F467600

General Info

Members Datasets Scaffolds Average Seq Length
596 247 1192 205

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0477752|Ga0501040_0477752_276_869
Length 197
Sequence MRLVDAVSLRSRKRKLRLFLEELEPSAQTTVLDVGVDEVGFGGSGGQAGCGTHNFFEELYPWPERITALGLHTGEGFARAYPHIPYVQADGAFDVVFSNAVVEHVGGEERQRAFVAEALRVGRRVFLTTPNRWFPVEVHTRLPLVHWLPDPLAHRAYDLARRPWAKDNRLLGPGDLRALFPGPVRVVNLGLTLVAIV

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
162 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
163 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
167 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
173 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 6.04
Rhizosphere 92.79
Stem 0
Stem Tuber 0
Unclassified 13.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0477752 3300049576 Bacteria 898
2 JGI24739J22299_10097847 3300001989 Bacteria 888
3 JGI24743J22301_10019892 3300001991 Unclassified 1276
4 JGI24738J21930_10027217 3300002075 Unclassified 1171
5 JGI25406J46586_10027498 3300003203 Bacteria 2180
6 Ga0070658_10025356 3300005327 Bacteria 4754
7 Ga0070676_10050882 3300005328 Bacteria 2430
8 Ga0070683_100059088 3300005329 Bacteria 3562
9 Ga0070683_100079754 3300005329 Bacteria 3063
10 Ga0070683_100099763 3300005329 Bacteria 2733
11 Ga0070690_100534651 3300005330 Bacteria 882
12 Ga0070677_10072456 3300005333 Unclassified 1453
13 Ga0070680_100088204 3300005336 Bacteria 2566
14 Ga0070682_100013019 3300005337 Bacteria 4775
15 Ga0070682_100163064 3300005337 Bacteria 1541
16 Ga0068868_100006825 3300005338 Bacteria 8103
17 Ga0068868_100020164 3300005338 Bacteria 5004
18 Ga0070660_100030602 3300005339 Bacteria 4038
19 Ga0070689_100497322 3300005340 Bacteria 1044
20 Ga0070691_10001275 3300005341 Bacteria 10641
21 Ga0070661_100035571 3300005344 Bacteria 3617
22 Ga0070661_100336510 3300005344 Bacteria 1182
23 Ga0070692_10017112 3300005345 Bacteria 3460
24 Ga0070692_10019261 3300005345 Bacteria 3291
25 Ga0070692_10086833 3300005345 Bacteria 1694
26 Ga0070668_100054175 3300005347 Bacteria 3093
27 Ga0070669_100357430 3300005353 Bacteria 1187
28 Ga0070675_100044845 3300005354 Bacteria 3616
29 Ga0070671_100206446 3300005355 Bacteria 1666
30 Ga0070674_100019458 3300005356 Bacteria 4313
31 Ga0070674_100064178 3300005356 Unclassified 2572
32 Ga0070688_100047743 3300005365 Bacteria 2657
33 Ga0070659_100051234 3300005366 Bacteria 3245
34 Ga0070659_100175628 3300005366 Bacteria 1756
35 Ga0070659_100481963 3300005366 Bacteria 1055
36 Ga0070667_100838141 3300005367 Bacteria 855
37 Ga0070701_10036655 3300005438 Bacteria 2471
38 Ga0070705_100019517 3300005440 Bacteria 3568
39 Ga0070700_100008297 3300005441 Bacteria 5653
40 Ga0070700_100026169 3300005441 Bacteria 3443
41 Ga0070700_100104637 3300005441 Bacteria 1870
42 Ga0070694_100194781 3300005444 Bacteria 1507
43 Ga0070694_100216839 3300005444 Bacteria 1434
44 Ga0070663_100100015 3300005455 Bacteria 2163
45 Ga0070678_100023241 3300005456 Bacteria 4127
46 Ga0070662_100092623 3300005457 Bacteria 2272
47 Ga0070662_100125182 3300005457 Bacteria 1975
48 Ga0070681_10012454 3300005458 Bacteria 8438
49 Ga0068867_100050741 3300005459 Bacteria 3059
50 Ga0068867_100068937 3300005459 Bacteria 2640
51 Ga0068867_100550241 3300005459 Bacteria 999
52 Ga0070685_10005508 3300005466 Bacteria 6417
53 Ga0070698_100051788 3300005471 Bacteria 4180
54 Ga0070699_100155688 3300005518 Bacteria 2022
55 Ga0070679_100065439 3300005530 Bacteria 3624
56 Ga0070679_100134554 3300005530 Bacteria 2453
57 Ga0070684_100019412 3300005535 Bacteria 5623
58 Ga0070684_100067185 3300005535 Bacteria 3148
59 Ga0070684_100135317 3300005535 Unclassified 2225
60 Ga0070684_100282937 3300005535 Unclassified 1519
61 Ga0070684_100351687 3300005535 Bacteria 1355
62 Ga0068853_100066724 3300005539 Bacteria 3125
63 Ga0070672_100031701 3300005543 Bacteria 3982
64 Ga0070672_100055546 3300005543 Bacteria 3102
65 Ga0070672_100189113 3300005543 Bacteria 1718
66 Ga0070672_100284093 3300005543 Unclassified 1400
67 Ga0070672_100388465 3300005543 Bacteria 1195
68 Ga0070686_100069060 3300005544 Unclassified 2306
69 Ga0070686_100077645 3300005544 Bacteria 2190
70 Ga0070695_100074656 3300005545 Bacteria 2228
71 Ga0070695_100090592 3300005545 Bacteria 2041
72 Ga0070696_100054400 3300005546 Bacteria 2789
73 Ga0070693_100147551 3300005547 Bacteria 1487
74 Ga0070693_100324436 3300005547 Bacteria 1046
75 Ga0070693_100521399 3300005547 Unclassified 846
76 Ga0070665_100105033 3300005548 Bacteria 2827
77 Ga0070665_100178094 3300005548 Bacteria 2127
78 Ga0070665_101135711 3300005548 Unclassified 793
79 Ga0070704_100017098 3300005549 Bacteria 4603
80 Ga0070704_100522966 3300005549 Bacteria 1033
81 Ga0070664_100068124 3300005564 Bacteria 3042
82 Ga0070664_100096145 3300005564 Bacteria 2570
83 Ga0070664_100113679 3300005564 Bacteria 2365
84 Ga0068857_100899052 3300005577 Bacteria 849
85 Ga0068854_100003129 3300005578 Bacteria 10302
86 Ga0068854_100108467 3300005578 Bacteria 2091
87 Ga0068854_100748408 3300005578 Bacteria 848
88 Ga0068852_100032692 3300005616 Bacteria 4310
89 Ga0068852_100457777 3300005616 Unclassified 1264
90 Ga0068864_100019665 3300005618 Bacteria 5647
91 Ga0068866_10046310 3300005718 Bacteria 2187
92 Ga0068866_10073481 3300005718 Bacteria 1814
93 Ga0068861_100044996 3300005719 Bacteria 3321
94 Ga0068861_101067149 3300005719 Bacteria 775
95 Ga0068851_10058524 3300005834 Bacteria 1970
96 Ga0068870_10023857 3300005840 Unclassified 3022
97 Ga0068870_10195621 3300005840 Archaea 1223
98 Ga0068858_100070859 3300005842 Bacteria 3232
99 Ga0068858_100078073 3300005842 Bacteria 3076
100 Ga0081455_10075691 3300005937 Bacteria 2776
101 Ga0081455_10094885 3300005937 Bacteria 2409
102 Ga0081455_10239767 3300005937 Bacteria 1333
103 Ga0081539_10002688 3300005985 Bacteria 24146
104 Ga0075432_10001384 3300006058 Bacteria 7882
105 Ga0075367_10148750 3300006178 Bacteria 1453
106 Ga0097621_100196392 3300006237 Bacteria 1750
107 Ga0097621_100359516 3300006237 Unclassified 1297
108 Ga0075370_10162755 3300006353 Bacteria 1310
109 Ga0068871_100148941 3300006358 Bacteria 1995
110 Ga0068871_100508424 3300006358 Bacteria 1087
111 Ga0075428_100006418 3300006844 Bacteria 13086
112 Ga0075428_100578884 3300006844 Bacteria 1200
113 Ga0075430_100617662 3300006846 Bacteria 894
114 Ga0075433_10034018 3300006852 Bacteria 4374
115 Ga0075433_10508727 3300006852 Bacteria 1060
116 Ga0075429_100042289 3300006880 Bacteria 3966
117 Ga0075429_100726403 3300006880 Bacteria 870
118 Ga0068865_100006497 3300006881 Bacteria 7138
119 Ga0068865_100214274 3300006881 Bacteria 1502
120 Ga0075436_100399386 3300006914 Bacteria 996
121 Ga0111539_10037117 3300009094 Bacteria 5887
122 Ga0105245_10009339 3300009098 Bacteria 8553
123 Ga0105245_10199867 3300009098 Bacteria 1919
124 Ga0105245_10425178 3300009098 Bacteria 1332
125 Ga0105245_11279366 3300009098 Unclassified 782
126 Ga0105247_10082583 3300009101 Bacteria 2028
127 Ga0114129_10000896 3300009147 Bacteria 38764
128 Ga0114129_10264516 3300009147 Bacteria 2303
129 Ga0114129_10308802 3300009147 Unclassified 2106
130 Ga0114129_10782912 3300009147 Bacteria 1218
131 Ga0105243_10005819 3300009148 Bacteria 9564
132 Ga0105243_10085191 3300009148 Bacteria 2590
133 Ga0105243_10376383 3300009148 Bacteria 1312
134 Ga0105243_10401176 3300009148 Bacteria 1274
135 Ga0105243_11105716 3300009148 Bacteria 801
136 Ga0105241_10609008 3300009174 Bacteria 988
137 Ga0105242_10497072 3300009176 Unclassified 1159
138 Ga0105242_10779990 3300009176 Bacteria 944
139 Ga0105248_10047063 3300009177 Bacteria 4836
140 Ga0105248_10870232 3300009177 Unclassified 1017
141 Ga0105238_10760419 3300009551 Unclassified 983
142 Ga0105239_10055203 3300010375 Bacteria 4357
143 Ga0105239_10076072 3300010375 Bacteria 3692
144 Ga0105239_10094248 3300010375 Bacteria 3306
145 Ga0105239_10099717 3300010375 Bacteria 3212
146 Ga0105239_10414742 3300010375 Bacteria 1525
147 Ga0105246_10014408 3300011119 Bacteria 4973
148 Ga0105246_10153666 3300011119 Bacteria 1745
149 Ga0105246_10640646 3300011119 Bacteria 924
150 Ga0157371_10019286 3300013102 Bacteria 5031
151 Ga0157371_10207766 3300013102 Bacteria 1404
152 Ga0157371_10249976 3300013102 Bacteria 1276
153 Ga0157369_10164613 3300013105 Bacteria 2340
154 Ga0157374_10217353 3300013296 Bacteria 1875
155 Ga0157372_10030676 3300013307 Bacteria 5882
156 Ga0157372_10111039 3300013307 Bacteria 3140
157 Ga0157372_10299089 3300013307 Bacteria 1872
158 Ga0157372_11329542 3300013307 Bacteria 829
159 Ga0157375_10007151 3300013308 Bacteria 9758
160 Ga0157375_10019741 3300013308 Bacteria 6138
161 Ga0157375_10109347 3300013308 Bacteria 2860
162 Ga0157375_10228940 3300013308 Bacteria 2018
163 Ga0157375_10603306 3300013308 Unclassified 1257
164 Ga0157375_11190028 3300013308 Bacteria 894
165 Ga0163163_10079025 3300014325 Bacteria 3287
166 Ga0163163_10316533 3300014325 Bacteria 1614
167 Ga0163163_10620660 3300014325 Bacteria 1144
168 Ga0163163_10884157 3300014325 Bacteria 957
169 Ga0163163_11304388 3300014325 Unclassified 788
170 Ga0157380_10021199 3300014326 Bacteria 4871
171 Ga0157380_10045011 3300014326 Bacteria 3461
172 Ga0157380_10233767 3300014326 Bacteria 1653
173 Ga0157380_10907141 3300014326 Bacteria 908
174 Ga0157377_10045075 3300014745 Bacteria 2462
175 Ga0157377_10319366 3300014745 Unclassified 1031
176 Ga0157379_10052435 3300014968 Bacteria 3644
177 Ga0157376_10045855 3300014969 Bacteria 3601
178 Ga0157376_10593051 3300014969 Unclassified 1102
179 Ga0157376_10779659 3300014969 Bacteria 967
180 Ga0163161_10203629 3300017792 Bacteria 1526
181 Ga0206353_10732547 3300020082 Bacteria 1982
182 Ga0207656_10039165 3300025321 Bacteria 2003
183 Ga0207682_10064919 3300025893 Bacteria 1535
184 Ga0207642_10030560 3300025899 Bacteria 2245
185 Ga0207642_10167572 3300025899 Bacteria 1185
186 Ga0207642_10312865 3300025899 Bacteria 914
187 Ga0207710_10170137 3300025900 Bacteria 1065
188 Ga0207688_10016867 3300025901 Bacteria 3966
189 Ga0207688_10021450 3300025901 Bacteria 3529
190 Ga0207688_10029847 3300025901 Bacteria 3005
191 Ga0207688_10139322 3300025901 Bacteria 1427
192 Ga0207647_10113299 3300025904 Bacteria 1603
193 Ga0207645_10074078 3300025907 Bacteria 2180
194 Ga0207645_10087642 3300025907 Bacteria 2000
195 Ga0207643_10002884 3300025908 Bacteria 9279
196 Ga0207654_10223275 3300025911 Bacteria 1251
197 Ga0207707_10051974 3300025912 Bacteria 3568
198 Ga0207707_10416033 3300025912 Unclassified 1153
199 Ga0207660_10056205 3300025917 Bacteria 2815
200 Ga0207657_10037484 3300025919 Bacteria 4328
201 Ga0207649_10151537 3300025920 Bacteria 1597
202 Ga0207652_10151152 3300025921 Bacteria 2079
203 Ga0207652_10593962 3300025921 Unclassified 993
204 Ga0207681_10220506 3300025923 Bacteria 1467
205 Ga0207694_10011601 3300025924 Bacteria 6650
206 Ga0207694_10526744 3300025924 Bacteria 991
207 Ga0207650_10021355 3300025925 Bacteria 4575
208 Ga0207650_10244895 3300025925 Bacteria 1450
209 Ga0207650_10365563 3300025925 Bacteria 1189
210 Ga0207659_10240488 3300025926 Bacteria 1464
211 Ga0207659_10852439 3300025926 Bacteria 783
212 Ga0207687_10043656 3300025927 Bacteria 3090
213 Ga0207687_10171712 3300025927 Bacteria 1673
214 Ga0207644_10067161 3300025931 Bacteria 2613
215 Ga0207690_10120856 3300025932 Bacteria 1902
216 Ga0207690_10292400 3300025932 Unclassified 1272
217 Ga0207706_10026936 3300025933 Bacteria 5144
218 Ga0207706_10121734 3300025933 Bacteria 2294
219 Ga0207706_10151195 3300025933 Bacteria 2042
220 Ga0207686_10399499 3300025934 Unclassified 1046
221 Ga0207709_10146052 3300025935 Bacteria 1632
222 Ga0207709_10148362 3300025935 Unclassified 1621
223 Ga0207709_10167660 3300025935 Bacteria 1538
224 Ga0207709_10358050 3300025935 Bacteria 1104
225 Ga0207709_10389975 3300025935 Bacteria 1062
226 Ga0207709_10651929 3300025935 Bacteria 838
227 Ga0207670_10217634 3300025936 Bacteria 1460
228 Ga0207669_10007615 3300025937 Bacteria 5026
229 Ga0207669_10038577 3300025937 Bacteria 2752
230 Ga0207669_10094433 3300025937 Bacteria 1957
231 Ga0207669_10156922 3300025937 Bacteria 1602
232 Ga0207704_10003930 3300025938 Bacteria 6755
233 Ga0207704_10052330 3300025938 Bacteria 2475
234 Ga0207704_10148331 3300025938 Unclassified 1651
235 Ga0207691_10007729 3300025940 Bacteria 10349
236 Ga0207691_10052788 3300025940 Bacteria 3712
237 Ga0207691_10056024 3300025940 Bacteria 3592
238 Ga0207691_10091388 3300025940 Bacteria 2727
239 Ga0207691_10145302 3300025940 Bacteria 2088
240 Ga0207691_10266761 3300025940 Bacteria 1475
241 Ga0207691_10638702 3300025940 Bacteria 900
242 Ga0207711_10045526 3300025941 Bacteria 3749
243 Ga0207689_10089417 3300025942 Bacteria 2530
244 Ga0207661_10000652 3300025944 Bacteria 22376
245 Ga0207661_10232766 3300025944 Bacteria 1632
246 Ga0207661_10410535 3300025944 Bacteria 1229
247 Ga0207679_10075292 3300025945 Bacteria 2561
248 Ga0207679_10105999 3300025945 Bacteria 2208
249 Ga0207679_10157412 3300025945 Bacteria 1856
250 Ga0207679_10568565 3300025945 Unclassified 1019
251 Ga0207667_10099418 3300025949 Bacteria 3001
252 Ga0207651_10378279 3300025960 Unclassified 1199
253 Ga0207712_10153884 3300025961 Bacteria 1779
254 Ga0207712_11051848 3300025961 Bacteria 723
255 Ga0207640_10039128 3300025981 Bacteria 2999
256 Ga0207640_10869121 3300025981 Bacteria 786
257 Ga0207677_10020450 3300026023 Bacteria 4020
258 Ga0207677_10915268 3300026023 Bacteria 791
259 Ga0207639_10052515 3300026041 Bacteria 3106
260 Ga0207639_10309253 3300026041 Bacteria 1399
261 Ga0207678_10057504 3300026067 Bacteria 3347
262 Ga0207678_10091070 3300026067 Bacteria 2606
263 Ga0207708_10051023 3300026075 Bacteria 3149
264 Ga0207708_10066351 3300026075 Bacteria 2759
265 Ga0207708_10096029 3300026075 Bacteria 2290
266 Ga0207708_10125882 3300026075 Bacteria 2000
267 Ga0207702_10270083 3300026078 Unclassified 1604
268 Ga0207641_10061648 3300026088 Bacteria 3199
269 Ga0207641_10137105 3300026088 Unclassified 2204
270 Ga0207648_10048840 3300026089 Bacteria 3704
271 Ga0207648_10108635 3300026089 Bacteria 2435
272 Ga0207648_10200484 3300026089 Bacteria 1770
273 Ga0207648_10610769 3300026089 Unclassified 1006
274 Ga0207676_10140900 3300026095 Bacteria 2064
275 Ga0207676_10380394 3300026095 Bacteria 1314
276 Ga0207674_10013487 3300026116 Bacteria 9063
277 Ga0207674_10141696 3300026116 Bacteria 2363
278 Ga0207675_100068551 3300026118 Bacteria 3315
279 Ga0207675_100283749 3300026118 Bacteria 1609
280 Ga0207683_10059867 3300026121 Bacteria 3346
281 Ga0207683_10069795 3300026121 Bacteria 3103
282 Ga0207683_10222869 3300026121 Bacteria 1718
283 Ga0207428_10000798 3300027907 Bacteria 35648
284 Ga0207428_10051517 3300027907 Bacteria 3290
285 Ga0207428_10090728 3300027907 Unclassified 2373
286 Ga0268266_10226708 3300028379 Unclassified 1720
287 Ga0268265_10385485 3300028380 Bacteria 1291
288 Ga0268265_10401671 3300028380 Bacteria 1267
289 Ga0268264_10071682 3300028381 Bacteria 2936
290 Ga0307408_100429496 3300031548 Unclassified 1141
291 Ga0307406_10440181 3300031901 Bacteria 1043
292 Ga0307409_100379867 3300031995 Unclassified 1343
293 Ga0307416_100479725 3300032002 Unclassified 1303
294 Ga0307416_100490239 3300032002 Bacteria 1291
295 Ga0307416_100545304 3300032002 Unclassified 1232
296 Ga0307411_10687067 3300032005 Unclassified 890
297 Ga0373948_0049666 3300034817 Bacteria 898
298 Ga0373958_0003444 3300034819 Bacteria 2282
299 Ga0373932_0020208 3300035112 Bacteria 1744
300 Ga0373941_0105672 3300035115 Bacteria 986
301 Ga0373960_0126052 3300035121 Bacteria 854
302 Ga0373961_0037957 3300035241 Bacteria 1379
303 Ga0373961_0038656 3300035241 Bacteria 1368
304 Ga0373931_0183503 3300035691 Bacteria 1241
305 Ga0395900_0060379 3300037418 Bacteria 3902
306 Ga0395905_0337386 3300037471 Bacteria 1398
307 Ga0395901_0009274 3300038443 Bacteria 9978
308 Ga0395901_0039151 3300038443 Bacteria 4906
309 Ga0439461_0001610 3300041410 Bacteria 3504
310 Ga0439461_0009146 3300041410 Unclassified 1792
311 Ga0451845_0927633 3300041501 Bacteria 853
312 Ga0451849_1333593 3300041505 Bacteria 757
313 Ga0451853_2633744 3300041512 Bacteria 979
314 Ga0439431_0001868 3300041997 Bacteria 4670
315 Ga0439433_0001650 3300041999 Bacteria 4647
316 Ga0439442_006220 3300042002 Bacteria 2395
317 Ga0439448_0034253 3300042005 Bacteria 1622
318 Ga0439432_087241 3300042006 Unclassified 941
319 Ga0439449_0068787 3300042007 Unclassified 1305
320 Ga0450923_008677 3300042125 Unclassified 1756
321 Ga0450902_007255 3300042137 Unclassified 1714
322 Ga0450906_026840 3300042145 Unclassified 1022
323 Ga0439446_0003129 3300042156 Bacteria 4070
324 Ga0439434_0030590 3300042435 Unclassified 1635
325 Ga0439460_0203166 3300042461 Unclassified 675
326 Ga0450918_006750 3300042531 Bacteria 2044
327 Ga0451576_0757872 3300045051 Unclassified 1020
328 Ga0495651_0071443 3300046462 Bacteria 2639
329 Ga0495605_0191403 3300046474 Unclassified 895
330 Ga0495596_0149914 3300046500 Unclassified 906
331 Ga0495596_0193271 3300046500 Bacteria 791
332 Ga0495620_0108833 3300046515 Bacteria 1100
333 Ga0495631_0197752 3300046518 Bacteria 860
334 Ga0495637_0089343 3300046520 Unclassified 1218
335 Ga0495644_0091273 3300046523 Bacteria 1150
336 Ga0495609_0112774 3300046538 Bacteria 1173
337 Ga0495656_0027753 3300046615 Archaea 2264
338 Ga0495656_0092678 3300046615 Unclassified 1384
339 Ga0495656_0166571 3300046615 Bacteria 1074
340 Ga0495657_0213669 3300046675 Bacteria 1172
341 Ga0495589_0271428 3300046794 Bacteria 790
342 Ga0495660_0063041 3300046810 Bacteria 1986
343 Ga0495674_0067767 3300047319 Bacteria 3091
344 Ga0496100_0059106 3300048903 Bacteria 2518
345 Ga0496100_0307903 3300048903 Bacteria 1187
346 Ga0496101_0550124 3300048904 Bacteria 912
347 Ga0496102_0191421 3300048905 Bacteria 1927
348 Ga0496102_0518995 3300048905 Bacteria 1114
349 Ga0496102_0639412 3300048905 Bacteria 987
350 Ga0496103_0124721 3300048906 Bacteria 1642
351 Ga0496104_0070206 3300048907 Bacteria 3330
352 Ga0496104_0114579 3300048907 Bacteria 2586
353 Ga0496104_0125288 3300048907 Bacteria 2467
354 Ga0496104_0770458 3300048907 Bacteria 869
355 Ga0496105_0080571 3300048908 Bacteria 2689
356 Ga0496105_0220839 3300048908 Unclassified 1543
357 Ga0496108_0029280 3300048911 Bacteria 4558
358 Ga0496108_0052619 3300048911 Bacteria 3413
359 Ga0496108_0078296 3300048911 Bacteria 2798
360 Ga0496108_0576898 3300048911 Bacteria 980
361 Ga0496108_0672681 3300048911 Bacteria 899
362 Ga0496109_0010431 3300048912 Bacteria 7936
363 Ga0496109_0012606 3300048912 Bacteria 7299
364 Ga0496109_0142367 3300048912 Bacteria 2243
365 Ga0496109_0361728 3300048912 Bacteria 1371
366 Ga0496109_0479850 3300048912 Unclassified 1174
367 Ga0496109_1215605 3300048912 Bacteria 690
368 Ga0496110_0029418 3300048913 Bacteria 4727
369 Ga0496110_0046343 3300048913 Bacteria 3803
370 Ga0496110_0201499 3300048913 Bacteria 1808
371 Ga0496110_0235146 3300048913 Unclassified 1667
372 Ga0496110_0664469 3300048913 Bacteria 942
373 Ga0496111_0259657 3300048914 Bacteria 1289
374 Ga0496111_0554516 3300048914 Bacteria 843
375 Ga0496112_0019038 3300048915 Bacteria 6472
376 Ga0496114_0015274 3300048917 Bacteria 6174
377 Ga0496114_0131105 3300048917 Bacteria 2165
378 Ga0496114_0766203 3300048917 Bacteria 843
379 Ga0496115_0520680 3300048918 Bacteria 954
380 Ga0501031_0039438 3300049568 Bacteria 3082
381 Ga0501031_0080099 3300049568 Bacteria 2128
382 Ga0501031_0156207 3300049568 Bacteria 1491
383 Ga0501031_0157686 3300049568 Bacteria 1483
384 Ga0501031_0313158 3300049568 Bacteria 1017
385 Ga0501032_0010237 3300049569 Bacteria 6767
386 Ga0501032_0028760 3300049569 Bacteria 3817
387 Ga0501033_0003943 3300049570 Bacteria 12033
388 Ga0501033_0261820 3300049570 Bacteria 1224
389 Ga0501034_0027555 3300049571 Bacteria 5779
390 Ga0501034_0192494 3300049571 Bacteria 2001
391 Ga0501034_0620848 3300049571 Unclassified 985
392 Ga0501036_0001948 3300049572 Bacteria 16020
393 Ga0501036_0014830 3300049572 Bacteria 6500
394 Ga0501036_0051449 3300049572 Bacteria 3487
395 Ga0501036_0479585 3300049572 Bacteria 1035
396 Ga0501037_0009974 3300049573 Bacteria 6966
397 Ga0501037_0289276 3300049573 Unclassified 1140
398 Ga0501037_0436683 3300049573 Unclassified 894
399 Ga0501037_0571164 3300049573 Bacteria 762
400 Ga0501038_0012350 3300049574 Bacteria 7805
401 Ga0501038_0027791 3300049574 Bacteria 5028
402 Ga0501038_0063121 3300049574 Bacteria 3163
403 Ga0501038_0160044 3300049574 Bacteria 1830
404 Ga0501038_0191874 3300049574 Bacteria 1643
405 Ga0501039_0005106 3300049575 Bacteria 9943
406 Ga0501039_0007758 3300049575 Bacteria 8188
407 Ga0501039_0012123 3300049575 Bacteria 6571
408 Ga0501039_0034642 3300049575 Bacteria 3895
409 Ga0501039_0078630 3300049575 Bacteria 2566
410 Ga0501039_0203071 3300049575 Bacteria 1558
411 Ga0501040_0001259 3300049576 Bacteria 16110
412 Ga0501040_0004669 3300049576 Bacteria 8885
413 Ga0501040_0012536 3300049576 Bacteria 5556
414 Ga0501040_0015119 3300049576 Bacteria 5099
415 Ga0501040_0060193 3300049576 Bacteria 2609
416 Ga0501040_0073366 3300049576 Unclassified 2364
417 Ga0501040_0099238 3300049576 Bacteria 2030
418 Ga0501040_0502988 3300049576 Unclassified 873
419 Ga0501041_0002939 3300049577 Bacteria 9774
420 Ga0501041_0006592 3300049577 Bacteria 6799
421 Ga0501041_0030754 3300049577 Bacteria 3241
422 Ga0501041_0307945 3300049577 Bacteria 998
423 Ga0501042_0005882 3300049578 Bacteria 7929
424 Ga0501042_0015410 3300049578 Bacteria 5234
425 Ga0501042_0022681 3300049578 Bacteria 4385
426 Ga0501042_0025310 3300049578 Bacteria 4167
427 Ga0501042_0031167 3300049578 Bacteria 3773
428 Ga0501042_0039334 3300049578 Bacteria 3360
429 Ga0501042_0063258 3300049578 Bacteria 2644
430 Ga0501042_0476496 3300049578 Bacteria 906
431 Ga0501043_0003946 3300049579 Bacteria 12166
432 Ga0501043_0161439 3300049579 Unclassified 1751
433 Ga0501046_0005562 3300049580 Bacteria 11259
434 Ga0501046_0015123 3300049580 Bacteria 6488
435 Ga0501046_0041321 3300049580 Bacteria 3680
436 Ga0501046_0051453 3300049580 Bacteria 3250
437 Ga0501046_0085302 3300049580 Bacteria 2435
438 Ga0501047_0200780 3300049581 Bacteria 1855
439 Ga0501048_0006715 3300049582 Bacteria 8742
440 Ga0501048_0007997 3300049582 Bacteria 8005
441 Ga0501048_0014173 3300049582 Bacteria 5907
442 Ga0501048_0030889 3300049582 Bacteria 3876
443 Ga0501048_0051311 3300049582 Bacteria 2936
444 Ga0501048_0052924 3300049582 Bacteria 2888
445 Ga0501048_0065745 3300049582 Bacteria 2564
446 Ga0501048_0238617 3300049582 Bacteria 1290
447 Ga0501048_0405970 3300049582 Unclassified 974
448 Ga0501067_0006263 3300049583 Bacteria 6600
449 Ga0501067_0038418 3300049583 Bacteria 2657
450 Ga0501067_0100930 3300049583 Bacteria 1603
451 Ga0501067_0180610 3300049583 Unclassified 1175
452 Ga0501068_0004980 3300049584 Bacteria 7235
453 Ga0501068_0014535 3300049584 Bacteria 4502
454 Ga0501068_0021087 3300049584 Bacteria 3803
455 Ga0501068_0023196 3300049584 Bacteria 3635
456 Ga0501068_0065860 3300049584 Bacteria 2206
457 Ga0501068_0103844 3300049584 Bacteria 1763
458 Ga0501068_0117265 3300049584 Bacteria 1658
459 Ga0501069_0004260 3300049585 Bacteria 7389
460 Ga0501069_0051388 3300049585 Bacteria 2294
461 Ga0501069_0061874 3300049585 Bacteria 2090
462 Ga0501069_0116914 3300049585 Unclassified 1521
463 Ga0501070_0006624 3300049586 Bacteria 9857
464 Ga0501070_0023384 3300049586 Bacteria 5177
465 Ga0501070_0045442 3300049586 Bacteria 3653
466 Ga0501070_0261586 3300049586 Bacteria 1414
467 Ga0501071_0089781 3300049587 Bacteria 2255
468 Ga0501071_0178115 3300049587 Bacteria 1592
469 Ga0501071_0228492 3300049587 Bacteria 1401
470 Ga0501071_0397725 3300049587 Unclassified 1052
471 Ga0501072_0009351 3300049588 Bacteria 7450
472 Ga0501072_0024754 3300049588 Bacteria 4672
473 Ga0501072_0033906 3300049588 Bacteria 4000
474 Ga0501072_0045914 3300049588 Bacteria 3436
475 Ga0501072_0056481 3300049588 Bacteria 3093
476 Ga0501072_0063015 3300049588 Bacteria 2924
477 Ga0501072_0097696 3300049588 Unclassified 2334
478 Ga0501072_0165100 3300049588 Bacteria 1766
479 Ga0501072_0219394 3300049588 Bacteria 1516
480 Ga0501072_0326434 3300049588 Bacteria 1219
481 Ga0501073_0027379 3300049589 Bacteria 4076
482 Ga0501073_0129361 3300049589 Bacteria 1750
483 Ga0501073_0173894 3300049589 Bacteria 1491
484 Ga0501073_0261225 3300049589 Bacteria 1195
485 Ga0501073_0295251 3300049589 Bacteria 1118
486 Ga0501074_0009811 3300049590 Bacteria 6954
487 Ga0501074_0022777 3300049590 Bacteria 4554
488 Ga0501074_0034249 3300049590 Bacteria 3682
489 Ga0501074_0049940 3300049590 Archaea 3020
490 Ga0501074_0053390 3300049590 Bacteria 2915
491 Ga0501074_0294384 3300049590 Bacteria 1153
492 Ga0501075_0002896 3300049591 Bacteria 11518
493 Ga0501075_0005578 3300049591 Bacteria 8608
494 Ga0501075_0031634 3300049591 Bacteria 3928
495 Ga0501075_0038594 3300049591 Bacteria 3571
496 Ga0501075_0045046 3300049591 Bacteria 3310
497 Ga0501075_0075741 3300049591 Bacteria 2544
498 Ga0501075_0078054 3300049591 Bacteria 2507
499 Ga0501075_0141630 3300049591 Bacteria 1832
500 Ga0501075_0503054 3300049591 Bacteria 924
501 Ga0501075_0589601 3300049591 Unclassified 848
502 Ga0501076_0003393 3300049592 Bacteria 11182
503 Ga0501076_0010215 3300049592 Bacteria 6958
504 Ga0501076_0146246 3300049592 Unclassified 1922
505 Ga0501076_0233159 3300049592 Bacteria 1505
506 Ga0501076_0303275 3300049592 Bacteria 1309
507 Ga0501076_0426352 3300049592 Bacteria 1091
508 Ga0501076_0784018 3300049592 Unclassified 786
509 Ga0501077_0003236 3300049593 Bacteria 9810
510 Ga0501077_0006256 3300049593 Bacteria 7280
511 Ga0501077_0009288 3300049593 Bacteria 6104
512 Ga0501077_0013415 3300049593 Bacteria 5139
513 Ga0501077_0055861 3300049593 Bacteria 2506
514 Ga0501077_0063722 3300049593 Bacteria 2338
515 Ga0501077_0075883 3300049593 Bacteria 2129
516 Ga0501077_0096869 3300049593 Bacteria 1869
517 Ga0501077_0176154 3300049593 Bacteria 1359
518 Ga0501077_0310180 3300049593 Unclassified 1006
519 Ga0501079_0003089 3300049741 Bacteria 12191
520 Ga0501079_0036001 3300049741 Bacteria 3811
521 Ga0501079_0043947 3300049741 Bacteria 3448
522 Ga0501079_0057238 3300049741 Bacteria 3008
523 Ga0501079_0057788 3300049741 Unclassified 2993
524 Ga0501079_0103901 3300049741 Bacteria 2204
525 Ga0501079_0172696 3300049741 Bacteria 1685
526 Ga0501079_0293099 3300049741 Bacteria 1272
527 Ga0501079_0615411 3300049741 Bacteria 855
528 Ga0501079_0959010 3300049741 Bacteria 673
529 Ga0501080_0055581 3300049742 Bacteria 3687
530 Ga0501080_0065434 3300049742 Bacteria 3381
531 Ga0501080_0069290 3300049742 Bacteria 3280
532 Ga0501080_0107086 3300049742 Bacteria 2591
533 Ga0501080_0128260 3300049742 Bacteria 2348
534 Ga0501080_0443656 3300049742 Bacteria 1164
535 Ga0501080_0483717 3300049742 Bacteria 1107
536 Ga0501081_0000659 3300049743 Bacteria 19786
537 Ga0501081_0020891 3300049743 Bacteria 4368
538 Ga0501081_0022847 3300049743 Bacteria 4187
539 Ga0501081_0025107 3300049743 Bacteria 4006
540 Ga0501081_0029560 3300049743 Bacteria 3704
541 Ga0501081_0039365 3300049743 Bacteria 3234
542 Ga0501081_0162307 3300049743 Bacteria 1610
543 Ga0501083_0062578 3300049744 Bacteria 2482
544 Ga0501083_0075363 3300049744 Bacteria 2241
545 Ga0501083_0075497 3300049744 Bacteria 2239
546 Ga0501083_0133295 3300049744 Bacteria 1629
547 Ga0501035_0037180 3300049822 Bacteria 4410
548 Ga0501035_0053900 3300049822 Bacteria 3595
549 Ga0501035_0100839 3300049822 Bacteria 2534
550 Ga0501035_0155019 3300049822 Bacteria 1986
551 Ga0501035_0279137 3300049822 Bacteria 1412
552 Ga0501044_0025012 3300049823 Bacteria 6331
553 Ga0501044_0136032 3300049823 Bacteria 2449
554 Ga0501044_0199145 3300049823 Bacteria 1962
555 Ga0501045_0001032 3300049824 Bacteria 18298
556 Ga0501045_0026827 3300049824 Archaea 4146
557 Ga0501045_0032274 3300049824 Bacteria 3794
558 Ga0501045_0041645 3300049824 Bacteria 3342
559 Ga0501045_0050059 3300049824 Bacteria 3047
560 Ga0501045_0055659 3300049824 Bacteria 2892
561 Ga0501045_0070820 3300049824 Bacteria 2565
562 Ga0501045_0085886 3300049824 Bacteria 2322
563 Ga0501045_0468387 3300049824 Unclassified 936
564 Ga0501045_0615799 3300049824 Unclassified 803
565 nmdc:mga00v17_6407_c1 3300050491 Bacteria 6243
566 nmdc:mga07m45_60679_c1 3300050496 Bacteria 2141
567 nmdc:mga05p37_135578_c1 3300050507 Unclassified 3019
568 nmdc:mga05p37_152400_c1 3300050507 Unclassified 2826
569 nmdc:mga05p37_20385_c1 3300050507 Bacteria 8020
570 nmdc:mga05p37_464267_c1 3300050507 Bacteria 1462
571 nmdc:mga09592_55073_c1 3300050508 Bacteria 3361
572 nmdc:mga08y16_1032489_c1 3300050511 Unclassified 800
573 nmdc:mga08y16_12365_c1 3300050511 Bacteria 8975
574 nmdc:mga08y16_18447_c1 3300050511 Bacteria 7352
575 nmdc:mga08x19_339220_c1 3300050514 Bacteria 1048
576 nmdc:mga0a205_237416_c1 3300050515 Bacteria 1704
577 nmdc:mga0a205_246108_c1 3300050515 Bacteria 1668
578 nmdc:mga0a205_7972_c1 3300050515 Bacteria 9622
579 Ga0495619_0134260 3300053085 Bacteria 1702
580 Ga0501084_0038348 3300054114 Bacteria 4006
581 Ga0501084_0161318 3300054114 Bacteria 1891
582 Ga0501084_0244887 3300054114 Bacteria 1513
583 Ga0501084_0508918 3300054114 Bacteria 1018
584 Ga0501082_0057564 3300060353 Bacteria 3348
585 Ga0501082_0083637 3300060353 Bacteria 2753
586 Ga0501082_0154985 3300060353 Bacteria 1990
587 Ga0501082_0260023 3300060353 Unclassified 1510
588 Ga0501082_0351263 3300060353 Bacteria 1285
589 Ga0530510_0009774 3300061734 Bacteria 6731
590 Ga0530510_0021196 3300061734 Bacteria 4622
591 Ga0530510_0025725 3300061734 Bacteria 4209
592 Ga0530510_0087356 3300061734 Bacteria 2272
593 Ga0530510_0093670 3300061734 Bacteria 2194
594 Ga0530510_0135890 3300061734 Bacteria 1810
595 Ga0530510_0183481 3300061734 Bacteria 1552
596 Ga0530510_0827199 3300061734 Unclassified 707
597 Ga0501040_0477752
598 JGI24739J22299_10097847
599 JGI24743J22301_10019892
600 JGI24738J21930_10027217
601 JGI25406J46586_10027498
602 Ga0070658_10025356
603 Ga0070676_10050882
604 Ga0070683_100059088
605 Ga0070683_100079754
606 Ga0070683_100099763
607 Ga0070690_100534651
608 Ga0070677_10072456
609 Ga0070680_100088204
610 Ga0070682_100013019
611 Ga0070682_100163064
612 Ga0068868_100006825
613 Ga0068868_100020164
614 Ga0070660_100030602
615 Ga0070689_100497322
616 Ga0070691_10001275
617 Ga0070661_100035571
618 Ga0070661_100336510
619 Ga0070692_10017112
620 Ga0070692_10019261
621 Ga0070692_10086833
622 Ga0070668_100054175
623 Ga0070669_100357430
624 Ga0070675_100044845
625 Ga0070671_100206446
626 Ga0070674_100019458
627 Ga0070674_100064178
628 Ga0070688_100047743
629 Ga0070659_100051234
630 Ga0070659_100175628
631 Ga0070659_100481963
632 Ga0070667_100838141
633 Ga0070701_10036655
634 Ga0070705_100019517
635 Ga0070700_100008297
636 Ga0070700_100026169
637 Ga0070700_100104637
638 Ga0070694_100194781
639 Ga0070694_100216839
640 Ga0070663_100100015
641 Ga0070678_100023241
642 Ga0070662_100092623
643 Ga0070662_100125182
644 Ga0070681_10012454
645 Ga0068867_100050741
646 Ga0068867_100068937
647 Ga0068867_100550241
648 Ga0070685_10005508
649 Ga0070698_100051788
650 Ga0070699_100155688
651 Ga0070679_100065439
652 Ga0070679_100134554
653 Ga0070684_100019412
654 Ga0070684_100067185
655 Ga0070684_100135317
656 Ga0070684_100282937
657 Ga0070684_100351687
658 Ga0068853_100066724
659 Ga0070672_100031701
660 Ga0070672_100055546
661 Ga0070672_100189113
662 Ga0070672_100284093
663 Ga0070672_100388465
664 Ga0070686_100069060
665 Ga0070686_100077645
666 Ga0070695_100074656
667 Ga0070695_100090592
668 Ga0070696_100054400
669 Ga0070693_100147551
670 Ga0070693_100324436
671 Ga0070693_100521399
672 Ga0070665_100105033
673 Ga0070665_100178094
674 Ga0070665_101135711
675 Ga0070704_100017098
676 Ga0070704_100522966
677 Ga0070664_100068124
678 Ga0070664_100096145
679 Ga0070664_100113679
680 Ga0068857_100899052
681 Ga0068854_100003129
682 Ga0068854_100108467
683 Ga0068854_100748408
684 Ga0068852_100032692
685 Ga0068852_100457777
686 Ga0068864_100019665
687 Ga0068866_10046310
688 Ga0068866_10073481
689 Ga0068861_100044996
690 Ga0068861_101067149
691 Ga0068851_10058524
692 Ga0068870_10023857
693 Ga0068870_10195621
694 Ga0068858_100070859
695 Ga0068858_100078073
696 Ga0081455_10075691
697 Ga0081455_10094885
698 Ga0081455_10239767
699 Ga0081539_10002688
700 Ga0075432_10001384
701 Ga0075367_10148750
702 Ga0097621_100196392
703 Ga0097621_100359516
704 Ga0075370_10162755
705 Ga0068871_100148941
706 Ga0068871_100508424
707 Ga0075428_100006418
708 Ga0075428_100578884
709 Ga0075430_100617662
710 Ga0075433_10034018
711 Ga0075433_10508727
712 Ga0075429_100042289
713 Ga0075429_100726403
714 Ga0068865_100006497
715 Ga0068865_100214274
716 Ga0075436_100399386
717 Ga0111539_10037117
718 Ga0105245_10009339
719 Ga0105245_10199867
720 Ga0105245_10425178
721 Ga0105245_11279366
722 Ga0105247_10082583
723 Ga0114129_10000896
724 Ga0114129_10264516
725 Ga0114129_10308802
726 Ga0114129_10782912
727 Ga0105243_10005819
728 Ga0105243_10085191
729 Ga0105243_10376383
730 Ga0105243_10401176
731 Ga0105243_11105716
732 Ga0105241_10609008
733 Ga0105242_10497072
734 Ga0105242_10779990
735 Ga0105248_10047063
736 Ga0105248_10870232
737 Ga0105238_10760419
738 Ga0105239_10055203
739 Ga0105239_10076072
740 Ga0105239_10094248
741 Ga0105239_10099717
742 Ga0105239_10414742
743 Ga0105246_10014408
744 Ga0105246_10153666
745 Ga0105246_10640646
746 Ga0157371_10019286
747 Ga0157371_10207766
748 Ga0157371_10249976
749 Ga0157369_10164613
750 Ga0157374_10217353
751 Ga0157372_10030676
752 Ga0157372_10111039
753 Ga0157372_10299089
754 Ga0157372_11329542
755 Ga0157375_10007151
756 Ga0157375_10019741
757 Ga0157375_10109347
758 Ga0157375_10228940
759 Ga0157375_10603306
760 Ga0157375_11190028
761 Ga0163163_10079025
762 Ga0163163_10316533
763 Ga0163163_10620660
764 Ga0163163_10884157
765 Ga0163163_11304388
766 Ga0157380_10021199
767 Ga0157380_10045011
768 Ga0157380_10233767
769 Ga0157380_10907141
770 Ga0157377_10045075
771 Ga0157377_10319366
772 Ga0157379_10052435
773 Ga0157376_10045855
774 Ga0157376_10593051
775 Ga0157376_10779659
776 Ga0163161_10203629
777 Ga0206353_10732547
778 Ga0207656_10039165
779 Ga0207682_10064919
780 Ga0207642_10030560
781 Ga0207642_10167572
782 Ga0207642_10312865
783 Ga0207710_10170137
784 Ga0207688_10016867
785 Ga0207688_10021450
786 Ga0207688_10029847
787 Ga0207688_10139322
788 Ga0207647_10113299
789 Ga0207645_10074078
790 Ga0207645_10087642
791 Ga0207643_10002884
792 Ga0207654_10223275
793 Ga0207707_10051974
794 Ga0207707_10416033
795 Ga0207660_10056205
796 Ga0207657_10037484
797 Ga0207649_10151537
798 Ga0207652_10151152
799 Ga0207652_10593962
800 Ga0207681_10220506
801 Ga0207694_10011601
802 Ga0207694_10526744
803 Ga0207650_10021355
804 Ga0207650_10244895
805 Ga0207650_10365563
806 Ga0207659_10240488
807 Ga0207659_10852439
808 Ga0207687_10043656
809 Ga0207687_10171712
810 Ga0207644_10067161
811 Ga0207690_10120856
812 Ga0207690_10292400
813 Ga0207706_10026936
814 Ga0207706_10121734
815 Ga0207706_10151195
816 Ga0207686_10399499
817 Ga0207709_10146052
818 Ga0207709_10148362
819 Ga0207709_10167660
820 Ga0207709_10358050
821 Ga0207709_10389975
822 Ga0207709_10651929
823 Ga0207670_10217634
824 Ga0207669_10007615
825 Ga0207669_10038577
826 Ga0207669_10094433
827 Ga0207669_10156922
828 Ga0207704_10003930
829 Ga0207704_10052330
830 Ga0207704_10148331
831 Ga0207691_10007729
832 Ga0207691_10052788
833 Ga0207691_10056024
834 Ga0207691_10091388
835 Ga0207691_10145302
836 Ga0207691_10266761
837 Ga0207691_10638702
838 Ga0207711_10045526
839 Ga0207689_10089417
840 Ga0207661_10000652
841 Ga0207661_10232766
842 Ga0207661_10410535
843 Ga0207679_10075292
844 Ga0207679_10105999
845 Ga0207679_10157412
846 Ga0207679_10568565
847 Ga0207667_10099418
848 Ga0207651_10378279
849 Ga0207712_10153884
850 Ga0207712_11051848
851 Ga0207640_10039128
852 Ga0207640_10869121
853 Ga0207677_10020450
854 Ga0207677_10915268
855 Ga0207639_10052515
856 Ga0207639_10309253
857 Ga0207678_10057504
858 Ga0207678_10091070
859 Ga0207708_10051023
860 Ga0207708_10066351
861 Ga0207708_10096029
862 Ga0207708_10125882
863 Ga0207702_10270083
864 Ga0207641_10061648
865 Ga0207641_10137105
866 Ga0207648_10048840
867 Ga0207648_10108635
868 Ga0207648_10200484
869 Ga0207648_10610769
870 Ga0207676_10140900
871 Ga0207676_10380394
872 Ga0207674_10013487
873 Ga0207674_10141696
874 Ga0207675_100068551
875 Ga0207675_100283749
876 Ga0207683_10059867
877 Ga0207683_10069795
878 Ga0207683_10222869
879 Ga0207428_10000798
880 Ga0207428_10051517
881 Ga0207428_10090728
882 Ga0268266_10226708
883 Ga0268265_10385485
884 Ga0268265_10401671
885 Ga0268264_10071682
886 Ga0307408_100429496
887 Ga0307406_10440181
888 Ga0307409_100379867
889 Ga0307416_100479725
890 Ga0307416_100490239
891 Ga0307416_100545304
892 Ga0307411_10687067
893 Ga0373948_0049666
894 Ga0373958_0003444
895 Ga0373932_0020208
896 Ga0373941_0105672
897 Ga0373960_0126052
898 Ga0373961_0037957
899 Ga0373961_0038656
900 Ga0373931_0183503
901 Ga0395900_0060379
902 Ga0395905_0337386
903 Ga0395901_0009274
904 Ga0395901_0039151
905 Ga0439461_0001610
906 Ga0439461_0009146
907 Ga0451845_0927633
908 Ga0451849_1333593
909 Ga0451853_2633744
910 Ga0439431_0001868
911 Ga0439433_0001650
912 Ga0439442_006220
913 Ga0439448_0034253
914 Ga0439432_087241
915 Ga0439449_0068787
916 Ga0450923_008677
917 Ga0450902_007255
918 Ga0450906_026840
919 Ga0439446_0003129
920 Ga0439434_0030590
921 Ga0439460_0203166
922 Ga0450918_006750
923 Ga0451576_0757872
924 Ga0495651_0071443
925 Ga0495605_0191403
926 Ga0495596_0149914
927 Ga0495596_0193271
928 Ga0495620_0108833
929 Ga0495631_0197752
930 Ga0495637_0089343
931 Ga0495644_0091273
932 Ga0495609_0112774
933 Ga0495656_0027753
934 Ga0495656_0092678
935 Ga0495656_0166571
936 Ga0495657_0213669
937 Ga0495589_0271428
938 Ga0495660_0063041
939 Ga0495674_0067767
940 Ga0496100_0059106
941 Ga0496100_0307903
942 Ga0496101_0550124
943 Ga0496102_0191421
944 Ga0496102_0518995
945 Ga0496102_0639412
946 Ga0496103_0124721
947 Ga0496104_0070206
948 Ga0496104_0114579
949 Ga0496104_0125288
950 Ga0496104_0770458
951 Ga0496105_0080571
952 Ga0496105_0220839
953 Ga0496108_0029280
954 Ga0496108_0052619
955 Ga0496108_0078296
956 Ga0496108_0576898
957 Ga0496108_0672681
958 Ga0496109_0010431
959 Ga0496109_0012606
960 Ga0496109_0142367
961 Ga0496109_0361728
962 Ga0496109_0479850
963 Ga0496109_1215605
964 Ga0496110_0029418
965 Ga0496110_0046343
966 Ga0496110_0201499
967 Ga0496110_0235146
968 Ga0496110_0664469
969 Ga0496111_0259657
970 Ga0496111_0554516
971 Ga0496112_0019038
972 Ga0496114_0015274
973 Ga0496114_0131105
974 Ga0496114_0766203
975 Ga0496115_0520680
976 Ga0501031_0039438
977 Ga0501031_0080099
978 Ga0501031_0156207
979 Ga0501031_0157686
980 Ga0501031_0313158
981 Ga0501032_0010237
982 Ga0501032_0028760
983 Ga0501033_0003943
984 Ga0501033_0261820
985 Ga0501034_0027555
986 Ga0501034_0192494
987 Ga0501034_0620848
988 Ga0501036_0001948
989 Ga0501036_0014830
990 Ga0501036_0051449
991 Ga0501036_0479585
992 Ga0501037_0009974
993 Ga0501037_0289276
994 Ga0501037_0436683
995 Ga0501037_0571164
996 Ga0501038_0012350
997 Ga0501038_0027791
998 Ga0501038_0063121
999 Ga0501038_0160044
1000 Ga0501038_0191874
1001 Ga0501039_0005106
1002 Ga0501039_0007758
1003 Ga0501039_0012123
1004 Ga0501039_0034642
1005 Ga0501039_0078630
1006 Ga0501039_0203071
1007 Ga0501040_0001259
1008 Ga0501040_0004669
1009 Ga0501040_0012536
1010 Ga0501040_0015119
1011 Ga0501040_0060193
1012 Ga0501040_0073366
1013 Ga0501040_0099238
1014 Ga0501040_0502988
1015 Ga0501041_0002939
1016 Ga0501041_0006592
1017 Ga0501041_0030754
1018 Ga0501041_0307945
1019 Ga0501042_0005882
1020 Ga0501042_0015410
1021 Ga0501042_0022681
1022 Ga0501042_0025310
1023 Ga0501042_0031167
1024 Ga0501042_0039334
1025 Ga0501042_0063258
1026 Ga0501042_0476496
1027 Ga0501043_0003946
1028 Ga0501043_0161439
1029 Ga0501046_0005562
1030 Ga0501046_0015123
1031 Ga0501046_0041321
1032 Ga0501046_0051453
1033 Ga0501046_0085302
1034 Ga0501047_0200780
1035 Ga0501048_0006715
1036 Ga0501048_0007997
1037 Ga0501048_0014173
1038 Ga0501048_0030889
1039 Ga0501048_0051311
1040 Ga0501048_0052924
1041 Ga0501048_0065745
1042 Ga0501048_0238617
1043 Ga0501048_0405970
1044 Ga0501067_0006263
1045 Ga0501067_0038418
1046 Ga0501067_0100930
1047 Ga0501067_0180610
1048 Ga0501068_0004980
1049 Ga0501068_0014535
1050 Ga0501068_0021087
1051 Ga0501068_0023196
1052 Ga0501068_0065860
1053 Ga0501068_0103844
1054 Ga0501068_0117265
1055 Ga0501069_0004260
1056 Ga0501069_0051388
1057 Ga0501069_0061874
1058 Ga0501069_0116914
1059 Ga0501070_0006624
1060 Ga0501070_0023384
1061 Ga0501070_0045442
1062 Ga0501070_0261586
1063 Ga0501071_0089781
1064 Ga0501071_0178115
1065 Ga0501071_0228492
1066 Ga0501071_0397725
1067 Ga0501072_0009351
1068 Ga0501072_0024754
1069 Ga0501072_0033906
1070 Ga0501072_0045914
1071 Ga0501072_0056481
1072 Ga0501072_0063015
1073 Ga0501072_0097696
1074 Ga0501072_0165100
1075 Ga0501072_0219394
1076 Ga0501072_0326434
1077 Ga0501073_0027379
1078 Ga0501073_0129361
1079 Ga0501073_0173894
1080 Ga0501073_0261225
1081 Ga0501073_0295251
1082 Ga0501074_0009811
1083 Ga0501074_0022777
1084 Ga0501074_0034249
1085 Ga0501074_0049940
1086 Ga0501074_0053390
1087 Ga0501074_0294384
1088 Ga0501075_0002896
1089 Ga0501075_0005578
1090 Ga0501075_0031634
1091 Ga0501075_0038594
1092 Ga0501075_0045046
1093 Ga0501075_0075741
1094 Ga0501075_0078054
1095 Ga0501075_0141630
1096 Ga0501075_0503054
1097 Ga0501075_0589601
1098 Ga0501076_0003393
1099 Ga0501076_0010215
1100 Ga0501076_0146246
1101 Ga0501076_0233159
1102 Ga0501076_0303275
1103 Ga0501076_0426352
1104 Ga0501076_0784018
1105 Ga0501077_0003236
1106 Ga0501077_0006256
1107 Ga0501077_0009288
1108 Ga0501077_0013415
1109 Ga0501077_0055861
1110 Ga0501077_0063722
1111 Ga0501077_0075883
1112 Ga0501077_0096869
1113 Ga0501077_0176154
1114 Ga0501077_0310180
1115 Ga0501079_0003089
1116 Ga0501079_0036001
1117 Ga0501079_0043947
1118 Ga0501079_0057238
1119 Ga0501079_0057788
1120 Ga0501079_0103901
1121 Ga0501079_0172696
1122 Ga0501079_0293099
1123 Ga0501079_0615411
1124 Ga0501079_0959010
1125 Ga0501080_0055581
1126 Ga0501080_0065434
1127 Ga0501080_0069290
1128 Ga0501080_0107086
1129 Ga0501080_0128260
1130 Ga0501080_0443656
1131 Ga0501080_0483717
1132 Ga0501081_0000659
1133 Ga0501081_0020891
1134 Ga0501081_0022847
1135 Ga0501081_0025107
1136 Ga0501081_0029560
1137 Ga0501081_0039365
1138 Ga0501081_0162307
1139 Ga0501083_0062578
1140 Ga0501083_0075363
1141 Ga0501083_0075497
1142 Ga0501083_0133295
1143 Ga0501035_0037180
1144 Ga0501035_0053900
1145 Ga0501035_0100839
1146 Ga0501035_0155019
1147 Ga0501035_0279137
1148 Ga0501044_0025012
1149 Ga0501044_0136032
1150 Ga0501044_0199145
1151 Ga0501045_0001032
1152 Ga0501045_0026827
1153 Ga0501045_0032274
1154 Ga0501045_0041645
1155 Ga0501045_0050059
1156 Ga0501045_0055659
1157 Ga0501045_0070820
1158 Ga0501045_0085886
1159 Ga0501045_0468387
1160 Ga0501045_0615799
1161 nmdc:mga00v17_6407_c1
1162 nmdc:mga07m45_60679_c1
1163 nmdc:mga05p37_135578_c1
1164 nmdc:mga05p37_152400_c1
1165 nmdc:mga05p37_20385_c1
1166 nmdc:mga05p37_464267_c1
1167 nmdc:mga09592_55073_c1
1168 nmdc:mga08y16_1032489_c1
1169 nmdc:mga08y16_12365_c1
1170 nmdc:mga08y16_18447_c1
1171 nmdc:mga08x19_339220_c1
1172 nmdc:mga0a205_237416_c1
1173 nmdc:mga0a205_246108_c1
1174 nmdc:mga0a205_7972_c1
1175 Ga0495619_0134260
1176 Ga0501084_0038348
1177 Ga0501084_0161318
1178 Ga0501084_0244887
1179 Ga0501084_0508918
1180 Ga0501082_0057564
1181 Ga0501082_0083637
1182 Ga0501082_0154985
1183 Ga0501082_0260023
1184 Ga0501082_0351263
1185 Ga0530510_0009774
1186 Ga0530510_0021196
1187 Ga0530510_0025725
1188 Ga0530510_0087356
1189 Ga0530510_0093670
1190 Ga0530510_0135890
1191 Ga0530510_0183481
1192 Ga0530510_0827199

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

47

124

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pd7-assembly1.cif.gz_A crocagin methyl transferase cgnl 0.7744 17 145
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.7565 15 148
5bsz-assembly1.cif.gz_A x-ray structure of the sugar n-methyltransferase keds8 from streptoalloteichus sp atcc 53650 0.741 19 135
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.7289 15 140
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.7206 13 195
ID Description Score Start End Superfamily
af_Q5A386_35_265_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.806 18 141 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7998 18 129 3.40.50.150
af_Q18489_32_205_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7888 15 129 3.40.50.150
af_Q8IJC4_363_592_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7801 14 145 3.40.50.150
af_Q54HP2_594_839_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7665 83 129 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W0QM31-F1-model_v4 Class I SAM-dependent methyltransferase 0.9698 50 205 GO:0008757
GO:0032259
AF-A0A7V8XFN7-F1-model_v4 Methyltransferase domain-containing protein 0.9654 1 205 GO:0008757
GO:0032259
AF-A0A538IAH6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9606 1 205 GO:0008757
GO:0032259
AF-A0A7W0QM31-F1-model_v4 Class I SAM-dependent methyltransferase 0.9578 50 205 GO:0008757
GO:0032259
AF-A0A538HU48-F1-model_v4 Methyltransferase domain-containing protein 0.949 1 205 GO:0008757
GO:0032259

Map