | Ga0395905_1301765_26_601 | 188 |
| 63 | 3300041410 | Ga0439461_0044131 | Ga0439461_0044131_179_745 | 188 |
| 64 | 3300041997 | Ga0439431_0017356 | Ga0439431_0017356_936_1502 | 188 |
| 65 | 3300044656 | Ga0466969_0005174 | Ga0466969_0005174_18_599 | 188 |
| 66 | 3300044658 | Ga0466972_0000231 | Ga0466972_0000231_13028_13597 | 188 |
| 67 | 3300044658 | Ga0466972_0035506 | Ga0466972_0035506_1542_2111 | 188 |
| 68 | 3300044683 | Ga0466965_0003639 | Ga0466965_0003639_2448_3017 | 188 |
| 69 | 3300044684 | Ga0466966_0007831 | Ga0466966_0007831_489_1070 | 188 |
| 70 | 3300044693 | Ga0466961_0073919 | Ga0466961_0073919_1490_2071 | 188 |
| 71 | 3300044706 | Ga0466964_0022474 | Ga0466964_0022474_92_661 | 188 |
| 72 | 3300044706 | Ga0466964_0031942 | Ga0466964_0031942_318_887 | 188 |
| 73 | 3300044735 | Ga0466968_0006862 | Ga0466968_0006862_2962_3531 | 188 |
| 74 | 3300044735 | Ga0466968_0040857 | Ga0466968_0040857_1036_1605 | 188 |
| 75 | 3300044765 | Ga0466970_0215940 | Ga0466970_0215940_16_597 | 188 |
| 76 | 3300045049 | Ga0466959_0011339 | Ga0466959_0011339_521_1102 | 188 |
| 77 | 3300046454 | Ga0495592_0000350 | Ga0495592_0000350_11014_11640 | 188 |
| 78 | 3300046519 | Ga0495632_0142380 | Ga0495632_0142380_462_1040 | 188 |
| 79 | 3300047317 | Ga0495604_0643368 | Ga0495604_0643368_10_588 | 188 |
| 80 | 3300048904 | Ga0496101_0319700 | Ga0496101_0319700_88_666 | 188 |
| 81 | 3300048914 | Ga0496111_0471242 | Ga0496111_0471242_201_776 | 188 |
| 82 | 3300053092 | Ga0500583_0013937 | Ga0500583_0013937_2469_3047 | 188 |
| 83 | 3300053138 | Ga0500564_162004 | Ga0500564_162004_74_700 | 188 |
| 84 | 3300005331 | Ga0070670_100331550 | Ga0070670_1003315502 | 189 |
| 85 | 3300005355 | Ga0070671_100020822 | Ga0070671_1000208224 | 189 |
| 86 | 3300005364 | Ga0070673_100480416 | Ga0070673_1004804162 | 189 |
| 87 | 3300005445 | Ga0070708_100284328 | Ga0070708_1002843282 | 189 |
| 88 | 3300005456 | Ga0070678_100114754 | Ga0070678_1001147542 | 189 |
| 89 | 3300005618 | Ga0068864_100117254 | Ga0068864_1001172543 | 189 |
| 90 | 3300006237 | Ga0097621_100035713 | Ga0097621_1000357131 | 189 |
| 91 | 3300009147 | Ga0114129_10025979 | Ga0114129_100259793 | 189 |
| 92 | 3300009177 | Ga0105248_10066500 | Ga0105248_100665003 | 189 |
| 93 | 3300014325 | Ga0163163_10275283 | Ga0163163_102752832 | 189 |
| 94 | 3300025925 | Ga0207650_10329614 | Ga0207650_103296142 | 189 |
| 95 | 3300025931 | Ga0207644_10041298 | Ga0207644_100412982 | 189 |
| 96 | 3300025941 | Ga0207711_10022609 | Ga0207711_100226094 | 189 |
| 97 | 3300026095 | Ga0207676_10028624 | Ga0207676_100286244 | 189 |
| 98 | 3300028794 | Ga0307515_10072877 | Ga0307515_100728773 | 189 |
| 99 | 3300031240 | Ga0265320_10063660 | Ga0265320_100636602 | 189 |
| 100 | 3300031507 | Ga0307509_10076765 | Ga0307509_100767653 | 189 |
| 101 | 3300031616 | Ga0307508_10052501 | Ga0307508_100525012 | 189 |
| 102 | 3300033179 | Ga0307507_10030539 | Ga0307507_100305392 | 189 |
| 103 | 3300037068 | Ga0373925_0065615 | Ga0373925_0065615_1778_2446 | 189 |
| 104 | 3300037471 | Ga0395905_0028557 | Ga0395905_0028557_623_1201 | 189 |
| 105 | 3300044765 | Ga0466970_0313634 | Ga0466970_0313634_296_874 | 189 |
| 106 | 3300046507 | Ga0495606_0398380 | Ga0495606_0398380_79_684 | 189 |
| 107 | 3300046526 | Ga0495666_0031176 | Ga0495666_0031176_809_1390 | 189 |
| 108 | 3300046660 | Ga0495625_0086404 | Ga0495625_0086404_1044_1625 | 189 |
| 109 | 3300046681 | Ga0495647_0057243 | Ga0495647_0057243_507_1175 | 189 |
| 110 | 3300046683 | Ga0495658_0034403 | Ga0495658_0034403_997_1578 | 189 |
| 111 | 3300048911 | Ga0496108_0461946 | Ga0496108_0461946_277_915 | 189 |
| 112 | 3300050493 | nmdc:mga0k408_80165_c1 | nmdc:mga0k408_80165_c1_227_805 | 189 |
| 113 | 3300050507 | nmdc:mga05p37_42453_c1 | nmdc:mga05p37_42453_c1_1197_1766 | 189 |
| 114 | 3300061719 | Ga0466962_0264052 | Ga0466962_0264052_199_777 | 189 |
| 115 | iso_pu_bacteria | 2751185846 | 2753569314 | 189 |
| 116 | 3300005356 | Ga0070674_100056094 | Ga0070674_1000560941 | 190 |
| 117 | 3300005459 | Ga0068867_100004396 | Ga0068867_1000043965 | 190 |
| 118 | 3300005543 | Ga0070672_100014096 | Ga0070672_1000140967 | 190 |
| 119 | 3300005616 | Ga0068852_101022815 | Ga0068852_1010228152 | 190 |
| 120 | 3300005617 | Ga0068859_100098215 | Ga0068859_1000982152 | 190 |
| 121 | 3300005617 | Ga0068859_100179968 | Ga0068859_1001799684 | 190 |
| 122 | 3300005617 | Ga0068859_101058299 | Ga0068859_1010582992 | 190 |
| 123 | 3300005718 | Ga0068866_10076369 | Ga0068866_100763692 | 190 |
| 124 | 3300005719 | Ga0068861_100013009 | Ga0068861_1000130098 | 190 |
| 125 | 3300005841 | Ga0068863_100179110 | Ga0068863_1001791104 | 190 |
| 126 | 3300005842 | Ga0068858_100249105 | Ga0068858_1002491051 | 190 |
| 127 | 3300005843 | Ga0068860_100001710 | Ga0068860_10000171021 | 190 |
| 128 | 3300006177 | Ga0075362_10029350 | Ga0075362_100293501 | 190 |
| 129 | 3300006178 | Ga0075367_10054103 | Ga0075367_100541033 | 190 |
| 130 | 3300006237 | Ga0097621_100045759 | Ga0097621_1000457595 | 190 |
| 131 | 3300006353 | Ga0075370_10493036 | Ga0075370_104930361 | 190 |
| 132 | 3300006358 | Ga0068871_100925491 | Ga0068871_1009254912 | 190 |
| 133 | 3300006846 | Ga0075430_100477103 | Ga0075430_1004771032 | 190 |
| 134 | 3300006881 | Ga0068865_100016577 | Ga0068865_1000165773 | 190 |
| 135 | 3300006931 | Ga0097620_100098215 | Ga0097620_1000982152 | 190 |
| 136 | 3300006931 | Ga0097620_100179960 | Ga0097620_1001799601 | 190 |
| 137 | 3300006931 | Ga0097620_101058194 | Ga0097620_1010581942 | 190 |
| 138 | 3300009545 | Ga0105237_10018178 | Ga0105237_100181788 | 190 |
| 139 | 3300013297 | Ga0157378_10033598 | Ga0157378_100335982 | 190 |
| 140 | 3300013306 | Ga0163162_10006598 | Ga0163162_100065985 | 190 |
| 141 | 3300013306 | Ga0163162_10232322 | Ga0163162_102323222 | 190 |
| 142 | 3300013308 | Ga0157375_10159021 | Ga0157375_101590213 | 190 |
| 143 | 3300014325 | Ga0163163_10000524 | Ga0163163_100005244 | 190 |
| 144 | 3300014326 | Ga0157380_10041577 | Ga0157380_100415775 | 190 |
| 145 | 3300014745 | Ga0157377_10162329 | Ga0157377_101623292 | 190 |
| 146 | 3300014968 | Ga0157379_10046335 | Ga0157379_100463355 | 190 |
| 147 | 3300014968 | Ga0157379_10261844 | Ga0157379_102618442 | 190 |
| 148 | 3300017792 | Ga0163161_10072629 | Ga0163161_100726293 | 190 |
| 149 | 3300025931 | Ga0207644_10178513 | Ga0207644_101785132 | 190 |
| 150 | 3300025937 | Ga0207669_10172978 | Ga0207669_101729782 | 190 |
| 151 | 3300025940 | Ga0207691_10023385 | Ga0207691_100233857 | 190 |
| 152 | 3300025942 | Ga0207689_10063606 | Ga0207689_100636064 | 190 |
| 153 | 3300025961 | Ga0207712_10246745 | Ga0207712_102467451 | 190 |
| 154 | 3300026035 | Ga0207703_10131606 | Ga0207703_101316062 | 190 |
| 155 | 3300026089 | Ga0207648_10000439 | Ga0207648_1000043935 | 190 |
| 156 | 3300026095 | Ga0207676_10078525 | Ga0207676_100785253 | 190 |
| 157 | 3300026118 | Ga0207675_100090736 | Ga0207675_1000907363 | 190 |
| 158 | 3300026142 | Ga0207698_10938373 | Ga0207698_109383731 | 190 |
| 159 | 3300028381 | Ga0268264_10387759 | Ga0268264_103877592 | 190 |
| 160 | 3300028381 | Ga0268264_10543912 | Ga0268264_105439122 | 190 |
| 161 | 3300028794 | Ga0307515_10000109 | Ga0307515_1000010994 | 190 |
| 162 | 3300028794 | Ga0307515_10003984 | Ga0307515_100039844 | 190 |
| 163 | 3300030522 | Ga0307512_10050741 | Ga0307512_100507412 | 190 |
| 164 | 3300031456 | Ga0307513_10012800 | Ga0307513_100128005 | 190 |
| 165 | 3300031507 | Ga0307509_10029770 | Ga0307509_100297704 | 190 |
| 166 | 3300031616 | Ga0307508_10000237 | Ga0307508_1000023751 | 190 |
| 167 | 3300031649 | Ga0307514_10002703 | Ga0307514_100027038 | 190 |
| 168 | 3300031995 | Ga0307409_100951606 | Ga0307409_1009516061 | 190 |
| 169 | 3300033179 | Ga0307507_10036600 | Ga0307507_100366005 | 190 |
| 170 | 3300035090 | Ga0373949_0055251 | Ga0373949_0055251_334_924 | 190 |
| 171 | 3300046692 | Ga0495671_0077336 | Ga0495671_0077336_946_1533 | 190 |
| 172 | 3300050493 | nmdc:mga0k408_59828_c1 | nmdc:mga0k408_59828_c1_1431_2030 | 190 |
| 173 | 3300053086 | Ga0500578_0000327 | Ga0500578_0000327_24187_24792 | 190 |
| 174 | 3300003322 | rootL2_10058867 | rootL2_100588673 | 191 |
| 175 | 3300005614 | Ga0068856_100274486 | Ga0068856_1002744862 | 191 |
| 176 | 3300006048 | Ga0075363_100176678 | Ga0075363_1001766782 | 191 |
| 177 | 3300006177 | Ga0075362_10136391 | Ga0075362_101363911 | 191 |
| 178 | 3300006195 | Ga0075366_10015836 | Ga0075366_100158362 | 191 |
| 179 | 3300006353 | Ga0075370_10004616 | Ga0075370_100046162 | 191 |
| 180 | 3300013105 | Ga0157369_11178506 | Ga0157369_111785061 | 191 |
| 181 | 3300025261 | Ga0209233_1009228 | Ga0209233_10092282 | 191 |
| 182 | 3300026078 | Ga0207702_10053645 | Ga0207702_100536454 | 191 |
| 183 | 3300026116 | Ga0207674_10122060 | Ga0207674_101220604 | 191 |
| 184 | 3300035171 | Ga0373946_0135184 | Ga0373946_0135184_269_886 | 191 |
| 185 | 3300035692 | Ga0373935_0253586 | Ga0373935_0253586_59_676 | 191 |
| 186 | 3300035724 | Ga0373933_0115373 | Ga0373933_0115373_21_638 | 191 |
| 187 | 3300036401 | Ga0373937_0024322 | Ga0373937_0024322_4076_4693 | 191 |
| 188 | 3300046459 | Ga0495629_0044220 | Ga0495629_0044220_685_1302 | 191 |
| 189 | 3300046462 | Ga0495651_0525777 | Ga0495651_0525777_93_710 | 191 |
| 190 | 3300046514 | Ga0495618_0218775 | Ga0495618_0218775_273_890 | 191 |
| 191 | 3300046516 | Ga0495628_0389477 | Ga0495628_0389477_226_843 | 191 |
| 192 | 3300046519 | Ga0495632_0033886 | Ga0495632_0033886_311_886 | 191 |
| 193 | 3300046675 | Ga0495657_0295898 | Ga0495657_0295898_215_832 | 191 |
| 194 | 3300046683 | Ga0495658_0044914 | Ga0495658_0044914_1274_1891 | 191 |
| 195 | 3300047319 | Ga0495674_0475968 | Ga0495674_0475968_368_985 | 191 |
| 196 | 3300047471 | Ga0495684_0092845 | Ga0495684_0092845_256_873 | 191 |
| 197 | 3300050496 | nmdc:mga07m45_24997_c1 | nmdc:mga07m45_24997_c1_1472_2047 | 191 |
| 198 | 3300053092 | Ga0500583_0221545 | Ga0500583_0221545_109_684 | 191 |
| 199 | 3300053129 | Ga0500628_025429 | Ga0500628_025429_383_958 | 191 |
| 200 | 3300053133 | Ga0500655_013867 | Ga0500655_013867_510_1085 | 191 |
| 201 | 3300053139 | Ga0500568_0016606 | Ga0500568_0016606_2440_3015 | 191 |
| 202 | 3300053142 | Ga0500577_0008593 | Ga0500577_0008593_905_1480 | 191 |
| 203 | 3300053151 | Ga0500604_0088755 | Ga0500604_0088755_80_655 | 191 |
| 204 | 3300053156 | Ga0500622_0000293 | Ga0500622_0000293_46444_47019 | 191 |
| 205 | iso_pu_bacteria | 2585428057 | 2587728842 | 191 |
| 206 | 3300014326 | Ga0157380_10204039 | Ga0157380_102040392 | 192 |
| 207 | 3300026089 | Ga0207648_10083223 | Ga0207648_100832232 | 192 |
| 208 | 3300041509 | Ga0451843_1104350 | Ga0451843_1104350_62_646 | 192 |
| 209 | 3300044656 | Ga0466969_0070406 | Ga0466969_0070406_499_1095 | 192 |
| 210 | 3300044693 | Ga0466961_0002667 | Ga0466961_0002667_1084_1680 | 192 |
| 211 | 3300044842 | Ga0466957_0161795 | Ga0466957_0161795_207_803 | 192 |
| 212 | 3300045976 | Ga0466967_0939819 | Ga0466967_0939819_143_739 | 192 |
| 213 | 3300046454 | Ga0495592_0159446 | Ga0495592_0159446_210_794 | 192 |
| 214 | 3300050492 | nmdc:mga0yw44_162213_c1 | nmdc:mga0yw44_162213_c1_359_952 | 192 |
| 215 | 3300053148 | Ga0500590_055769 | Ga0500590_055769_1025_1609 | 192 |
| 216 | 3300061719 | Ga0466962_0027022 | Ga0466962_0027022_931_1527 | 192 |
| 217 | 3300005355 | Ga0070671_100067021 | Ga0070671_1000670214 | 193 |
| 218 | 3300005459 | Ga0068867_100002336 | Ga0068867_10000233616 | 193 |
| 219 | 3300005467 | Ga0070706_100013190 | Ga0070706_1000131902 | 193 |
| 220 | 3300005468 | Ga0070707_100434109 | Ga0070707_1004341092 | 193 |
| 221 | 3300005549 | Ga0070704_101062663 | Ga0070704_1010626632 | 193 |
| 222 | 3300005616 | Ga0068852_100218130 | Ga0068852_1002181302 | 193 |
| 223 | 3300005618 | Ga0068864_100209211 | Ga0068864_1002092113 | 193 |
| 224 | 3300009148 | Ga0105243_10001013 | Ga0105243_100010136 | 193 |
| 225 | 3300009177 | Ga0105248_10003994 | Ga0105248_100039948 | 193 |
| 226 | 3300014745 | Ga0157377_10000006 | Ga0157377_1000000679 | 193 |
| 227 | 3300025910 | Ga0207684_10046792 | Ga0207684_100467922 | 193 |
| 228 | 3300025920 | Ga0207649_10278194 | Ga0207649_102781941 | 193 |
| 229 | 3300025931 | Ga0207644_10171879 | Ga0207644_101718792 | 193 |
| 230 | 3300025935 | Ga0207709_10000918 | Ga0207709_1000091823 | 193 |
| 231 | 3300025941 | Ga0207711_10103830 | Ga0207711_101038302 | 193 |
| 232 | 3300026089 | Ga0207648_10000936 | Ga0207648_1000093635 | 193 |
| 233 | 3300026142 | Ga0207698_10008831 | Ga0207698_100088317 | 193 |
| 234 | 3300028381 | Ga0268264_10099392 | Ga0268264_100993923 | 193 |
| 235 | 3300031731 | Ga0307405_10138040 | Ga0307405_101380402 | 193 |
| 236 | 3300031731 | Ga0307405_10173049 | Ga0307405_101730492 | 193 |
| 237 | 3300031901 | Ga0307406_10024872 | Ga0307406_100248721 | 193 |
| 238 | 3300031911 | Ga0307412_10292275 | Ga0307412_102922752 | 193 |
| 239 | 3300032002 | Ga0307416_100166488 | Ga0307416_1001664882 | 193 |
| 240 | 3300032002 | Ga0307416_100240950 | Ga0307416_1002409502 | 193 |
| 241 | 3300032126 | Ga0307415_100027395 | Ga0307415_1000273953 | 193 |
| 242 | 3300035116 | Ga0373945_0033745 | Ga0373945_0033745_121_753 | 193 |
| 243 | 3300037471 | Ga0395905_0001177 | Ga0395905_0001177_12012_12602 | 193 |
| 244 | 3300037471 | Ga0395905_0096698 | Ga0395905_0096698_1220_1846 | 193 |
| 245 | 3300044656 | Ga0466969_0000010 | Ga0466969_0000010_50981_51658 | 193 |
| 246 | 3300044656 | Ga0466969_0211406 | Ga0466969_0211406_244_846 | 193 |
| 247 | 3300044684 | Ga0466966_0043768 | Ga0466966_0043768_244_846 | 193 |
| 248 | 3300044693 | Ga0466961_0063227 | Ga0466961_0063227_1180_1857 | 193 |
| 249 | 3300044694 | Ga0466963_0101521 | Ga0466963_0101521_1046_1648 | 193 |
| 250 | 3300044706 | Ga0466964_0050406 | Ga0466964_0050406_564_1166 | 193 |
| 251 | 3300044719 | Ga0466971_0397136 | Ga0466971_0397136_32_622 | 193 |
| 252 | 3300044765 | Ga0466970_0002900 | Ga0466970_0002900_303_905 | 193 |
| 253 | 3300044765 | Ga0466970_0185682 | Ga0466970_0185682_143_820 | 193 |
| 254 | 3300044842 | Ga0466957_0110896 | Ga0466957_0110896_237_839 | 193 |
| 255 | 3300045049 | Ga0466959_0000169 | Ga0466959_0000169_17490_18092 | 193 |
| 256 | 3300045049 | Ga0466959_0025563 | Ga0466959_0025563_3678_4355 | 193 |
| 257 | 3300045836 | Ga0466958_0151575 | Ga0466958_0151575_687_1289 | 193 |
| 258 | 3300045976 | Ga0466967_0436208 | Ga0466967_0436208_183_785 | 193 |
| 259 | 3300048905 | Ga0496102_0006709 | Ga0496102_0006709_3980_4564 | 193 |
| 260 | 3300048907 | Ga0496104_0101794 | Ga0496104_0101794_446_1033 | 193 |
| 261 | 3300048911 | Ga0496108_0182722 | Ga0496108_0182722_859_1446 | 193 |
| 262 | 3300048915 | Ga0496112_0038517 | Ga0496112_0038517_684_1271 | 193 |
| 263 | 3300048916 | Ga0496113_0219898 | Ga0496113_0219898_849_1436 | 193 |
| 264 | 3300049523 | Ga0501300_017303 | Ga0501300_017303_62_646 | 193 |
| 265 | 3300049526 | Ga0501303_022921 | Ga0501303_022921_33_617 | 193 |
| 266 | 3300049653 | Ga0501206_015943 | Ga0501206_015943_301_885 | 193 |
| 267 | 3300049762 | Ga0501265_007902 | Ga0501265_007902_545_1129 | 193 |
| 268 | 3300053078 | Ga0495612_0186495 | Ga0495612_0186495_87_719 | 193 |
| 269 | 3300061719 | Ga0466962_0066086 | Ga0466962_0066086_561_1163 | 193 |
| 270 | 3300061719 | Ga0466962_0295130 | Ga0466962_0295130_69_659 | 193 |
| 271 | iso_pu_bacteria | 2588253510 | 2588291867 | 193 |
| 272 | 3300003215 | JGI25153J46596_10007019 | JGI25153J46596_100070198 | 194 |
| 273 | 3300005331 | Ga0070670_100006074 | Ga0070670_1000060743 | 194 |
| 274 | 3300005354 | Ga0070675_100031570 | Ga0070675_1000315702 | 194 |
| 275 | 3300005364 | Ga0070673_100387946 | Ga0070673_1003879462 | 194 |
| 276 | 3300005543 | Ga0070672_100046972 | Ga0070672_1000469723 | 194 |
| 277 | 3300005618 | Ga0068864_100488682 | Ga0068864_1004886822 | 194 |
| 278 | 3300005841 | Ga0068863_100114674 | Ga0068863_1001146743 | 194 |
| 279 | 3300009177 | Ga0105248_10393162 | Ga0105248_103931622 | 194 |
| 280 | 3300014325 | Ga0163163_10329019 | Ga0163163_103290192 | 194 |
| 281 | 3300017792 | Ga0163161_10107259 | Ga0163161_101072593 | 194 |
| 282 | 3300021384 | Ga0213876_10035781 | Ga0213876_100357812 | 194 |
| 283 | 3300025297 | Ga0209758_1004256 | Ga0209758_10042561 | 194 |
| 284 | 3300025909 | Ga0207705_10124012 | Ga0207705_101240123 | 194 |
| 285 | 3300025925 | Ga0207650_10002949 | Ga0207650_1000294911 | 194 |
| 286 | 3300025926 | Ga0207659_10045449 | Ga0207659_100454494 | 194 |
| 287 | 3300025931 | Ga0207644_10050606 | Ga0207644_100506064 | 194 |
| 288 | 3300025933 | Ga0207706_10006464 | Ga0207706_100064648 | 194 |
| 289 | 3300026088 | Ga0207641_10348724 | Ga0207641_103487242 | 194 |
| 290 | 3300026088 | Ga0207641_10462974 | Ga0207641_104629742 | 194 |
| 291 | 3300035092 | Ga0373952_0014343 | Ga0373952_0014343_963_1559 | 194 |
| 292 | 3300035172 | Ga0373955_0391008 | Ga0373955_0391008_174_812 | 194 |
| 293 | 3300035692 | Ga0373935_0142049 | Ga0373935_0142049_512_1150 | 194 |
| 294 | 3300037471 | Ga0395905_0007409 | Ga0395905_0007409_8210_8806 | 194 |
| 295 | 3300039437 | Ga0436365_0002712 | Ga0436365_0002712_3955_4572 | 194 |
| 296 | 3300044658 | Ga0466972_0001299 | Ga0466972_0001299_1364_1969 | 194 |
| 297 | 3300046683 | Ga0495658_0087843 | Ga0495658_0087843_621_1259 | 194 |
| 298 | 3300048913 | Ga0496110_0252897 | Ga0496110_0252897_417_1055 | 194 |
| 299 | 3300005328 | Ga0070676_10020755 | Ga0070676_100207551 | 195 |
| 300 | 3300005331 | Ga0070670_100008070 | Ga0070670_1000080704 | 195 |
| 301 | 3300005331 | Ga0070670_100077964 | Ga0070670_1000779641 | 195 |
| 302 | 3300005331 | Ga0070670_100129878 | Ga0070670_1001298782 | 195 |
| 303 | 3300005331 | Ga0070670_100452825 | Ga0070670_1004528252 | 195 |
| 304 | 3300005333 | Ga0070677_10020310 | Ga0070677_100203102 | 195 |
| 305 | 3300005334 | Ga0068869_100017350 | Ga0068869_1000173506 | 195 |
| 306 | 3300005335 | Ga0070666_10146727 | Ga0070666_101467272 | 195 |
| 307 | 3300005337 | Ga0070682_100474233 | Ga0070682_1004742331 | 195 |
| 308 | 3300005338 | Ga0068868_100022466 | Ga0068868_1000224663 | 195 |
| 309 | 3300005338 | Ga0068868_100034136 | Ga0068868_1000341361 | 195 |
| 310 | 3300005338 | Ga0068868_100375780 | Ga0068868_1003757802 | 195 |
| 311 | 3300005339 | Ga0070660_100182252 | Ga0070660_1001822522 | 195 |
| 312 | 3300005339 | Ga0070660_100230035 | Ga0070660_1002300352 | 195 |
| 313 | 3300005343 | Ga0070687_100006034 | Ga0070687_1000060341 | 195 |
| 314 | 3300005344 | Ga0070661_100001667 | Ga0070661_1000016676 | 195 |
| 315 | 3300005344 | Ga0070661_100447340 | Ga0070661_1004473402 | 195 |
| 316 | 3300005347 | Ga0070668_100003853 | Ga0070668_1000038532 | 195 |
| 317 | 3300005353 | Ga0070669_100005123 | Ga0070669_1000051235 | 195 |
| 318 | 3300005354 | Ga0070675_100011995 | Ga0070675_1000119954 | 195 |
| 319 | 3300005354 | Ga0070675_100018260 | Ga0070675_1000182605 | 195 |
| 320 | 3300005354 | Ga0070675_100050187 | Ga0070675_1000501871 | 195 |
| 321 | 3300005355 | Ga0070671_100023972 | Ga0070671_1000239723 | 195 |
| 322 | 3300005355 | Ga0070671_100028965 | Ga0070671_1000289655 | 195 |
| 323 | 3300005355 | Ga0070671_100132032 | Ga0070671_1001320323 | 195 |
| 324 | 3300005356 | Ga0070674_100039156 | Ga0070674_1000391563 | 195 |
| 325 | 3300005356 | Ga0070674_100046859 | Ga0070674_1000468593 | 195 |
| 326 | 3300005356 | Ga0070674_100053652 | Ga0070674_1000536523 | 195 |
| 327 | 3300005364 | Ga0070673_100003566 | Ga0070673_1000035665 | 195 |
| 328 | 3300005364 | Ga0070673_100007794 | Ga0070673_1000077943 | 195 |
| 329 | 3300005364 | Ga0070673_100024223 | Ga0070673_1000242232 | 195 |
| 330 | 3300005364 | Ga0070673_100048699 | Ga0070673_1000486992 | 195 |
| 331 | 3300005364 | Ga0070673_100341072 | Ga0070673_1003410721 | 195 |
| 332 | 3300005367 | Ga0070667_100025553 | Ga0070667_1000255533 | 195 |
| 333 | 3300005367 | Ga0070667_100163858 | Ga0070667_1001638583 | 195 |
| 334 | 3300005367 | Ga0070667_100529486 | Ga0070667_1005294861 | 195 |
| 335 | 3300005438 | Ga0070701_10263334 | Ga0070701_102633342 | 195 |
| 336 | 3300005455 | Ga0070663_100901011 | Ga0070663_1009010111 | 195 |
| 337 | 3300005456 | Ga0070678_100020363 | Ga0070678_1000203632 | 195 |
| 338 | 3300005456 | Ga0070678_100129938 | Ga0070678_1001299382 | 195 |
| 339 | 3300005457 | Ga0070662_100007391 | Ga0070662_1000073918 | 195 |
| 340 | 3300005457 | Ga0070662_100018033 | Ga0070662_1000180335 | 195 |
| 341 | 3300005459 | Ga0068867_100004662 | Ga0068867_1000046623 | 195 |
| 342 | 3300005459 | Ga0068867_100010749 | Ga0068867_1000107493 | 195 |
| 343 | 3300005459 | Ga0068867_100017302 | Ga0068867_1000173024 | 195 |
| 344 | 3300005459 | Ga0068867_100774035 | Ga0068867_1007740351 | 195 |
| 345 | 3300005466 | Ga0070685_10571083 | Ga0070685_105710831 | 195 |
| 346 | 3300005518 | Ga0070699_100209236 | Ga0070699_1002092362 | 195 |
| 347 | 3300005535 | Ga0070684_100057588 | Ga0070684_1000575883 | 195 |
| 348 | 3300005539 | Ga0068853_100053324 | Ga0068853_1000533243 | 195 |
| 349 | 3300005539 | Ga0068853_100109927 | Ga0068853_1001099272 | 195 |
| 350 | 3300005539 | Ga0068853_100127632 | Ga0068853_1001276322 | 195 |
| 351 | 3300005539 | Ga0068853_100547769 | Ga0068853_1005477692 | 195 |
| 352 | 3300005539 | Ga0068853_100835793 | Ga0068853_1008357931 | 195 |
| 353 | 3300005543 | Ga0070672_100005430 | Ga0070672_1000054307 | 195 |
| 354 | 3300005543 | Ga0070672_100006558 | Ga0070672_1000065583 | 195 |
| 355 | 3300005543 | Ga0070672_100011962 | Ga0070672_1000119624 | 195 |
| 356 | 3300005543 | Ga0070672_100023123 | Ga0070672_1000231233 | 195 |
| 357 | 3300005548 | Ga0070665_100556828 | Ga0070665_1005568282 | 195 |
| 358 | 3300005564 | Ga0070664_100049125 | Ga0070664_1000491253 | 195 |
| 359 | 3300005564 | Ga0070664_100100514 | Ga0070664_1001005143 | 195 |
| 360 | 3300005564 | Ga0070664_100579453 | Ga0070664_1005794532 | 195 |
| 361 | 3300005577 | Ga0068857_100005818 | Ga0068857_1000058183 | 195 |
| 362 | 3300005577 | Ga0068857_100032809 | Ga0068857_1000328095 | 195 |
| 363 | 3300005577 | Ga0068857_100032823 | Ga0068857_1000328231 | 195 |
| 364 | 3300005578 | Ga0068854_100046890 | Ga0068854_1000468902 | 195 |
| 365 | 3300005578 | Ga0068854_100078529 | Ga0068854_1000785293 | 195 |
| 366 | 3300005578 | Ga0068854_100658631 | Ga0068854_1006586312 | 195 |
| 367 | 3300005614 | Ga0068856_100040549 | Ga0068856_1000405493 | 195 |
| 368 | 3300005616 | Ga0068852_100174474 | Ga0068852_1001744743 | 195 |
| 369 | 3300005616 | Ga0068852_100364211 | Ga0068852_1003642112 | 195 |
| 370 | 3300005616 | Ga0068852_100417914 | Ga0068852_1004179142 | 195 |
| 371 | 3300005617 | Ga0068859_100057456 | Ga0068859_1000574563 | 195 |
| 372 | 3300005618 | Ga0068864_100026599 | Ga0068864_1000265992 | 195 |
| 373 | 3300005618 | Ga0068864_100034603 | Ga0068864_1000346033 | 195 |
| 374 | 3300005718 | Ga0068866_10024004 | Ga0068866_100240042 | 195 |
| 375 | 3300005719 | Ga0068861_100007197 | Ga0068861_1000071978 | 195 |
| 376 | 3300005834 | Ga0068851_10023362 | Ga0068851_100233621 | 195 |
| 377 | 3300005834 | Ga0068851_10062308 | Ga0068851_100623082 | 195 |
| 378 | 3300005834 | Ga0068851_10125635 | Ga0068851_101256352 | 195 |
| 379 | 3300005834 | Ga0068851_10458412 | Ga0068851_104584121 | 195 |
| 380 | 3300005840 | Ga0068870_10480258 | Ga0068870_104802581 | 195 |
| 381 | 3300005841 | Ga0068863_100081253 | Ga0068863_1000812533 | 195 |
| 382 | 3300005842 | Ga0068858_100032248 | Ga0068858_1000322483 | 195 |
| 383 | 3300005843 | Ga0068860_100002908 | Ga0068860_1000029081 | 195 |
| 384 | 3300005843 | Ga0068860_100483870 | Ga0068860_1004838702 | 195 |
| 385 | 3300005844 | Ga0068862_100227262 | Ga0068862_1002272621 | 195 |
| 386 | 3300006042 | Ga0075368_10014629 | Ga0075368_100146292 | 195 |
| 387 | 3300006048 | Ga0075363_100022277 | Ga0075363_1000222773 | 195 |
| 388 | 3300006051 | Ga0075364_10317560 | Ga0075364_103175601 | 195 |
| 389 | 3300006163 | Ga0070715_10198814 | Ga0070715_101988141 | 195 |
| 390 | 3300006177 | Ga0075362_10047342 | Ga0075362_100473422 | 195 |
| 391 | 3300006178 | Ga0075367_10003398 | Ga0075367_100033984 | 195 |
| 392 | 3300006178 | Ga0075367_10008118 | Ga0075367_100081183 | 195 |
| 393 | 3300006195 | Ga0075366_10026111 | Ga0075366_100261113 | 195 |
| 394 | 3300006195 | Ga0075366_10342880 | Ga0075366_103428801 | 195 |
| 395 | 3300006237 | Ga0097621_100168888 | Ga0097621_1001688881 | 195 |
| 396 | 3300006353 | Ga0075370_10000519 | Ga0075370_1000051910 | 195 |
| 397 | 3300006353 | Ga0075370_10004658 | Ga0075370_100046582 | 195 |
| 398 | 3300006353 | Ga0075370_10005088 | Ga0075370_100050885 | 195 |
| 399 | 3300006353 | Ga0075370_10022523 | Ga0075370_100225234 | 195 |
| 400 | 3300006353 | Ga0075370_10030077 | Ga0075370_100300773 | 195 |
| 401 | 3300006353 | Ga0075370_10283454 | Ga0075370_102834542 | 195 |
| 402 | 3300006353 | Ga0075370_10346277 | Ga0075370_103462772 | 195 |
| 403 | 3300006358 | Ga0068871_100132099 | Ga0068871_1001320992 | 195 |
| 404 | 3300006881 | Ga0068865_100452476 | Ga0068865_1004524762 | 195 |
| 405 | 3300006931 | Ga0097620_100057455 | Ga0097620_1000574553 | 195 |
| 406 | 3300009093 | Ga0105240_10597290 | Ga0105240_105972902 | 195 |
| 407 | 3300009098 | Ga0105245_10023807 | Ga0105245_100238075 | 195 |
| 408 | 3300009098 | Ga0105245_10095933 | Ga0105245_100959332 | 195 |
| 409 | 3300009098 | Ga0105245_10208999 | Ga0105245_102089992 | 195 |
| 410 | 3300009148 | Ga0105243_10010176 | Ga0105243_100101764 | 195 |
| 411 | 3300009174 | Ga0105241_10460618 | Ga0105241_104606182 | 195 |
| 412 | 3300009176 | Ga0105242_10248653 | Ga0105242_102486532 | 195 |
| 413 | 3300009177 | Ga0105248_10749489 | Ga0105248_107494892 | 195 |
| 414 | 3300009545 | Ga0105237_10001435 | Ga0105237_100014355 | 195 |
| 415 | 3300009551 | Ga0105238_10005749 | Ga0105238_100057498 | 195 |
| 416 | 3300009553 | Ga0105249_10044249 | Ga0105249_100442493 | 195 |
| 417 | 3300010375 | Ga0105239_10001553 | Ga0105239_100015535 | 195 |
| 418 | 3300010375 | Ga0105239_10033378 | Ga0105239_100333785 | 195 |
| 419 | 3300013104 | Ga0157370_10098030 | Ga0157370_100980303 | 195 |
| 420 | 3300013306 | Ga0163162_10159454 | Ga0163162_101594542 | 195 |
| 421 | 3300013306 | Ga0163162_10593928 | Ga0163162_105939282 | 195 |
| 422 | 3300013307 | Ga0157372_10057147 | Ga0157372_100571473 | 195 |
| 423 | 3300013308 | Ga0157375_10010086 | Ga0157375_100100868 | 195 |
| 424 | 3300013308 | Ga0157375_10034712 | Ga0157375_100347123 | 195 |
| 425 | 3300014326 | Ga0157380_10122316 | Ga0157380_101223162 | 195 |
| 426 | 3300014326 | Ga0157380_10535555 | Ga0157380_105355552 | 195 |
| 427 | 3300014968 | Ga0157379_10007142 | Ga0157379_100071423 | 195 |
| 428 | 3300014968 | Ga0157379_10026336 | Ga0157379_100263363 | 195 |
| 429 | 3300014968 | Ga0157379_10032199 | Ga0157379_100321993 | 195 |
| 430 | 3300014969 | Ga0157376_10313146 | Ga0157376_103131462 | 195 |
| 431 | 3300014969 | Ga0157376_10340742 | Ga0157376_103407421 | 195 |
| 432 | 3300025304 | Ga0209257_1027771 | Ga0209257_10277712 | 195 |
| 433 | 3300025315 | Ga0207697_10044945 | Ga0207697_100449452 | 195 |
| 434 | 3300025321 | Ga0207656_10029458 | Ga0207656_100294582 | 195 |
| 435 | 3300025893 | Ga0207682_10010639 | Ga0207682_100106393 | 195 |
| 436 | 3300025899 | Ga0207642_10012289 | Ga0207642_100122894 | 195 |
| 437 | 3300025899 | Ga0207642_10125355 | Ga0207642_101253552 | 195 |
| 438 | 3300025905 | Ga0207685_10193437 | Ga0207685_101934371 | 195 |
| 439 | 3300025907 | Ga0207645_10013620 | Ga0207645_100136205 | 195 |
| 440 | 3300025907 | Ga0207645_10202144 | Ga0207645_102021442 | 195 |
| 441 | 3300025909 | Ga0207705_10026166 | Ga0207705_100261665 | 195 |
| 442 | 3300025909 | Ga0207705_10355901 | Ga0207705_103559011 | 195 |
| 443 | 3300025910 | Ga0207684_10008994 | Ga0207684_100089944 | 195 |
| 444 | 3300025911 | Ga0207654_10137993 | Ga0207654_101379932 | 195 |
| 445 | 3300025911 | Ga0207654_10236623 | Ga0207654_102366232 | 195 |
| 446 | 3300025913 | Ga0207695_10101950 | Ga0207695_101019501 | 195 |
| 447 | 3300025913 | Ga0207695_10131577 | Ga0207695_101315772 | 195 |
| 448 | 3300025914 | Ga0207671_10129088 | Ga0207671_101290882 | 195 |
| 449 | 3300025918 | Ga0207662_10016086 | Ga0207662_100160865 | 195 |
| 450 | 3300025918 | Ga0207662_10319990 | Ga0207662_103199901 | 195 |
| 451 | 3300025919 | Ga0207657_10055184 | Ga0207657_100551843 | 195 |
| 452 | 3300025922 | Ga0207646_10056675 | Ga0207646_100566753 | 195 |
| 453 | 3300025923 | Ga0207681_10014947 | Ga0207681_100149474 | 195 |
| 454 | 3300025924 | Ga0207694_10059865 | Ga0207694_100598652 | 195 |
| 455 | 3300025924 | Ga0207694_11009785 | Ga0207694_110097851 | 195 |
| 456 | 3300025925 | Ga0207650_10001509 | Ga0207650_100015093 | 195 |
| 457 | 3300025925 | Ga0207650_10009021 | Ga0207650_100090213 | 195 |
| 458 | 3300025926 | Ga0207659_10005000 | Ga0207659_100050003 | 195 |
| 459 | 3300025926 | Ga0207659_10014723 | Ga0207659_100147234 | 195 |
| 460 | 3300025927 | Ga0207687_10013260 | Ga0207687_100132605 | 195 |
| 461 | 3300025931 | Ga0207644_10015344 | Ga0207644_100153443 | 195 |
| 462 | 3300025931 | Ga0207644_10024937 | Ga0207644_100249371 | 195 |
| 463 | 3300025931 | Ga0207644_10154327 | Ga0207644_101543272 | 195 |
| 464 | 3300025931 | Ga0207644_10727169 | Ga0207644_107271691 | 195 |
| 465 | 3300025932 | Ga0207690_10158006 | Ga0207690_101580062 | 195 |
| 466 | 3300025933 | Ga0207706_10006915 | Ga0207706_100069157 | 195 |
| 467 | 3300025933 | Ga0207706_10392194 | Ga0207706_103921941 | 195 |
| 468 | 3300025935 | Ga0207709_10035746 | Ga0207709_100357464 | 195 |
| 469 | 3300025937 | Ga0207669_10088077 | Ga0207669_100880772 | 195 |
| 470 | 3300025938 | Ga0207704_10064898 | Ga0207704_100648982 | 195 |
| 471 | 3300025940 | Ga0207691_10001450 | Ga0207691_1000145017 | 195 |
| 472 | 3300025940 | Ga0207691_10003420 | Ga0207691_100034204 | 195 |
| 473 | 3300025940 | Ga0207691_10013320 | Ga0207691_100133208 | 195 |
| 474 | 3300025940 | Ga0207691_10024373 | Ga0207691_100243735 | 195 |
| 475 | 3300025940 | Ga0207691_10334637 | Ga0207691_103346372 | 195 |
| 476 | 3300025942 | Ga0207689_10008839 | Ga0207689_100088398 | 195 |
| 477 | 3300025942 | Ga0207689_10075066 | Ga0207689_100750662 | 195 |
| 478 | 3300025942 | Ga0207689_10780719 | Ga0207689_107807191 | 195 |
| 479 | 3300025944 | Ga0207661_10150338 | Ga0207661_101503382 | 195 |
| 480 | 3300025945 | Ga0207679_10006305 | Ga0207679_100063056 | 195 |
| 481 | 3300025945 | Ga0207679_10014460 | Ga0207679_100144604 | 195 |
| 482 | 3300025960 | Ga0207651_10021326 | Ga0207651_100213262 | 195 |
| 483 | 3300025960 | Ga0207651_10027746 | Ga0207651_100277462 | 195 |
| 484 | 3300025960 | Ga0207651_10053388 | Ga0207651_100533882 | 195 |
| 485 | 3300025960 | Ga0207651_10210703 | Ga0207651_102107032 | 195 |
| 486 | 3300025961 | Ga0207712_10019369 | Ga0207712_100193693 | 195 |
| 487 | 3300025972 | Ga0207668_10006769 | Ga0207668_100067698 | 195 |
| 488 | 3300025981 | Ga0207640_10133809 | Ga0207640_101338092 | 195 |
| 489 | 3300025981 | Ga0207640_10155096 | Ga0207640_101550962 | 195 |
| 490 | 3300025981 | Ga0207640_10491242 | Ga0207640_104912422 | 195 |
| 491 | 3300025986 | Ga0207658_10019709 | Ga0207658_100197094 | 195 |
| 492 | 3300025986 | Ga0207658_10502215 | Ga0207658_105022152 | 195 |
| 493 | 3300025986 | Ga0207658_10503254 | Ga0207658_105032542 | 195 |
| 494 | 3300026023 | Ga0207677_10008949 | Ga0207677_100089493 | 195 |
| 495 | 3300026023 | Ga0207677_10009887 | Ga0207677_100098872 | 195 |
| 496 | 3300026023 | Ga0207677_10101836 | Ga0207677_101018362 | 195 |
| 497 | 3300026035 | Ga0207703_10026556 | Ga0207703_100265563 | 195 |
| 498 | 3300026041 | Ga0207639_10032785 | Ga0207639_100327854 | 195 |
| 499 | 3300026041 | Ga0207639_10289361 | Ga0207639_102893612 | 195 |
| 500 | 3300026041 | Ga0207639_10600380 | Ga0207639_106003802 | 195 |
| 501 | 3300026067 | Ga0207678_10515338 | Ga0207678_105153382 | 195 |
| 502 | 3300026078 | Ga0207702_10089332 | Ga0207702_100893323 | 195 |
| 503 | 3300026088 | Ga0207641_10045920 | Ga0207641_100459204 | 195 |
| 504 | 3300026088 | Ga0207641_10071563 | Ga0207641_100715633 | 195 |
| 505 | 3300026088 | Ga0207641_10391844 | Ga0207641_103918442 | 195 |
| 506 | 3300026089 | Ga0207648_10005574 | Ga0207648_100055745 | 195 |
| 507 | 3300026089 | Ga0207648_10015155 | Ga0207648_100151554 | 195 |
| 508 | 3300026089 | Ga0207648_10027227 | Ga0207648_100272275 | 195 |
| 509 | 3300026089 | Ga0207648_10030658 | Ga0207648_100306585 | 195 |
| 510 | 3300026095 | Ga0207676_10004408 | Ga0207676_100044083 | 195 |
| 511 | 3300026095 | Ga0207676_10271851 | Ga0207676_102718512 | 195 |
| 512 | 3300026116 | Ga0207674_10012525 | Ga0207674_1001252511 | 195 |
| 513 | 3300026116 | Ga0207674_10633212 | Ga0207674_106332122 | 195 |
| 514 | 3300026118 | Ga0207675_100010737 | Ga0207675_1000107378 | 195 |
| 515 | 3300026118 | Ga0207675_100351726 | Ga0207675_1003517262 | 195 |
| 516 | 3300026121 | Ga0207683_10056908 | Ga0207683_100569084 | 195 |
| 517 | 3300026121 | Ga0207683_10071631 | Ga0207683_100716314 | 195 |
| 518 | 3300026121 | Ga0207683_10140114 | Ga0207683_101401141 | 195 |
| 519 | 3300026142 | Ga0207698_10045653 | Ga0207698_100456533 | 195 |
| 520 | 3300026142 | Ga0207698_10071950 | Ga0207698_100719502 | 195 |
| 521 | 3300026142 | Ga0207698_10340459 | Ga0207698_103404592 | 195 |
| 522 | 3300026142 | Ga0207698_10649096 | Ga0207698_106490962 | 195 |
| 523 | 3300027866 | Ga0209813_10085588 | Ga0209813_100855882 | 195 |
| 524 | 3300028379 | Ga0268266_10104102 | Ga0268266_101041023 | 195 |
| 525 | 3300028381 | Ga0268264_10012844 | Ga0268264_100128442 | 195 |
| 526 | 3300028381 | Ga0268264_10365218 | Ga0268264_103652183 | 195 |
| 527 | 3300028786 | Ga0307517_10025918 | Ga0307517_100259187 | 195 |
| 528 | 3300028794 | Ga0307515_10026336 | Ga0307515_100263363 | 195 |
| 529 | 3300031456 | Ga0307513_10559587 | Ga0307513_105595871 | 195 |
| 530 | 3300031507 | Ga0307509_10168165 | Ga0307509_101681654 | 195 |
| 531 | 3300031548 | Ga0307408_100040814 | Ga0307408_1000408144 | 195 |
| 532 | 3300031548 | Ga0307408_100479211 | Ga0307408_1004792112 | 195 |
| 533 | 3300031730 | Ga0307516_10000723 | Ga0307516_1000072320 | 195 |
| 534 | 3300031730 | Ga0307516_10144069 | Ga0307516_101440692 | 195 |
| 535 | 3300031731 | Ga0307405_10004869 | Ga0307405_100048692 | 195 |
| 536 | 3300031824 | Ga0307413_10047355 | Ga0307413_100473552 | 195 |
| 537 | 3300031852 | Ga0307410_10189644 | Ga0307410_101896441 | 195 |
| 538 | 3300031901 | Ga0307406_10147016 | Ga0307406_101470162 | 195 |
| 539 | 3300031911 | Ga0307412_10367741 | Ga0307412_103677412 | 195 |
| 540 | 3300031911 | Ga0307412_10396936 | Ga0307412_103969361 | 195 |
| 541 | 3300031995 | Ga0307409_100685375 | Ga0307409_1006853751 | 195 |
| 542 | 3300032002 | Ga0307416_100202106 | Ga0307416_1002021063 | 195 |
| 543 | 3300032002 | Ga0307416_100636426 | Ga0307416_1006364262 | 195 |
| 544 | 3300032004 | Ga0307414_10227989 | Ga0307414_102279892 | 195 |
| 545 | 3300032005 | Ga0307411_10140987 | Ga0307411_101409872 | 195 |
| 546 | 3300035691 | Ga0373931_0205102 | Ga0373931_0205102_541_1143 | 195 |
| 547 | 3300035695 | Ga0373927_0091669 | Ga0373927_0091669_1232_1870 | 195 |
| 548 | 3300037471 | Ga0395905_0000078 | Ga0395905_0000078_33579_34208 | 195 |
| 549 | 3300037471 | Ga0395905_0054613 | Ga0395905_0054613_2252_2884 | 195 |
| 550 | 3300039437 | Ga0436365_0306544 | Ga0436365_0306544_817_1434 | 195 |
| 551 | 3300044658 | Ga0466972_0283307 | Ga0466972_0283307_76_693 | 195 |
| 552 | 3300044683 | Ga0466965_0043499 | Ga0466965_0043499_706_1323 | 195 |
| 553 | 3300046522 | Ga0495643_0134961 | Ga0495643_0134961_497_1096 | 195 |
| 554 | 3300046543 | Ga0495645_0110568 | Ga0495645_0110568_1089_1715 | 195 |
| 555 | 3300047443 | Ga0495687_000070 | Ga0495687_000070_82031_82630 | 195 |
| 556 | 3300048911 | Ga0496108_0173708 | Ga0496108_0173708_643_1269 | 195 |
| 557 | 3300048912 | Ga0496109_0130651 | Ga0496109_0130651_1102_1731 | 195 |
| 558 | 3300048912 | Ga0496109_0511104 | Ga0496109_0511104_294_920 | 195 |
| 559 | 3300048913 | Ga0496110_0339284 | Ga0496110_0339284_537_1166 | 195 |
| 560 | 3300048916 | Ga0496113_0747297 | Ga0496113_0747297_137_745 | 195 |
| 561 | 3300048917 | Ga0496114_0094562 | Ga0496114_0094562_1387_2025 | 195 |
| 562 | 3300048928 | Ga0496125_0241988 | Ga0496125_0241988_525_1130 | 195 |
| 563 | 3300050490 | nmdc:mga03n38_61554_c1 | nmdc:mga03n38_61554_c1_902_1501 | 195 |
| 564 | 3300050492 | nmdc:mga0yw44_49238_c1 | nmdc:mga0yw44_49238_c1_903_1502 | 195 |
| 565 | 3300050493 | nmdc:mga0k408_137755_c1 | nmdc:mga0k408_137755_c1_565_1164 | 195 |
| 566 | 3300050493 | nmdc:mga0k408_62782_c1 | nmdc:mga0k408_62782_c1_1057_1656 | 195 |
| 567 | 3300050494 | nmdc:mga06z11_10448_c1 | nmdc:mga06z11_10448_c1_1321_1920 | 195 |
| 568 | 3300050494 | nmdc:mga06z11_60682_c1 | nmdc:mga06z11_60682_c1_1143_1742 | 195 |
| 569 | 3300050495 | nmdc:mga04h51_32983_c1 | nmdc:mga04h51_32983_c1_294_893 | 195 |
| 570 | 3300050496 | nmdc:mga07m45_13444_c1 | nmdc:mga07m45_13444_c1_3497_4096 | 195 |
| 571 | 3300050496 | nmdc:mga07m45_186627_c1 | nmdc:mga07m45_186627_c1_121_720 | 195 |
| 572 | 3300050496 | nmdc:mga07m45_1976_c1 | nmdc:mga07m45_1976_c1_2315_2914 | 195 |
| 573 | 3300050496 | nmdc:mga07m45_43128_c1 | nmdc:mga07m45_43128_c1_309_908 | 195 |
| 574 | 3300050496 | nmdc:mga07m45_97434_c1 | nmdc:mga07m45_97434_c1_1033_1665 | 195 |
| 575 | 3300050516 | nmdc:mga0sz30_42072_c1 | nmdc:mga0sz30_42072_c1_505_1104 | 195 |
| 576 | iso_pu_bacteria | 2643221592 | 2643971481 | 195 |
| 577 | iso_pu_bacteria | 2643221625 | 2644141016 | 195 |
| 578 | iso_pu_bacteria | 2643221648 | 2644276808 | 195 |
| 579 | 3300031456 | Ga0307513_10156076 | Ga0307513_101560761 | 196 |
| 580 | 3300053137 | Ga0500561_0131941 | Ga0500561_0131941_44_727 | 197 |
| 581 | 3300053726 | Ga0500584_117047 | Ga0500584_117047_252_845 | 197 |
| 582 | 3300005262 | Ga0065165_1003998 | Ga0065165_100399810 | 199 |
| 583 | 3300025273 | Ga0209673_1009410 | Ga0209673_10094103 | 199 |
| 584 | 3300025298 | Ga0209050_1000202 | Ga0209050_100020265 | 199 |
| 585 | 3300025303 | Ga0209051_1042523 | Ga0209051_10425232 | 199 |
| 586 | 3300002773 | JGI25152J39213_1002894 | JGI25152J39213_10028946 | 200 |
| 587 | 3300003215 | JGI25153J46596_10011594 | JGI25153J46596_100115942 | 200 |
| 588 | 3300003771 | Ga0055526_1002792 | Ga0055526_10027926 | 200 |
| 589 | 3300025245 | Ga0207425_1000905 | Ga0207425_100090513 | 200 |
| 590 | 3300025258 | Ga0209129_1000038 | Ga0209129_1000038225 | 200 |
| 591 | 3300025258 | Ga0209129_1000154 | Ga0209129_1000154105 | 200 |
| 592 | 3300025273 | Ga0209673_1008207 | Ga0209673_10082073 | 200 |
| 593 | 3300025295 | Ga0209564_1000162 | Ga0209564_1000162127 | 200 |
| 594 | 3300025297 | Ga0209758_1000152 | Ga0209758_100015228 | 200 |
| 595 | 3300025299 | Ga0209256_1035992 | Ga0209256_10359922 | 200 |
| 596 | 3300025304 | Ga0209257_1047002 | Ga0209257_10470021 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yba-assembly1.cif.gz_A | the structure of the c.kpn2i controller protein | 0.9681 | 19 | 70 |
| 1y7y-assembly1.cif.gz_B | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.9592 | 15 | 76 |
| 8ezt-assembly1.cif.gz_D-2 | crystal structure of hipb(lp) from legionella pneumophila | 0.9561 | 18 | 72 |
| 1y7y-assembly1.cif.gz_A | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.9516 | 15 | 76 |
| 3zkc-assembly1.cif.gz_B | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.9471 | 18 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ybaA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9681 | 19 | 70 | 1.10.260.40 |
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9592 | 15 | 76 | 1.10.260.40 |
| 1y7yA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9516 | 15 | 76 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9471 | 18 | 77 | 1.10.260.40 |
| 3zkcA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9385 | 19 | 77 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7C948-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9791 | 14 | 76 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A2J6MKE6-F1-model_v4 | XRE family transcriptional regulator | 0.9784 | 14 | 80 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A6M7UIA0-F1-model_v4 | XRE family transcriptional regulator | 0.9752 | 14 | 80 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A1M3MDD5-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9742 | 14 | 80 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A2A4VCF4-F1-model_v4 | DNA-binding protein | 0.9712 | 17 | 79 |
GO:0003677
GO:0003700 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar