F467600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 596 | 247 | 1192 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0477752|Ga0501040_0477752_276_869 |
| Length | 197 |
| Sequence | MRLVDAVSLRSRKRKLRLFLEELEPSAQTTVLDVGVDEVGFGGSGGQAGCGTHNFFEELYPWPERITALGLHTGEGFARAYPHIPYVQADGAFDVVFSNAVVEHVGGEERQRAFVAEALRVGRRVFLTTPNRWFPVEVHTRLPLVHWLPDPLAHRAYDLARRPWAKDNRLLGPGDLRALFPGPVRVVNLGLTLVAIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 152 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 162 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 163 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 164 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 165 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 166 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 167 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 170 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 171 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 172 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 173 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 174 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 177 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.67 |
| Nodule | 0 |
| Rhizoplane | 6.04 |
| Rhizosphere | 92.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501040_0477752 | 3300049576 | Bacteria | 898 |
| 2 | JGI24739J22299_10097847 | 3300001989 | Bacteria | 888 |
| 3 | JGI24743J22301_10019892 | 3300001991 | Unclassified | 1276 |
| 4 | JGI24738J21930_10027217 | 3300002075 | Unclassified | 1171 |
| 5 | JGI25406J46586_10027498 | 3300003203 | Bacteria | 2180 |
| 6 | Ga0070658_10025356 | 3300005327 | Bacteria | 4754 |
| 7 | Ga0070676_10050882 | 3300005328 | Bacteria | 2430 |
| 8 | Ga0070683_100059088 | 3300005329 | Bacteria | 3562 |
| 9 | Ga0070683_100079754 | 3300005329 | Bacteria | 3063 |
| 10 | Ga0070683_100099763 | 3300005329 | Bacteria | 2733 |
| 11 | Ga0070690_100534651 | 3300005330 | Bacteria | 882 |
| 12 | Ga0070677_10072456 | 3300005333 | Unclassified | 1453 |
| 13 | Ga0070680_100088204 | 3300005336 | Bacteria | 2566 |
| 14 | Ga0070682_100013019 | 3300005337 | Bacteria | 4775 |
| 15 | Ga0070682_100163064 | 3300005337 | Bacteria | 1541 |
| 16 | Ga0068868_100006825 | 3300005338 | Bacteria | 8103 |
| 17 | Ga0068868_100020164 | 3300005338 | Bacteria | 5004 |
| 18 | Ga0070660_100030602 | 3300005339 | Bacteria | 4038 |
| 19 | Ga0070689_100497322 | 3300005340 | Bacteria | 1044 |
| 20 | Ga0070691_10001275 | 3300005341 | Bacteria | 10641 |
| 21 | Ga0070661_100035571 | 3300005344 | Bacteria | 3617 |
| 22 | Ga0070661_100336510 | 3300005344 | Bacteria | 1182 |
| 23 | Ga0070692_10017112 | 3300005345 | Bacteria | 3460 |
| 24 | Ga0070692_10019261 | 3300005345 | Bacteria | 3291 |
| 25 | Ga0070692_10086833 | 3300005345 | Bacteria | 1694 |
| 26 | Ga0070668_100054175 | 3300005347 | Bacteria | 3093 |
| 27 | Ga0070669_100357430 | 3300005353 | Bacteria | 1187 |
| 28 | Ga0070675_100044845 | 3300005354 | Bacteria | 3616 |
| 29 | Ga0070671_100206446 | 3300005355 | Bacteria | 1666 |
| 30 | Ga0070674_100019458 | 3300005356 | Bacteria | 4313 |
| 31 | Ga0070674_100064178 | 3300005356 | Unclassified | 2572 |
| 32 | Ga0070688_100047743 | 3300005365 | Bacteria | 2657 |
| 33 | Ga0070659_100051234 | 3300005366 | Bacteria | 3245 |
| 34 | Ga0070659_100175628 | 3300005366 | Bacteria | 1756 |
| 35 | Ga0070659_100481963 | 3300005366 | Bacteria | 1055 |
| 36 | Ga0070667_100838141 | 3300005367 | Bacteria | 855 |
| 37 | Ga0070701_10036655 | 3300005438 | Bacteria | 2471 |
| 38 | Ga0070705_100019517 | 3300005440 | Bacteria | 3568 |
| 39 | Ga0070700_100008297 | 3300005441 | Bacteria | 5653 |
| 40 | Ga0070700_100026169 | 3300005441 | Bacteria | 3443 |
| 41 | Ga0070700_100104637 | 3300005441 | Bacteria | 1870 |
| 42 | Ga0070694_100194781 | 3300005444 | Bacteria | 1507 |
| 43 | Ga0070694_100216839 | 3300005444 | Bacteria | 1434 |
| 44 | Ga0070663_100100015 | 3300005455 | Bacteria | 2163 |
| 45 | Ga0070678_100023241 | 3300005456 | Bacteria | 4127 |
| 46 | Ga0070662_100092623 | 3300005457 | Bacteria | 2272 |
| 47 | Ga0070662_100125182 | 3300005457 | Bacteria | 1975 |
| 48 | Ga0070681_10012454 | 3300005458 | Bacteria | 8438 |
| 49 | Ga0068867_100050741 | 3300005459 | Bacteria | 3059 |
| 50 | Ga0068867_100068937 | 3300005459 | Bacteria | 2640 |
| 51 | Ga0068867_100550241 | 3300005459 | Bacteria | 999 |
| 52 | Ga0070685_10005508 | 3300005466 | Bacteria | 6417 |
| 53 | Ga0070698_100051788 | 3300005471 | Bacteria | 4180 |
| 54 | Ga0070699_100155688 | 3300005518 | Bacteria | 2022 |
| 55 | Ga0070679_100065439 | 3300005530 | Bacteria | 3624 |
| 56 | Ga0070679_100134554 | 3300005530 | Bacteria | 2453 |
| 57 | Ga0070684_100019412 | 3300005535 | Bacteria | 5623 |
| 58 | Ga0070684_100067185 | 3300005535 | Bacteria | 3148 |
| 59 | Ga0070684_100135317 | 3300005535 | Unclassified | 2225 |
| 60 | Ga0070684_100282937 | 3300005535 | Unclassified | 1519 |
| 61 | Ga0070684_100351687 | 3300005535 | Bacteria | 1355 |
| 62 | Ga0068853_100066724 | 3300005539 | Bacteria | 3125 |
| 63 | Ga0070672_100031701 | 3300005543 | Bacteria | 3982 |
| 64 | Ga0070672_100055546 | 3300005543 | Bacteria | 3102 |
| 65 | Ga0070672_100189113 | 3300005543 | Bacteria | 1718 |
| 66 | Ga0070672_100284093 | 3300005543 | Unclassified | 1400 |
| 67 | Ga0070672_100388465 | 3300005543 | Bacteria | 1195 |
| 68 | Ga0070686_100069060 | 3300005544 | Unclassified | 2306 |
| 69 | Ga0070686_100077645 | 3300005544 | Bacteria | 2190 |
| 70 | Ga0070695_100074656 | 3300005545 | Bacteria | 2228 |
| 71 | Ga0070695_100090592 | 3300005545 | Bacteria | 2041 |
| 72 | Ga0070696_100054400 | 3300005546 | Bacteria | 2789 |
| 73 | Ga0070693_100147551 | 3300005547 | Bacteria | 1487 |
| 74 | Ga0070693_100324436 | 3300005547 | Bacteria | 1046 |
| 75 | Ga0070693_100521399 | 3300005547 | Unclassified | 846 |
| 76 | Ga0070665_100105033 | 3300005548 | Bacteria | 2827 |
| 77 | Ga0070665_100178094 | 3300005548 | Bacteria | 2127 |
| 78 | Ga0070665_101135711 | 3300005548 | Unclassified | 793 |
| 79 | Ga0070704_100017098 | 3300005549 | Bacteria | 4603 |
| 80 | Ga0070704_100522966 | 3300005549 | Bacteria | 1033 |
| 81 | Ga0070664_100068124 | 3300005564 | Bacteria | 3042 |
| 82 | Ga0070664_100096145 | 3300005564 | Bacteria | 2570 |
| 83 | Ga0070664_100113679 | 3300005564 | Bacteria | 2365 |
| 84 | Ga0068857_100899052 | 3300005577 | Bacteria | 849 |
| 85 | Ga0068854_100003129 | 3300005578 | Bacteria | 10302 |
| 86 | Ga0068854_100108467 | 3300005578 | Bacteria | 2091 |
| 87 | Ga0068854_100748408 | 3300005578 | Bacteria | 848 |
| 88 | Ga0068852_100032692 | 3300005616 | Bacteria | 4310 |
| 89 | Ga0068852_100457777 | 3300005616 | Unclassified | 1264 |
| 90 | Ga0068864_100019665 | 3300005618 | Bacteria | 5647 |
| 91 | Ga0068866_10046310 | 3300005718 | Bacteria | 2187 |
| 92 | Ga0068866_10073481 | 3300005718 | Bacteria | 1814 |
| 93 | Ga0068861_100044996 | 3300005719 | Bacteria | 3321 |
| 94 | Ga0068861_101067149 | 3300005719 | Bacteria | 775 |
| 95 | Ga0068851_10058524 | 3300005834 | Bacteria | 1970 |
| 96 | Ga0068870_10023857 | 3300005840 | Unclassified | 3022 |
| 97 | Ga0068870_10195621 | 3300005840 | Archaea | 1223 |
| 98 | Ga0068858_100070859 | 3300005842 | Bacteria | 3232 |
| 99 | Ga0068858_100078073 | 3300005842 | Bacteria | 3076 |
| 100 | Ga0081455_10075691 | 3300005937 | Bacteria | 2776 |
| 101 | Ga0081455_10094885 | 3300005937 | Bacteria | 2409 |
| 102 | Ga0081455_10239767 | 3300005937 | Bacteria | 1333 |
| 103 | Ga0081539_10002688 | 3300005985 | Bacteria | 24146 |
| 104 | Ga0075432_10001384 | 3300006058 | Bacteria | 7882 |
| 105 | Ga0075367_10148750 | 3300006178 | Bacteria | 1453 |
| 106 | Ga0097621_100196392 | 3300006237 | Bacteria | 1750 |
| 107 | Ga0097621_100359516 | 3300006237 | Unclassified | 1297 |
| 108 | Ga0075370_10162755 | 3300006353 | Bacteria | 1310 |
| 109 | Ga0068871_100148941 | 3300006358 | Bacteria | 1995 |
| 110 | Ga0068871_100508424 | 3300006358 | Bacteria | 1087 |
| 111 | Ga0075428_100006418 | 3300006844 | Bacteria | 13086 |
| 112 | Ga0075428_100578884 | 3300006844 | Bacteria | 1200 |
| 113 | Ga0075430_100617662 | 3300006846 | Bacteria | 894 |
| 114 | Ga0075433_10034018 | 3300006852 | Bacteria | 4374 |
| 115 | Ga0075433_10508727 | 3300006852 | Bacteria | 1060 |
| 116 | Ga0075429_100042289 | 3300006880 | Bacteria | 3966 |
| 117 | Ga0075429_100726403 | 3300006880 | Bacteria | 870 |
| 118 | Ga0068865_100006497 | 3300006881 | Bacteria | 7138 |
| 119 | Ga0068865_100214274 | 3300006881 | Bacteria | 1502 |
| 120 | Ga0075436_100399386 | 3300006914 | Bacteria | 996 |
| 121 | Ga0111539_10037117 | 3300009094 | Bacteria | 5887 |
| 122 | Ga0105245_10009339 | 3300009098 | Bacteria | 8553 |
| 123 | Ga0105245_10199867 | 3300009098 | Bacteria | 1919 |
| 124 | Ga0105245_10425178 | 3300009098 | Bacteria | 1332 |
| 125 | Ga0105245_11279366 | 3300009098 | Unclassified | 782 |
| 126 | Ga0105247_10082583 | 3300009101 | Bacteria | 2028 |
| 127 | Ga0114129_10000896 | 3300009147 | Bacteria | 38764 |
| 128 | Ga0114129_10264516 | 3300009147 | Bacteria | 2303 |
| 129 | Ga0114129_10308802 | 3300009147 | Unclassified | 2106 |
| 130 | Ga0114129_10782912 | 3300009147 | Bacteria | 1218 |
| 131 | Ga0105243_10005819 | 3300009148 | Bacteria | 9564 |
| 132 | Ga0105243_10085191 | 3300009148 | Bacteria | 2590 |
| 133 | Ga0105243_10376383 | 3300009148 | Bacteria | 1312 |
| 134 | Ga0105243_10401176 | 3300009148 | Bacteria | 1274 |
| 135 | Ga0105243_11105716 | 3300009148 | Bacteria | 801 |
| 136 | Ga0105241_10609008 | 3300009174 | Bacteria | 988 |
| 137 | Ga0105242_10497072 | 3300009176 | Unclassified | 1159 |
| 138 | Ga0105242_10779990 | 3300009176 | Bacteria | 944 |
| 139 | Ga0105248_10047063 | 3300009177 | Bacteria | 4836 |
| 140 | Ga0105248_10870232 | 3300009177 | Unclassified | 1017 |
| 141 | Ga0105238_10760419 | 3300009551 | Unclassified | 983 |
| 142 | Ga0105239_10055203 | 3300010375 | Bacteria | 4357 |
| 143 | Ga0105239_10076072 | 3300010375 | Bacteria | 3692 |
| 144 | Ga0105239_10094248 | 3300010375 | Bacteria | 3306 |
| 145 | Ga0105239_10099717 | 3300010375 | Bacteria | 3212 |
| 146 | Ga0105239_10414742 | 3300010375 | Bacteria | 1525 |
| 147 | Ga0105246_10014408 | 3300011119 | Bacteria | 4973 |
| 148 | Ga0105246_10153666 | 3300011119 | Bacteria | 1745 |
| 149 | Ga0105246_10640646 | 3300011119 | Bacteria | 924 |
| 150 | Ga0157371_10019286 | 3300013102 | Bacteria | 5031 |
| 151 | Ga0157371_10207766 | 3300013102 | Bacteria | 1404 |
| 152 | Ga0157371_10249976 | 3300013102 | Bacteria | 1276 |
| 153 | Ga0157369_10164613 | 3300013105 | Bacteria | 2340 |
| 154 | Ga0157374_10217353 | 3300013296 | Bacteria | 1875 |
| 155 | Ga0157372_10030676 | 3300013307 | Bacteria | 5882 |
| 156 | Ga0157372_10111039 | 3300013307 | Bacteria | 3140 |
| 157 | Ga0157372_10299089 | 3300013307 | Bacteria | 1872 |
| 158 | Ga0157372_11329542 | 3300013307 | Bacteria | 829 |
| 159 | Ga0157375_10007151 | 3300013308 | Bacteria | 9758 |
| 160 | Ga0157375_10019741 | 3300013308 | Bacteria | 6138 |
| 161 | Ga0157375_10109347 | 3300013308 | Bacteria | 2860 |
| 162 | Ga0157375_10228940 | 3300013308 | Bacteria | 2018 |
| 163 | Ga0157375_10603306 | 3300013308 | Unclassified | 1257 |
| 164 | Ga0157375_11190028 | 3300013308 | Bacteria | 894 |
| 165 | Ga0163163_10079025 | 3300014325 | Bacteria | 3287 |
| 166 | Ga0163163_10316533 | 3300014325 | Bacteria | 1614 |
| 167 | Ga0163163_10620660 | 3300014325 | Bacteria | 1144 |
| 168 | Ga0163163_10884157 | 3300014325 | Bacteria | 957 |
| 169 | Ga0163163_11304388 | 3300014325 | Unclassified | 788 |
| 170 | Ga0157380_10021199 | 3300014326 | Bacteria | 4871 |
| 171 | Ga0157380_10045011 | 3300014326 | Bacteria | 3461 |
| 172 | Ga0157380_10233767 | 3300014326 | Bacteria | 1653 |
| 173 | Ga0157380_10907141 | 3300014326 | Bacteria | 908 |
| 174 | Ga0157377_10045075 | 3300014745 | Bacteria | 2462 |
| 175 | Ga0157377_10319366 | 3300014745 | Unclassified | 1031 |
| 176 | Ga0157379_10052435 | 3300014968 | Bacteria | 3644 |
| 177 | Ga0157376_10045855 | 3300014969 | Bacteria | 3601 |
| 178 | Ga0157376_10593051 | 3300014969 | Unclassified | 1102 |
| 179 | Ga0157376_10779659 | 3300014969 | Bacteria | 967 |
| 180 | Ga0163161_10203629 | 3300017792 | Bacteria | 1526 |
| 181 | Ga0206353_10732547 | 3300020082 | Bacteria | 1982 |
| 182 | Ga0207656_10039165 | 3300025321 | Bacteria | 2003 |
| 183 | Ga0207682_10064919 | 3300025893 | Bacteria | 1535 |
| 184 | Ga0207642_10030560 | 3300025899 | Bacteria | 2245 |
| 185 | Ga0207642_10167572 | 3300025899 | Bacteria | 1185 |
| 186 | Ga0207642_10312865 | 3300025899 | Bacteria | 914 |
| 187 | Ga0207710_10170137 | 3300025900 | Bacteria | 1065 |
| 188 | Ga0207688_10016867 | 3300025901 | Bacteria | 3966 |
| 189 | Ga0207688_10021450 | 3300025901 | Bacteria | 3529 |
| 190 | Ga0207688_10029847 | 3300025901 | Bacteria | 3005 |
| 191 | Ga0207688_10139322 | 3300025901 | Bacteria | 1427 |
| 192 | Ga0207647_10113299 | 3300025904 | Bacteria | 1603 |
| 193 | Ga0207645_10074078 | 3300025907 | Bacteria | 2180 |
| 194 | Ga0207645_10087642 | 3300025907 | Bacteria | 2000 |
| 195 | Ga0207643_10002884 | 3300025908 | Bacteria | 9279 |
| 196 | Ga0207654_10223275 | 3300025911 | Bacteria | 1251 |
| 197 | Ga0207707_10051974 | 3300025912 | Bacteria | 3568 |
| 198 | Ga0207707_10416033 | 3300025912 | Unclassified | 1153 |
| 199 | Ga0207660_10056205 | 3300025917 | Bacteria | 2815 |
| 200 | Ga0207657_10037484 | 3300025919 | Bacteria | 4328 |
| 201 | Ga0207649_10151537 | 3300025920 | Bacteria | 1597 |
| 202 | Ga0207652_10151152 | 3300025921 | Bacteria | 2079 |
| 203 | Ga0207652_10593962 | 3300025921 | Unclassified | 993 |
| 204 | Ga0207681_10220506 | 3300025923 | Bacteria | 1467 |
| 205 | Ga0207694_10011601 | 3300025924 | Bacteria | 6650 |
| 206 | Ga0207694_10526744 | 3300025924 | Bacteria | 991 |
| 207 | Ga0207650_10021355 | 3300025925 | Bacteria | 4575 |
| 208 | Ga0207650_10244895 | 3300025925 | Bacteria | 1450 |
| 209 | Ga0207650_10365563 | 3300025925 | Bacteria | 1189 |
| 210 | Ga0207659_10240488 | 3300025926 | Bacteria | 1464 |
| 211 | Ga0207659_10852439 | 3300025926 | Bacteria | 783 |
| 212 | Ga0207687_10043656 | 3300025927 | Bacteria | 3090 |
| 213 | Ga0207687_10171712 | 3300025927 | Bacteria | 1673 |
| 214 | Ga0207644_10067161 | 3300025931 | Bacteria | 2613 |
| 215 | Ga0207690_10120856 | 3300025932 | Bacteria | 1902 |
| 216 | Ga0207690_10292400 | 3300025932 | Unclassified | 1272 |
| 217 | Ga0207706_10026936 | 3300025933 | Bacteria | 5144 |
| 218 | Ga0207706_10121734 | 3300025933 | Bacteria | 2294 |
| 219 | Ga0207706_10151195 | 3300025933 | Bacteria | 2042 |
| 220 | Ga0207686_10399499 | 3300025934 | Unclassified | 1046 |
| 221 | Ga0207709_10146052 | 3300025935 | Bacteria | 1632 |
| 222 | Ga0207709_10148362 | 3300025935 | Unclassified | 1621 |
| 223 | Ga0207709_10167660 | 3300025935 | Bacteria | 1538 |
| 224 | Ga0207709_10358050 | 3300025935 | Bacteria | 1104 |
| 225 | Ga0207709_10389975 | 3300025935 | Bacteria | 1062 |
| 226 | Ga0207709_10651929 | 3300025935 | Bacteria | 838 |
| 227 | Ga0207670_10217634 | 3300025936 | Bacteria | 1460 |
| 228 | Ga0207669_10007615 | 3300025937 | Bacteria | 5026 |
| 229 | Ga0207669_10038577 | 3300025937 | Bacteria | 2752 |
| 230 | Ga0207669_10094433 | 3300025937 | Bacteria | 1957 |
| 231 | Ga0207669_10156922 | 3300025937 | Bacteria | 1602 |
| 232 | Ga0207704_10003930 | 3300025938 | Bacteria | 6755 |
| 233 | Ga0207704_10052330 | 3300025938 | Bacteria | 2475 |
| 234 | Ga0207704_10148331 | 3300025938 | Unclassified | 1651 |
| 235 | Ga0207691_10007729 | 3300025940 | Bacteria | 10349 |
| 236 | Ga0207691_10052788 | 3300025940 | Bacteria | 3712 |
| 237 | Ga0207691_10056024 | 3300025940 | Bacteria | 3592 |
| 238 | Ga0207691_10091388 | 3300025940 | Bacteria | 2727 |
| 239 | Ga0207691_10145302 | 3300025940 | Bacteria | 2088 |
| 240 | Ga0207691_10266761 | 3300025940 | Bacteria | 1475 |
| 241 | Ga0207691_10638702 | 3300025940 | Bacteria | 900 |
| 242 | Ga0207711_10045526 | 3300025941 | Bacteria | 3749 |
| 243 | Ga0207689_10089417 | 3300025942 | Bacteria | 2530 |
| 244 | Ga0207661_10000652 | 3300025944 | Bacteria | 22376 |
| 245 | Ga0207661_10232766 | 3300025944 | Bacteria | 1632 |
| 246 | Ga0207661_10410535 | 3300025944 | Bacteria | 1229 |
| 247 | Ga0207679_10075292 | 3300025945 | Bacteria | 2561 |
| 248 | Ga0207679_10105999 | 3300025945 | Bacteria | 2208 |
| 249 | Ga0207679_10157412 | 3300025945 | Bacteria | 1856 |
| 250 | Ga0207679_10568565 | 3300025945 | Unclassified | 1019 |
| 251 | Ga0207667_10099418 | 3300025949 | Bacteria | 3001 |
| 252 | Ga0207651_10378279 | 3300025960 | Unclassified | 1199 |
| 253 | Ga0207712_10153884 | 3300025961 | Bacteria | 1779 |
| 254 | Ga0207712_11051848 | 3300025961 | Bacteria | 723 |
| 255 | Ga0207640_10039128 | 3300025981 | Bacteria | 2999 |
| 256 | Ga0207640_10869121 | 3300025981 | Bacteria | 786 |
| 257 | Ga0207677_10020450 | 3300026023 | Bacteria | 4020 |
| 258 | Ga0207677_10915268 | 3300026023 | Bacteria | 791 |
| 259 | Ga0207639_10052515 | 3300026041 | Bacteria | 3106 |
| 260 | Ga0207639_10309253 | 3300026041 | Bacteria | 1399 |
| 261 | Ga0207678_10057504 | 3300026067 | Bacteria | 3347 |
| 262 | Ga0207678_10091070 | 3300026067 | Bacteria | 2606 |
| 263 | Ga0207708_10051023 | 3300026075 | Bacteria | 3149 |
| 264 | Ga0207708_10066351 | 3300026075 | Bacteria | 2759 |
| 265 | Ga0207708_10096029 | 3300026075 | Bacteria | 2290 |
| 266 | Ga0207708_10125882 | 3300026075 | Bacteria | 2000 |
| 267 | Ga0207702_10270083 | 3300026078 | Unclassified | 1604 |
| 268 | Ga0207641_10061648 | 3300026088 | Bacteria | 3199 |
| 269 | Ga0207641_10137105 | 3300026088 | Unclassified | 2204 |
| 270 | Ga0207648_10048840 | 3300026089 | Bacteria | 3704 |
| 271 | Ga0207648_10108635 | 3300026089 | Bacteria | 2435 |
| 272 | Ga0207648_10200484 | 3300026089 | Bacteria | 1770 |
| 273 | Ga0207648_10610769 | 3300026089 | Unclassified | 1006 |
| 274 | Ga0207676_10140900 | 3300026095 | Bacteria | 2064 |
| 275 | Ga0207676_10380394 | 3300026095 | Bacteria | 1314 |
| 276 | Ga0207674_10013487 | 3300026116 | Bacteria | 9063 |
| 277 | Ga0207674_10141696 | 3300026116 | Bacteria | 2363 |
| 278 | Ga0207675_100068551 | 3300026118 | Bacteria | 3315 |
| 279 | Ga0207675_100283749 | 3300026118 | Bacteria | 1609 |
| 280 | Ga0207683_10059867 | 3300026121 | Bacteria | 3346 |
| 281 | Ga0207683_10069795 | 3300026121 | Bacteria | 3103 |
| 282 | Ga0207683_10222869 | 3300026121 | Bacteria | 1718 |
| 283 | Ga0207428_10000798 | 3300027907 | Bacteria | 35648 |
| 284 | Ga0207428_10051517 | 3300027907 | Bacteria | 3290 |
| 285 | Ga0207428_10090728 | 3300027907 | Unclassified | 2373 |
| 286 | Ga0268266_10226708 | 3300028379 | Unclassified | 1720 |
| 287 | Ga0268265_10385485 | 3300028380 | Bacteria | 1291 |
| 288 | Ga0268265_10401671 | 3300028380 | Bacteria | 1267 |
| 289 | Ga0268264_10071682 | 3300028381 | Bacteria | 2936 |
| 290 | Ga0307408_100429496 | 3300031548 | Unclassified | 1141 |
| 291 | Ga0307406_10440181 | 3300031901 | Bacteria | 1043 |
| 292 | Ga0307409_100379867 | 3300031995 | Unclassified | 1343 |
| 293 | Ga0307416_100479725 | 3300032002 | Unclassified | 1303 |
| 294 | Ga0307416_100490239 | 3300032002 | Bacteria | 1291 |
| 295 | Ga0307416_100545304 | 3300032002 | Unclassified | 1232 |
| 296 | Ga0307411_10687067 | 3300032005 | Unclassified | 890 |
| 297 | Ga0373948_0049666 | 3300034817 | Bacteria | 898 |
| 298 | Ga0373958_0003444 | 3300034819 | Bacteria | 2282 |
| 299 | Ga0373932_0020208 | 3300035112 | Bacteria | 1744 |
| 300 | Ga0373941_0105672 | 3300035115 | Bacteria | 986 |
| 301 | Ga0373960_0126052 | 3300035121 | Bacteria | 854 |
| 302 | Ga0373961_0037957 | 3300035241 | Bacteria | 1379 |
| 303 | Ga0373961_0038656 | 3300035241 | Bacteria | 1368 |
| 304 | Ga0373931_0183503 | 3300035691 | Bacteria | 1241 |
| 305 | Ga0395900_0060379 | 3300037418 | Bacteria | 3902 |
| 306 | Ga0395905_0337386 | 3300037471 | Bacteria | 1398 |
| 307 | Ga0395901_0009274 | 3300038443 | Bacteria | 9978 |
| 308 | Ga0395901_0039151 | 3300038443 | Bacteria | 4906 |
| 309 | Ga0439461_0001610 | 3300041410 | Bacteria | 3504 |
| 310 | Ga0439461_0009146 | 3300041410 | Unclassified | 1792 |
| 311 | Ga0451845_0927633 | 3300041501 | Bacteria | 853 |
| 312 | Ga0451849_1333593 | 3300041505 | Bacteria | 757 |
| 313 | Ga0451853_2633744 | 3300041512 | Bacteria | 979 |
| 314 | Ga0439431_0001868 | 3300041997 | Bacteria | 4670 |
| 315 | Ga0439433_0001650 | 3300041999 | Bacteria | 4647 |
| 316 | Ga0439442_006220 | 3300042002 | Bacteria | 2395 |
| 317 | Ga0439448_0034253 | 3300042005 | Bacteria | 1622 |
| 318 | Ga0439432_087241 | 3300042006 | Unclassified | 941 |
| 319 | Ga0439449_0068787 | 3300042007 | Unclassified | 1305 |
| 320 | Ga0450923_008677 | 3300042125 | Unclassified | 1756 |
| 321 | Ga0450902_007255 | 3300042137 | Unclassified | 1714 |
| 322 | Ga0450906_026840 | 3300042145 | Unclassified | 1022 |
| 323 | Ga0439446_0003129 | 3300042156 | Bacteria | 4070 |
| 324 | Ga0439434_0030590 | 3300042435 | Unclassified | 1635 |
| 325 | Ga0439460_0203166 | 3300042461 | Unclassified | 675 |
| 326 | Ga0450918_006750 | 3300042531 | Bacteria | 2044 |
| 327 | Ga0451576_0757872 | 3300045051 | Unclassified | 1020 |
| 328 | Ga0495651_0071443 | 3300046462 | Bacteria | 2639 |
| 329 | Ga0495605_0191403 | 3300046474 | Unclassified | 895 |
| 330 | Ga0495596_0149914 | 3300046500 | Unclassified | 906 |
| 331 | Ga0495596_0193271 | 3300046500 | Bacteria | 791 |
| 332 | Ga0495620_0108833 | 3300046515 | Bacteria | 1100 |
| 333 | Ga0495631_0197752 | 3300046518 | Bacteria | 860 |
| 334 | Ga0495637_0089343 | 3300046520 | Unclassified | 1218 |
| 335 | Ga0495644_0091273 | 3300046523 | Bacteria | 1150 |
| 336 | Ga0495609_0112774 | 3300046538 | Bacteria | 1173 |
| 337 | Ga0495656_0027753 | 3300046615 | Archaea | 2264 |
| 338 | Ga0495656_0092678 | 3300046615 | Unclassified | 1384 |
| 339 | Ga0495656_0166571 | 3300046615 | Bacteria | 1074 |
| 340 | Ga0495657_0213669 | 3300046675 | Bacteria | 1172 |
| 341 | Ga0495589_0271428 | 3300046794 | Bacteria | 790 |
| 342 | Ga0495660_0063041 | 3300046810 | Bacteria | 1986 |
| 343 | Ga0495674_0067767 | 3300047319 | Bacteria | 3091 |
| 344 | Ga0496100_0059106 | 3300048903 | Bacteria | 2518 |
| 345 | Ga0496100_0307903 | 3300048903 | Bacteria | 1187 |
| 346 | Ga0496101_0550124 | 3300048904 | Bacteria | 912 |
| 347 | Ga0496102_0191421 | 3300048905 | Bacteria | 1927 |
| 348 | Ga0496102_0518995 | 3300048905 | Bacteria | 1114 |
| 349 | Ga0496102_0639412 | 3300048905 | Bacteria | 987 |
| 350 | Ga0496103_0124721 | 3300048906 | Bacteria | 1642 |
| 351 | Ga0496104_0070206 | 3300048907 | Bacteria | 3330 |
| 352 | Ga0496104_0114579 | 3300048907 | Bacteria | 2586 |
| 353 | Ga0496104_0125288 | 3300048907 | Bacteria | 2467 |
| 354 | Ga0496104_0770458 | 3300048907 | Bacteria | 869 |
| 355 | Ga0496105_0080571 | 3300048908 | Bacteria | 2689 |
| 356 | Ga0496105_0220839 | 3300048908 | Unclassified | 1543 |
| 357 | Ga0496108_0029280 | 3300048911 | Bacteria | 4558 |
| 358 | Ga0496108_0052619 | 3300048911 | Bacteria | 3413 |
| 359 | Ga0496108_0078296 | 3300048911 | Bacteria | 2798 |
| 360 | Ga0496108_0576898 | 3300048911 | Bacteria | 980 |
| 361 | Ga0496108_0672681 | 3300048911 | Bacteria | 899 |
| 362 | Ga0496109_0010431 | 3300048912 | Bacteria | 7936 |
| 363 | Ga0496109_0012606 | 3300048912 | Bacteria | 7299 |
| 364 | Ga0496109_0142367 | 3300048912 | Bacteria | 2243 |
| 365 | Ga0496109_0361728 | 3300048912 | Bacteria | 1371 |
| 366 | Ga0496109_0479850 | 3300048912 | Unclassified | 1174 |
| 367 | Ga0496109_1215605 | 3300048912 | Bacteria | 690 |
| 368 | Ga0496110_0029418 | 3300048913 | Bacteria | 4727 |
| 369 | Ga0496110_0046343 | 3300048913 | Bacteria | 3803 |
| 370 | Ga0496110_0201499 | 3300048913 | Bacteria | 1808 |
| 371 | Ga0496110_0235146 | 3300048913 | Unclassified | 1667 |
| 372 | Ga0496110_0664469 | 3300048913 | Bacteria | 942 |
| 373 | Ga0496111_0259657 | 3300048914 | Bacteria | 1289 |
| 374 | Ga0496111_0554516 | 3300048914 | Bacteria | 843 |
| 375 | Ga0496112_0019038 | 3300048915 | Bacteria | 6472 |
| 376 | Ga0496114_0015274 | 3300048917 | Bacteria | 6174 |
| 377 | Ga0496114_0131105 | 3300048917 | Bacteria | 2165 |
| 378 | Ga0496114_0766203 | 3300048917 | Bacteria | 843 |
| 379 | Ga0496115_0520680 | 3300048918 | Bacteria | 954 |
| 380 | Ga0501031_0039438 | 3300049568 | Bacteria | 3082 |
| 381 | Ga0501031_0080099 | 3300049568 | Bacteria | 2128 |
| 382 | Ga0501031_0156207 | 3300049568 | Bacteria | 1491 |
| 383 | Ga0501031_0157686 | 3300049568 | Bacteria | 1483 |
| 384 | Ga0501031_0313158 | 3300049568 | Bacteria | 1017 |
| 385 | Ga0501032_0010237 | 3300049569 | Bacteria | 6767 |
| 386 | Ga0501032_0028760 | 3300049569 | Bacteria | 3817 |
| 387 | Ga0501033_0003943 | 3300049570 | Bacteria | 12033 |
| 388 | Ga0501033_0261820 | 3300049570 | Bacteria | 1224 |
| 389 | Ga0501034_0027555 | 3300049571 | Bacteria | 5779 |
| 390 | Ga0501034_0192494 | 3300049571 | Bacteria | 2001 |
| 391 | Ga0501034_0620848 | 3300049571 | Unclassified | 985 |
| 392 | Ga0501036_0001948 | 3300049572 | Bacteria | 16020 |
| 393 | Ga0501036_0014830 | 3300049572 | Bacteria | 6500 |
| 394 | Ga0501036_0051449 | 3300049572 | Bacteria | 3487 |
| 395 | Ga0501036_0479585 | 3300049572 | Bacteria | 1035 |
| 396 | Ga0501037_0009974 | 3300049573 | Bacteria | 6966 |
| 397 | Ga0501037_0289276 | 3300049573 | Unclassified | 1140 |
| 398 | Ga0501037_0436683 | 3300049573 | Unclassified | 894 |
| 399 | Ga0501037_0571164 | 3300049573 | Bacteria | 762 |
| 400 | Ga0501038_0012350 | 3300049574 | Bacteria | 7805 |
| 401 | Ga0501038_0027791 | 3300049574 | Bacteria | 5028 |
| 402 | Ga0501038_0063121 | 3300049574 | Bacteria | 3163 |
| 403 | Ga0501038_0160044 | 3300049574 | Bacteria | 1830 |
| 404 | Ga0501038_0191874 | 3300049574 | Bacteria | 1643 |
| 405 | Ga0501039_0005106 | 3300049575 | Bacteria | 9943 |
| 406 | Ga0501039_0007758 | 3300049575 | Bacteria | 8188 |
| 407 | Ga0501039_0012123 | 3300049575 | Bacteria | 6571 |
| 408 | Ga0501039_0034642 | 3300049575 | Bacteria | 3895 |
| 409 | Ga0501039_0078630 | 3300049575 | Bacteria | 2566 |
| 410 | Ga0501039_0203071 | 3300049575 | Bacteria | 1558 |
| 411 | Ga0501040_0001259 | 3300049576 | Bacteria | 16110 |
| 412 | Ga0501040_0004669 | 3300049576 | Bacteria | 8885 |
| 413 | Ga0501040_0012536 | 3300049576 | Bacteria | 5556 |
| 414 | Ga0501040_0015119 | 3300049576 | Bacteria | 5099 |
| 415 | Ga0501040_0060193 | 3300049576 | Bacteria | 2609 |
| 416 | Ga0501040_0073366 | 3300049576 | Unclassified | 2364 |
| 417 | Ga0501040_0099238 | 3300049576 | Bacteria | 2030 |
| 418 | Ga0501040_0502988 | 3300049576 | Unclassified | 873 |
| 419 | Ga0501041_0002939 | 3300049577 | Bacteria | 9774 |
| 420 | Ga0501041_0006592 | 3300049577 | Bacteria | 6799 |
| 421 | Ga0501041_0030754 | 3300049577 | Bacteria | 3241 |
| 422 | Ga0501041_0307945 | 3300049577 | Bacteria | 998 |
| 423 | Ga0501042_0005882 | 3300049578 | Bacteria | 7929 |
| 424 | Ga0501042_0015410 | 3300049578 | Bacteria | 5234 |
| 425 | Ga0501042_0022681 | 3300049578 | Bacteria | 4385 |
| 426 | Ga0501042_0025310 | 3300049578 | Bacteria | 4167 |
| 427 | Ga0501042_0031167 | 3300049578 | Bacteria | 3773 |
| 428 | Ga0501042_0039334 | 3300049578 | Bacteria | 3360 |
| 429 | Ga0501042_0063258 | 3300049578 | Bacteria | 2644 |
| 430 | Ga0501042_0476496 | 3300049578 | Bacteria | 906 |
| 431 | Ga0501043_0003946 | 3300049579 | Bacteria | 12166 |
| 432 | Ga0501043_0161439 | 3300049579 | Unclassified | 1751 |
| 433 | Ga0501046_0005562 | 3300049580 | Bacteria | 11259 |
| 434 | Ga0501046_0015123 | 3300049580 | Bacteria | 6488 |
| 435 | Ga0501046_0041321 | 3300049580 | Bacteria | 3680 |
| 436 | Ga0501046_0051453 | 3300049580 | Bacteria | 3250 |
| 437 | Ga0501046_0085302 | 3300049580 | Bacteria | 2435 |
| 438 | Ga0501047_0200780 | 3300049581 | Bacteria | 1855 |
| 439 | Ga0501048_0006715 | 3300049582 | Bacteria | 8742 |
| 440 | Ga0501048_0007997 | 3300049582 | Bacteria | 8005 |
| 441 | Ga0501048_0014173 | 3300049582 | Bacteria | 5907 |
| 442 | Ga0501048_0030889 | 3300049582 | Bacteria | 3876 |
| 443 | Ga0501048_0051311 | 3300049582 | Bacteria | 2936 |
| 444 | Ga0501048_0052924 | 3300049582 | Bacteria | 2888 |
| 445 | Ga0501048_0065745 | 3300049582 | Bacteria | 2564 |
| 446 | Ga0501048_0238617 | 3300049582 | Bacteria | 1290 |
| 447 | Ga0501048_0405970 | 3300049582 | Unclassified | 974 |
| 448 | Ga0501067_0006263 | 3300049583 | Bacteria | 6600 |
| 449 | Ga0501067_0038418 | 3300049583 | Bacteria | 2657 |
| 450 | Ga0501067_0100930 | 3300049583 | Bacteria | 1603 |
| 451 | Ga0501067_0180610 | 3300049583 | Unclassified | 1175 |
| 452 | Ga0501068_0004980 | 3300049584 | Bacteria | 7235 |
| 453 | Ga0501068_0014535 | 3300049584 | Bacteria | 4502 |
| 454 | Ga0501068_0021087 | 3300049584 | Bacteria | 3803 |
| 455 | Ga0501068_0023196 | 3300049584 | Bacteria | 3635 |
| 456 | Ga0501068_0065860 | 3300049584 | Bacteria | 2206 |
| 457 | Ga0501068_0103844 | 3300049584 | Bacteria | 1763 |
| 458 | Ga0501068_0117265 | 3300049584 | Bacteria | 1658 |
| 459 | Ga0501069_0004260 | 3300049585 | Bacteria | 7389 |
| 460 | Ga0501069_0051388 | 3300049585 | Bacteria | 2294 |
| 461 | Ga0501069_0061874 | 3300049585 | Bacteria | 2090 |
| 462 | Ga0501069_0116914 | 3300049585 | Unclassified | 1521 |
| 463 | Ga0501070_0006624 | 3300049586 | Bacteria | 9857 |
| 464 | Ga0501070_0023384 | 3300049586 | Bacteria | 5177 |
| 465 | Ga0501070_0045442 | 3300049586 | Bacteria | 3653 |
| 466 | Ga0501070_0261586 | 3300049586 | Bacteria | 1414 |
| 467 | Ga0501071_0089781 | 3300049587 | Bacteria | 2255 |
| 468 | Ga0501071_0178115 | 3300049587 | Bacteria | 1592 |
| 469 | Ga0501071_0228492 | 3300049587 | Bacteria | 1401 |
| 470 | Ga0501071_0397725 | 3300049587 | Unclassified | 1052 |
| 471 | Ga0501072_0009351 | 3300049588 | Bacteria | 7450 |
| 472 | Ga0501072_0024754 | 3300049588 | Bacteria | 4672 |
| 473 | Ga0501072_0033906 | 3300049588 | Bacteria | 4000 |
| 474 | Ga0501072_0045914 | 3300049588 | Bacteria | 3436 |
| 475 | Ga0501072_0056481 | 3300049588 | Bacteria | 3093 |
| 476 | Ga0501072_0063015 | 3300049588 | Bacteria | 2924 |
| 477 | Ga0501072_0097696 | 3300049588 | Unclassified | 2334 |
| 478 | Ga0501072_0165100 | 3300049588 | Bacteria | 1766 |
| 479 | Ga0501072_0219394 | 3300049588 | Bacteria | 1516 |
| 480 | Ga0501072_0326434 | 3300049588 | Bacteria | 1219 |
| 481 | Ga0501073_0027379 | 3300049589 | Bacteria | 4076 |
| 482 | Ga0501073_0129361 | 3300049589 | Bacteria | 1750 |
| 483 | Ga0501073_0173894 | 3300049589 | Bacteria | 1491 |
| 484 | Ga0501073_0261225 | 3300049589 | Bacteria | 1195 |
| 485 | Ga0501073_0295251 | 3300049589 | Bacteria | 1118 |
| 486 | Ga0501074_0009811 | 3300049590 | Bacteria | 6954 |
| 487 | Ga0501074_0022777 | 3300049590 | Bacteria | 4554 |
| 488 | Ga0501074_0034249 | 3300049590 | Bacteria | 3682 |
| 489 | Ga0501074_0049940 | 3300049590 | Archaea | 3020 |
| 490 | Ga0501074_0053390 | 3300049590 | Bacteria | 2915 |
| 491 | Ga0501074_0294384 | 3300049590 | Bacteria | 1153 |
| 492 | Ga0501075_0002896 | 3300049591 | Bacteria | 11518 |
| 493 | Ga0501075_0005578 | 3300049591 | Bacteria | 8608 |
| 494 | Ga0501075_0031634 | 3300049591 | Bacteria | 3928 |
| 495 | Ga0501075_0038594 | 3300049591 | Bacteria | 3571 |
| 496 | Ga0501075_0045046 | 3300049591 | Bacteria | 3310 |
| 497 | Ga0501075_0075741 | 3300049591 | Bacteria | 2544 |
| 498 | Ga0501075_0078054 | 3300049591 | Bacteria | 2507 |
| 499 | Ga0501075_0141630 | 3300049591 | Bacteria | 1832 |
| 500 | Ga0501075_0503054 | 3300049591 | Bacteria | 924 |
| 501 | Ga0501075_0589601 | 3300049591 | Unclassified | 848 |
| 502 | Ga0501076_0003393 | 3300049592 | Bacteria | 11182 |
| 503 | Ga0501076_0010215 | 3300049592 | Bacteria | 6958 |
| 504 | Ga0501076_0146246 | 3300049592 | Unclassified | 1922 |
| 505 | Ga0501076_0233159 | 3300049592 | Bacteria | 1505 |
| 506 | Ga0501076_0303275 | 3300049592 | Bacteria | 1309 |
| 507 | Ga0501076_0426352 | 3300049592 | Bacteria | 1091 |
| 508 | Ga0501076_0784018 | 3300049592 | Unclassified | 786 |
| 509 | Ga0501077_0003236 | 3300049593 | Bacteria | 9810 |
| 510 | Ga0501077_0006256 | 3300049593 | Bacteria | 7280 |
| 511 | Ga0501077_0009288 | 3300049593 | Bacteria | 6104 |
| 512 | Ga0501077_0013415 | 3300049593 | Bacteria | 5139 |
| 513 | Ga0501077_0055861 | 3300049593 | Bacteria | 2506 |
| 514 | Ga0501077_0063722 | 3300049593 | Bacteria | 2338 |
| 515 | Ga0501077_0075883 | 3300049593 | Bacteria | 2129 |
| 516 | Ga0501077_0096869 | 3300049593 | Bacteria | 1869 |
| 517 | Ga0501077_0176154 | 3300049593 | Bacteria | 1359 |
| 518 | Ga0501077_0310180 | 3300049593 | Unclassified | 1006 |
| 519 | Ga0501079_0003089 | 3300049741 | Bacteria | 12191 |
| 520 | Ga0501079_0036001 | 3300049741 | Bacteria | 3811 |
| 521 | Ga0501079_0043947 | 3300049741 | Bacteria | 3448 |
| 522 | Ga0501079_0057238 | 3300049741 | Bacteria | 3008 |
| 523 | Ga0501079_0057788 | 3300049741 | Unclassified | 2993 |
| 524 | Ga0501079_0103901 | 3300049741 | Bacteria | 2204 |
| 525 | Ga0501079_0172696 | 3300049741 | Bacteria | 1685 |
| 526 | Ga0501079_0293099 | 3300049741 | Bacteria | 1272 |
| 527 | Ga0501079_0615411 | 3300049741 | Bacteria | 855 |
| 528 | Ga0501079_0959010 | 3300049741 | Bacteria | 673 |
| 529 | Ga0501080_0055581 | 3300049742 | Bacteria | 3687 |
| 530 | Ga0501080_0065434 | 3300049742 | Bacteria | 3381 |
| 531 | Ga0501080_0069290 | 3300049742 | Bacteria | 3280 |
| 532 | Ga0501080_0107086 | 3300049742 | Bacteria | 2591 |
| 533 | Ga0501080_0128260 | 3300049742 | Bacteria | 2348 |
| 534 | Ga0501080_0443656 | 3300049742 | Bacteria | 1164 |
| 535 | Ga0501080_0483717 | 3300049742 | Bacteria | 1107 |
| 536 | Ga0501081_0000659 | 3300049743 | Bacteria | 19786 |
| 537 | Ga0501081_0020891 | 3300049743 | Bacteria | 4368 |
| 538 | Ga0501081_0022847 | 3300049743 | Bacteria | 4187 |
| 539 | Ga0501081_0025107 | 3300049743 | Bacteria | 4006 |
| 540 | Ga0501081_0029560 | 3300049743 | Bacteria | 3704 |
| 541 | Ga0501081_0039365 | 3300049743 | Bacteria | 3234 |
| 542 | Ga0501081_0162307 | 3300049743 | Bacteria | 1610 |
| 543 | Ga0501083_0062578 | 3300049744 | Bacteria | 2482 |
| 544 | Ga0501083_0075363 | 3300049744 | Bacteria | 2241 |
| 545 | Ga0501083_0075497 | 3300049744 | Bacteria | 2239 |
| 546 | Ga0501083_0133295 | 3300049744 | Bacteria | 1629 |
| 547 | Ga0501035_0037180 | 3300049822 | Bacteria | 4410 |
| 548 | Ga0501035_0053900 | 3300049822 | Bacteria | 3595 |
| 549 | Ga0501035_0100839 | 3300049822 | Bacteria | 2534 |
| 550 | Ga0501035_0155019 | 3300049822 | Bacteria | 1986 |
| 551 | Ga0501035_0279137 | 3300049822 | Bacteria | 1412 |
| 552 | Ga0501044_0025012 | 3300049823 | Bacteria | 6331 |
| 553 | Ga0501044_0136032 | 3300049823 | Bacteria | 2449 |
| 554 | Ga0501044_0199145 | 3300049823 | Bacteria | 1962 |
| 555 | Ga0501045_0001032 | 3300049824 | Bacteria | 18298 |
| 556 | Ga0501045_0026827 | 3300049824 | Archaea | 4146 |
| 557 | Ga0501045_0032274 | 3300049824 | Bacteria | 3794 |
| 558 | Ga0501045_0041645 | 3300049824 | Bacteria | 3342 |
| 559 | Ga0501045_0050059 | 3300049824 | Bacteria | 3047 |
| 560 | Ga0501045_0055659 | 3300049824 | Bacteria | 2892 |
| 561 | Ga0501045_0070820 | 3300049824 | Bacteria | 2565 |
| 562 | Ga0501045_0085886 | 3300049824 | Bacteria | 2322 |
| 563 | Ga0501045_0468387 | 3300049824 | Unclassified | 936 |
| 564 | Ga0501045_0615799 | 3300049824 | Unclassified | 803 |
| 565 | nmdc:mga00v17_6407_c1 | 3300050491 | Bacteria | 6243 |
| 566 | nmdc:mga07m45_60679_c1 | 3300050496 | Bacteria | 2141 |
| 567 | nmdc:mga05p37_135578_c1 | 3300050507 | Unclassified | 3019 |
| 568 | nmdc:mga05p37_152400_c1 | 3300050507 | Unclassified | 2826 |
| 569 | nmdc:mga05p37_20385_c1 | 3300050507 | Bacteria | 8020 |
| 570 | nmdc:mga05p37_464267_c1 | 3300050507 | Bacteria | 1462 |
| 571 | nmdc:mga09592_55073_c1 | 3300050508 | Bacteria | 3361 |
| 572 | nmdc:mga08y16_1032489_c1 | 3300050511 | Unclassified | 800 |
| 573 | nmdc:mga08y16_12365_c1 | 3300050511 | Bacteria | 8975 |
| 574 | nmdc:mga08y16_18447_c1 | 3300050511 | Bacteria | 7352 |
| 575 | nmdc:mga08x19_339220_c1 | 3300050514 | Bacteria | 1048 |
| 576 | nmdc:mga0a205_237416_c1 | 3300050515 | Bacteria | 1704 |
| 577 | nmdc:mga0a205_246108_c1 | 3300050515 | Bacteria | 1668 |
| 578 | nmdc:mga0a205_7972_c1 | 3300050515 | Bacteria | 9622 |
| 579 | Ga0495619_0134260 | 3300053085 | Bacteria | 1702 |
| 580 | Ga0501084_0038348 | 3300054114 | Bacteria | 4006 |
| 581 | Ga0501084_0161318 | 3300054114 | Bacteria | 1891 |
| 582 | Ga0501084_0244887 | 3300054114 | Bacteria | 1513 |
| 583 | Ga0501084_0508918 | 3300054114 | Bacteria | 1018 |
| 584 | Ga0501082_0057564 | 3300060353 | Bacteria | 3348 |
| 585 | Ga0501082_0083637 | 3300060353 | Bacteria | 2753 |
| 586 | Ga0501082_0154985 | 3300060353 | Bacteria | 1990 |
| 587 | Ga0501082_0260023 | 3300060353 | Unclassified | 1510 |
| 588 | Ga0501082_0351263 | 3300060353 | Bacteria | 1285 |
| 589 | Ga0530510_0009774 | 3300061734 | Bacteria | 6731 |
| 590 | Ga0530510_0021196 | 3300061734 | Bacteria | 4622 |
| 591 | Ga0530510_0025725 | 3300061734 | Bacteria | 4209 |
| 592 | Ga0530510_0087356 | 3300061734 | Bacteria | 2272 |
| 593 | Ga0530510_0093670 | 3300061734 | Bacteria | 2194 |
| 594 | Ga0530510_0135890 | 3300061734 | Bacteria | 1810 |
| 595 | Ga0530510_0183481 | 3300061734 | Bacteria | 1552 |
| 596 | Ga0530510_0827199 | 3300061734 | Unclassified | 707 |
| 597 | Ga0501040_0477752 | |||
| 598 | JGI24739J22299_10097847 | |||
| 599 | JGI24743J22301_10019892 | |||
| 600 | JGI24738J21930_10027217 | |||
| 601 | JGI25406J46586_10027498 | |||
| 602 | Ga0070658_10025356 | |||
| 603 | Ga0070676_10050882 | |||
| 604 | Ga0070683_100059088 | |||
| 605 | Ga0070683_100079754 | |||
| 606 | Ga0070683_100099763 | |||
| 607 | Ga0070690_100534651 | |||
| 608 | Ga0070677_10072456 | |||
| 609 | Ga0070680_100088204 | |||
| 610 | Ga0070682_100013019 | |||
| 611 | Ga0070682_100163064 | |||
| 612 | Ga0068868_100006825 | |||
| 613 | Ga0068868_100020164 | |||
| 614 | Ga0070660_100030602 | |||
| 615 | Ga0070689_100497322 | |||
| 616 | Ga0070691_10001275 | |||
| 617 | Ga0070661_100035571 | |||
| 618 | Ga0070661_100336510 | |||
| 619 | Ga0070692_10017112 | |||
| 620 | Ga0070692_10019261 | |||
| 621 | Ga0070692_10086833 | |||
| 622 | Ga0070668_100054175 | |||
| 623 | Ga0070669_100357430 | |||
| 624 | Ga0070675_100044845 | |||
| 625 | Ga0070671_100206446 | |||
| 626 | Ga0070674_100019458 | |||
| 627 | Ga0070674_100064178 | |||
| 628 | Ga0070688_100047743 | |||
| 629 | Ga0070659_100051234 | |||
| 630 | Ga0070659_100175628 | |||
| 631 | Ga0070659_100481963 | |||
| 632 | Ga0070667_100838141 | |||
| 633 | Ga0070701_10036655 | |||
| 634 | Ga0070705_100019517 | |||
| 635 | Ga0070700_100008297 | |||
| 636 | Ga0070700_100026169 | |||
| 637 | Ga0070700_100104637 | |||
| 638 | Ga0070694_100194781 | |||
| 639 | Ga0070694_100216839 | |||
| 640 | Ga0070663_100100015 | |||
| 641 | Ga0070678_100023241 | |||
| 642 | Ga0070662_100092623 | |||
| 643 | Ga0070662_100125182 | |||
| 644 | Ga0070681_10012454 | |||
| 645 | Ga0068867_100050741 | |||
| 646 | Ga0068867_100068937 | |||
| 647 | Ga0068867_100550241 | |||
| 648 | Ga0070685_10005508 | |||
| 649 | Ga0070698_100051788 | |||
| 650 | Ga0070699_100155688 | |||
| 651 | Ga0070679_100065439 | |||
| 652 | Ga0070679_100134554 | |||
| 653 | Ga0070684_100019412 | |||
| 654 | Ga0070684_100067185 | |||
| 655 | Ga0070684_100135317 | |||
| 656 | Ga0070684_100282937 | |||
| 657 | Ga0070684_100351687 | |||
| 658 | Ga0068853_100066724 | |||
| 659 | Ga0070672_100031701 | |||
| 660 | Ga0070672_100055546 | |||
| 661 | Ga0070672_100189113 | |||
| 662 | Ga0070672_100284093 | |||
| 663 | Ga0070672_100388465 | |||
| 664 | Ga0070686_100069060 | |||
| 665 | Ga0070686_100077645 | |||
| 666 | Ga0070695_100074656 | |||
| 667 | Ga0070695_100090592 | |||
| 668 | Ga0070696_100054400 | |||
| 669 | Ga0070693_100147551 | |||
| 670 | Ga0070693_100324436 | |||
| 671 | Ga0070693_100521399 | |||
| 672 | Ga0070665_100105033 | |||
| 673 | Ga0070665_100178094 | |||
| 674 | Ga0070665_101135711 | |||
| 675 | Ga0070704_100017098 | |||
| 676 | Ga0070704_100522966 | |||
| 677 | Ga0070664_100068124 | |||
| 678 | Ga0070664_100096145 | |||
| 679 | Ga0070664_100113679 | |||
| 680 | Ga0068857_100899052 | |||
| 681 | Ga0068854_100003129 | |||
| 682 | Ga0068854_100108467 | |||
| 683 | Ga0068854_100748408 | |||
| 684 | Ga0068852_100032692 | |||
| 685 | Ga0068852_100457777 | |||
| 686 | Ga0068864_100019665 | |||
| 687 | Ga0068866_10046310 | |||
| 688 | Ga0068866_10073481 | |||
| 689 | Ga0068861_100044996 | |||
| 690 | Ga0068861_101067149 | |||
| 691 | Ga0068851_10058524 | |||
| 692 | Ga0068870_10023857 | |||
| 693 | Ga0068870_10195621 | |||
| 694 | Ga0068858_100070859 | |||
| 695 | Ga0068858_100078073 | |||
| 696 | Ga0081455_10075691 | |||
| 697 | Ga0081455_10094885 | |||
| 698 | Ga0081455_10239767 | |||
| 699 | Ga0081539_10002688 | |||
| 700 | Ga0075432_10001384 | |||
| 701 | Ga0075367_10148750 | |||
| 702 | Ga0097621_100196392 | |||
| 703 | Ga0097621_100359516 | |||
| 704 | Ga0075370_10162755 | |||
| 705 | Ga0068871_100148941 | |||
| 706 | Ga0068871_100508424 | |||
| 707 | Ga0075428_100006418 | |||
| 708 | Ga0075428_100578884 | |||
| 709 | Ga0075430_100617662 | |||
| 710 | Ga0075433_10034018 | |||
| 711 | Ga0075433_10508727 | |||
| 712 | Ga0075429_100042289 | |||
| 713 | Ga0075429_100726403 | |||
| 714 | Ga0068865_100006497 | |||
| 715 | Ga0068865_100214274 | |||
| 716 | Ga0075436_100399386 | |||
| 717 | Ga0111539_10037117 | |||
| 718 | Ga0105245_10009339 | |||
| 719 | Ga0105245_10199867 | |||
| 720 | Ga0105245_10425178 | |||
| 721 | Ga0105245_11279366 | |||
| 722 | Ga0105247_10082583 | |||
| 723 | Ga0114129_10000896 | |||
| 724 | Ga0114129_10264516 | |||
| 725 | Ga0114129_10308802 | |||
| 726 | Ga0114129_10782912 | |||
| 727 | Ga0105243_10005819 | |||
| 728 | Ga0105243_10085191 | |||
| 729 | Ga0105243_10376383 | |||
| 730 | Ga0105243_10401176 | |||
| 731 | Ga0105243_11105716 | |||
| 732 | Ga0105241_10609008 | |||
| 733 | Ga0105242_10497072 | |||
| 734 | Ga0105242_10779990 | |||
| 735 | Ga0105248_10047063 | |||
| 736 | Ga0105248_10870232 | |||
| 737 | Ga0105238_10760419 | |||
| 738 | Ga0105239_10055203 | |||
| 739 | Ga0105239_10076072 | |||
| 740 | Ga0105239_10094248 | |||
| 741 | Ga0105239_10099717 | |||
| 742 | Ga0105239_10414742 | |||
| 743 | Ga0105246_10014408 | |||
| 744 | Ga0105246_10153666 | |||
| 745 | Ga0105246_10640646 | |||
| 746 | Ga0157371_10019286 | |||
| 747 | Ga0157371_10207766 | |||
| 748 | Ga0157371_10249976 | |||
| 749 | Ga0157369_10164613 | |||
| 750 | Ga0157374_10217353 | |||
| 751 | Ga0157372_10030676 | |||
| 752 | Ga0157372_10111039 | |||
| 753 | Ga0157372_10299089 | |||
| 754 | Ga0157372_11329542 | |||
| 755 | Ga0157375_10007151 | |||
| 756 | Ga0157375_10019741 | |||
| 757 | Ga0157375_10109347 | |||
| 758 | Ga0157375_10228940 | |||
| 759 | Ga0157375_10603306 | |||
| 760 | Ga0157375_11190028 | |||
| 761 | Ga0163163_10079025 | |||
| 762 | Ga0163163_10316533 | |||
| 763 | Ga0163163_10620660 | |||
| 764 | Ga0163163_10884157 | |||
| 765 | Ga0163163_11304388 | |||
| 766 | Ga0157380_10021199 | |||
| 767 | Ga0157380_10045011 | |||
| 768 | Ga0157380_10233767 | |||
| 769 | Ga0157380_10907141 | |||
| 770 | Ga0157377_10045075 | |||
| 771 | Ga0157377_10319366 | |||
| 772 | Ga0157379_10052435 | |||
| 773 | Ga0157376_10045855 | |||
| 774 | Ga0157376_10593051 | |||
| 775 | Ga0157376_10779659 | |||
| 776 | Ga0163161_10203629 | |||
| 777 | Ga0206353_10732547 | |||
| 778 | Ga0207656_10039165 | |||
| 779 | Ga0207682_10064919 | |||
| 780 | Ga0207642_10030560 | |||
| 781 | Ga0207642_10167572 | |||
| 782 | Ga0207642_10312865 | |||
| 783 | Ga0207710_10170137 | |||
| 784 | Ga0207688_10016867 | |||
| 785 | Ga0207688_10021450 | |||
| 786 | Ga0207688_10029847 | |||
| 787 | Ga0207688_10139322 | |||
| 788 | Ga0207647_10113299 | |||
| 789 | Ga0207645_10074078 | |||
| 790 | Ga0207645_10087642 | |||
| 791 | Ga0207643_10002884 | |||
| 792 | Ga0207654_10223275 | |||
| 793 | Ga0207707_10051974 | |||
| 794 | Ga0207707_10416033 | |||
| 795 | Ga0207660_10056205 | |||
| 796 | Ga0207657_10037484 | |||
| 797 | Ga0207649_10151537 | |||
| 798 | Ga0207652_10151152 | |||
| 799 | Ga0207652_10593962 | |||
| 800 | Ga0207681_10220506 | |||
| 801 | Ga0207694_10011601 | |||
| 802 | Ga0207694_10526744 | |||
| 803 | Ga0207650_10021355 | |||
| 804 | Ga0207650_10244895 | |||
| 805 | Ga0207650_10365563 | |||
| 806 | Ga0207659_10240488 | |||
| 807 | Ga0207659_10852439 | |||
| 808 | Ga0207687_10043656 | |||
| 809 | Ga0207687_10171712 | |||
| 810 | Ga0207644_10067161 | |||
| 811 | Ga0207690_10120856 | |||
| 812 | Ga0207690_10292400 | |||
| 813 | Ga0207706_10026936 | |||
| 814 | Ga0207706_10121734 | |||
| 815 | Ga0207706_10151195 | |||
| 816 | Ga0207686_10399499 | |||
| 817 | Ga0207709_10146052 | |||
| 818 | Ga0207709_10148362 | |||
| 819 | Ga0207709_10167660 | |||
| 820 | Ga0207709_10358050 | |||
| 821 | Ga0207709_10389975 | |||
| 822 | Ga0207709_10651929 | |||
| 823 | Ga0207670_10217634 | |||
| 824 | Ga0207669_10007615 | |||
| 825 | Ga0207669_10038577 | |||
| 826 | Ga0207669_10094433 | |||
| 827 | Ga0207669_10156922 | |||
| 828 | Ga0207704_10003930 | |||
| 829 | Ga0207704_10052330 | |||
| 830 | Ga0207704_10148331 | |||
| 831 | Ga0207691_10007729 | |||
| 832 | Ga0207691_10052788 | |||
| 833 | Ga0207691_10056024 | |||
| 834 | Ga0207691_10091388 | |||
| 835 | Ga0207691_10145302 | |||
| 836 | Ga0207691_10266761 | |||
| 837 | Ga0207691_10638702 | |||
| 838 | Ga0207711_10045526 | |||
| 839 | Ga0207689_10089417 | |||
| 840 | Ga0207661_10000652 | |||
| 841 | Ga0207661_10232766 | |||
| 842 | Ga0207661_10410535 | |||
| 843 | Ga0207679_10075292 | |||
| 844 | Ga0207679_10105999 | |||
| 845 | Ga0207679_10157412 | |||
| 846 | Ga0207679_10568565 | |||
| 847 | Ga0207667_10099418 | |||
| 848 | Ga0207651_10378279 | |||
| 849 | Ga0207712_10153884 | |||
| 850 | Ga0207712_11051848 | |||
| 851 | Ga0207640_10039128 | |||
| 852 | Ga0207640_10869121 | |||
| 853 | Ga0207677_10020450 | |||
| 854 | Ga0207677_10915268 | |||
| 855 | Ga0207639_10052515 | |||
| 856 | Ga0207639_10309253 | |||
| 857 | Ga0207678_10057504 | |||
| 858 | Ga0207678_10091070 | |||
| 859 | Ga0207708_10051023 | |||
| 860 | Ga0207708_10066351 | |||
| 861 | Ga0207708_10096029 | |||
| 862 | Ga0207708_10125882 | |||
| 863 | Ga0207702_10270083 | |||
| 864 | Ga0207641_10061648 | |||
| 865 | Ga0207641_10137105 | |||
| 866 | Ga0207648_10048840 | |||
| 867 | Ga0207648_10108635 | |||
| 868 | Ga0207648_10200484 | |||
| 869 | Ga0207648_10610769 | |||
| 870 | Ga0207676_10140900 | |||
| 871 | Ga0207676_10380394 | |||
| 872 | Ga0207674_10013487 | |||
| 873 | Ga0207674_10141696 | |||
| 874 | Ga0207675_100068551 | |||
| 875 | Ga0207675_100283749 | |||
| 876 | Ga0207683_10059867 | |||
| 877 | Ga0207683_10069795 | |||
| 878 | Ga0207683_10222869 | |||
| 879 | Ga0207428_10000798 | |||
| 880 | Ga0207428_10051517 | |||
| 881 | Ga0207428_10090728 | |||
| 882 | Ga0268266_10226708 | |||
| 883 | Ga0268265_10385485 | |||
| 884 | Ga0268265_10401671 | |||
| 885 | Ga0268264_10071682 | |||
| 886 | Ga0307408_100429496 | |||
| 887 | Ga0307406_10440181 | |||
| 888 | Ga0307409_100379867 | |||
| 889 | Ga0307416_100479725 | |||
| 890 | Ga0307416_100490239 | |||
| 891 | Ga0307416_100545304 | |||
| 892 | Ga0307411_10687067 | |||
| 893 | Ga0373948_0049666 | |||
| 894 | Ga0373958_0003444 | |||
| 895 | Ga0373932_0020208 | |||
| 896 | Ga0373941_0105672 | |||
| 897 | Ga0373960_0126052 | |||
| 898 | Ga0373961_0037957 | |||
| 899 | Ga0373961_0038656 | |||
| 900 | Ga0373931_0183503 | |||
| 901 | Ga0395900_0060379 | |||
| 902 | Ga0395905_0337386 | |||
| 903 | Ga0395901_0009274 | |||
| 904 | Ga0395901_0039151 | |||
| 905 | Ga0439461_0001610 | |||
| 906 | Ga0439461_0009146 | |||
| 907 | Ga0451845_0927633 | |||
| 908 | Ga0451849_1333593 | |||
| 909 | Ga0451853_2633744 | |||
| 910 | Ga0439431_0001868 | |||
| 911 | Ga0439433_0001650 | |||
| 912 | Ga0439442_006220 | |||
| 913 | Ga0439448_0034253 | |||
| 914 | Ga0439432_087241 | |||
| 915 | Ga0439449_0068787 | |||
| 916 | Ga0450923_008677 | |||
| 917 | Ga0450902_007255 | |||
| 918 | Ga0450906_026840 | |||
| 919 | Ga0439446_0003129 | |||
| 920 | Ga0439434_0030590 | |||
| 921 | Ga0439460_0203166 | |||
| 922 | Ga0450918_006750 | |||
| 923 | Ga0451576_0757872 | |||
| 924 | Ga0495651_0071443 | |||
| 925 | Ga0495605_0191403 | |||
| 926 | Ga0495596_0149914 | |||
| 927 | Ga0495596_0193271 | |||
| 928 | Ga0495620_0108833 | |||
| 929 | Ga0495631_0197752 | |||
| 930 | Ga0495637_0089343 | |||
| 931 | Ga0495644_0091273 | |||
| 932 | Ga0495609_0112774 | |||
| 933 | Ga0495656_0027753 | |||
| 934 | Ga0495656_0092678 | |||
| 935 | Ga0495656_0166571 | |||
| 936 | Ga0495657_0213669 | |||
| 937 | Ga0495589_0271428 | |||
| 938 | Ga0495660_0063041 | |||
| 939 | Ga0495674_0067767 | |||
| 940 | Ga0496100_0059106 | |||
| 941 | Ga0496100_0307903 | |||
| 942 | Ga0496101_0550124 | |||
| 943 | Ga0496102_0191421 | |||
| 944 | Ga0496102_0518995 | |||
| 945 | Ga0496102_0639412 | |||
| 946 | Ga0496103_0124721 | |||
| 947 | Ga0496104_0070206 | |||
| 948 | Ga0496104_0114579 | |||
| 949 | Ga0496104_0125288 | |||
| 950 | Ga0496104_0770458 | |||
| 951 | Ga0496105_0080571 | |||
| 952 | Ga0496105_0220839 | |||
| 953 | Ga0496108_0029280 | |||
| 954 | Ga0496108_0052619 | |||
| 955 | Ga0496108_0078296 | |||
| 956 | Ga0496108_0576898 | |||
| 957 | Ga0496108_0672681 | |||
| 958 | Ga0496109_0010431 | |||
| 959 | Ga0496109_0012606 | |||
| 960 | Ga0496109_0142367 | |||
| 961 | Ga0496109_0361728 | |||
| 962 | Ga0496109_0479850 | |||
| 963 | Ga0496109_1215605 | |||
| 964 | Ga0496110_0029418 | |||
| 965 | Ga0496110_0046343 | |||
| 966 | Ga0496110_0201499 | |||
| 967 | Ga0496110_0235146 | |||
| 968 | Ga0496110_0664469 | |||
| 969 | Ga0496111_0259657 | |||
| 970 | Ga0496111_0554516 | |||
| 971 | Ga0496112_0019038 | |||
| 972 | Ga0496114_0015274 | |||
| 973 | Ga0496114_0131105 | |||
| 974 | Ga0496114_0766203 | |||
| 975 | Ga0496115_0520680 | |||
| 976 | Ga0501031_0039438 | |||
| 977 | Ga0501031_0080099 | |||
| 978 | Ga0501031_0156207 | |||
| 979 | Ga0501031_0157686 | |||
| 980 | Ga0501031_0313158 | |||
| 981 | Ga0501032_0010237 | |||
| 982 | Ga0501032_0028760 | |||
| 983 | Ga0501033_0003943 | |||
| 984 | Ga0501033_0261820 | |||
| 985 | Ga0501034_0027555 | |||
| 986 | Ga0501034_0192494 | |||
| 987 | Ga0501034_0620848 | |||
| 988 | Ga0501036_0001948 | |||
| 989 | Ga0501036_0014830 | |||
| 990 | Ga0501036_0051449 | |||
| 991 | Ga0501036_0479585 | |||
| 992 | Ga0501037_0009974 | |||
| 993 | Ga0501037_0289276 | |||
| 994 | Ga0501037_0436683 | |||
| 995 | Ga0501037_0571164 | |||
| 996 | Ga0501038_0012350 | |||
| 997 | Ga0501038_0027791 | |||
| 998 | Ga0501038_0063121 | |||
| 999 | Ga0501038_0160044 | |||
| 1000 | Ga0501038_0191874 | |||
| 1001 | Ga0501039_0005106 | |||
| 1002 | Ga0501039_0007758 | |||
| 1003 | Ga0501039_0012123 | |||
| 1004 | Ga0501039_0034642 | |||
| 1005 | Ga0501039_0078630 | |||
| 1006 | Ga0501039_0203071 | |||
| 1007 | Ga0501040_0001259 | |||
| 1008 | Ga0501040_0004669 | |||
| 1009 | Ga0501040_0012536 | |||
| 1010 | Ga0501040_0015119 | |||
| 1011 | Ga0501040_0060193 | |||
| 1012 | Ga0501040_0073366 | |||
| 1013 | Ga0501040_0099238 | |||
| 1014 | Ga0501040_0502988 | |||
| 1015 | Ga0501041_0002939 | |||
| 1016 | Ga0501041_0006592 | |||
| 1017 | Ga0501041_0030754 | |||
| 1018 | Ga0501041_0307945 | |||
| 1019 | Ga0501042_0005882 | |||
| 1020 | Ga0501042_0015410 | |||
| 1021 | Ga0501042_0022681 | |||
| 1022 | Ga0501042_0025310 | |||
| 1023 | Ga0501042_0031167 | |||
| 1024 | Ga0501042_0039334 | |||
| 1025 | Ga0501042_0063258 | |||
| 1026 | Ga0501042_0476496 | |||
| 1027 | Ga0501043_0003946 | |||
| 1028 | Ga0501043_0161439 | |||
| 1029 | Ga0501046_0005562 | |||
| 1030 | Ga0501046_0015123 | |||
| 1031 | Ga0501046_0041321 | |||
| 1032 | Ga0501046_0051453 | |||
| 1033 | Ga0501046_0085302 | |||
| 1034 | Ga0501047_0200780 | |||
| 1035 | Ga0501048_0006715 | |||
| 1036 | Ga0501048_0007997 | |||
| 1037 | Ga0501048_0014173 | |||
| 1038 | Ga0501048_0030889 | |||
| 1039 | Ga0501048_0051311 | |||
| 1040 | Ga0501048_0052924 | |||
| 1041 | Ga0501048_0065745 | |||
| 1042 | Ga0501048_0238617 | |||
| 1043 | Ga0501048_0405970 | |||
| 1044 | Ga0501067_0006263 | |||
| 1045 | Ga0501067_0038418 | |||
| 1046 | Ga0501067_0100930 | |||
| 1047 | Ga0501067_0180610 | |||
| 1048 | Ga0501068_0004980 | |||
| 1049 | Ga0501068_0014535 | |||
| 1050 | Ga0501068_0021087 | |||
| 1051 | Ga0501068_0023196 | |||
| 1052 | Ga0501068_0065860 | |||
| 1053 | Ga0501068_0103844 | |||
| 1054 | Ga0501068_0117265 | |||
| 1055 | Ga0501069_0004260 | |||
| 1056 | Ga0501069_0051388 | |||
| 1057 | Ga0501069_0061874 | |||
| 1058 | Ga0501069_0116914 | |||
| 1059 | Ga0501070_0006624 | |||
| 1060 | Ga0501070_0023384 | |||
| 1061 | Ga0501070_0045442 | |||
| 1062 | Ga0501070_0261586 | |||
| 1063 | Ga0501071_0089781 | |||
| 1064 | Ga0501071_0178115 | |||
| 1065 | Ga0501071_0228492 | |||
| 1066 | Ga0501071_0397725 | |||
| 1067 | Ga0501072_0009351 | |||
| 1068 | Ga0501072_0024754 | |||
| 1069 | Ga0501072_0033906 | |||
| 1070 | Ga0501072_0045914 | |||
| 1071 | Ga0501072_0056481 | |||
| 1072 | Ga0501072_0063015 | |||
| 1073 | Ga0501072_0097696 | |||
| 1074 | Ga0501072_0165100 | |||
| 1075 | Ga0501072_0219394 | |||
| 1076 | Ga0501072_0326434 | |||
| 1077 | Ga0501073_0027379 | |||
| 1078 | Ga0501073_0129361 | |||
| 1079 | Ga0501073_0173894 | |||
| 1080 | Ga0501073_0261225 | |||
| 1081 | Ga0501073_0295251 | |||
| 1082 | Ga0501074_0009811 | |||
| 1083 | Ga0501074_0022777 | |||
| 1084 | Ga0501074_0034249 | |||
| 1085 | Ga0501074_0049940 | |||
| 1086 | Ga0501074_0053390 | |||
| 1087 | Ga0501074_0294384 | |||
| 1088 | Ga0501075_0002896 | |||
| 1089 | Ga0501075_0005578 | |||
| 1090 | Ga0501075_0031634 | |||
| 1091 | Ga0501075_0038594 | |||
| 1092 | Ga0501075_0045046 | |||
| 1093 | Ga0501075_0075741 | |||
| 1094 | Ga0501075_0078054 | |||
| 1095 | Ga0501075_0141630 | |||
| 1096 | Ga0501075_0503054 | |||
| 1097 | Ga0501075_0589601 | |||
| 1098 | Ga0501076_0003393 | |||
| 1099 | Ga0501076_0010215 | |||
| 1100 | Ga0501076_0146246 | |||
| 1101 | Ga0501076_0233159 | |||
| 1102 | Ga0501076_0303275 | |||
| 1103 | Ga0501076_0426352 | |||
| 1104 | Ga0501076_0784018 | |||
| 1105 | Ga0501077_0003236 | |||
| 1106 | Ga0501077_0006256 | |||
| 1107 | Ga0501077_0009288 | |||
| 1108 | Ga0501077_0013415 | |||
| 1109 | Ga0501077_0055861 | |||
| 1110 | Ga0501077_0063722 | |||
| 1111 | Ga0501077_0075883 | |||
| 1112 | Ga0501077_0096869 | |||
| 1113 | Ga0501077_0176154 | |||
| 1114 | Ga0501077_0310180 | |||
| 1115 | Ga0501079_0003089 | |||
| 1116 | Ga0501079_0036001 | |||
| 1117 | Ga0501079_0043947 | |||
| 1118 | Ga0501079_0057238 | |||
| 1119 | Ga0501079_0057788 | |||
| 1120 | Ga0501079_0103901 | |||
| 1121 | Ga0501079_0172696 | |||
| 1122 | Ga0501079_0293099 | |||
| 1123 | Ga0501079_0615411 | |||
| 1124 | Ga0501079_0959010 | |||
| 1125 | Ga0501080_0055581 | |||
| 1126 | Ga0501080_0065434 | |||
| 1127 | Ga0501080_0069290 | |||
| 1128 | Ga0501080_0107086 | |||
| 1129 | Ga0501080_0128260 | |||
| 1130 | Ga0501080_0443656 | |||
| 1131 | Ga0501080_0483717 | |||
| 1132 | Ga0501081_0000659 | |||
| 1133 | Ga0501081_0020891 | |||
| 1134 | Ga0501081_0022847 | |||
| 1135 | Ga0501081_0025107 | |||
| 1136 | Ga0501081_0029560 | |||
| 1137 | Ga0501081_0039365 | |||
| 1138 | Ga0501081_0162307 | |||
| 1139 | Ga0501083_0062578 | |||
| 1140 | Ga0501083_0075363 | |||
| 1141 | Ga0501083_0075497 | |||
| 1142 | Ga0501083_0133295 | |||
| 1143 | Ga0501035_0037180 | |||
| 1144 | Ga0501035_0053900 | |||
| 1145 | Ga0501035_0100839 | |||
| 1146 | Ga0501035_0155019 | |||
| 1147 | Ga0501035_0279137 | |||
| 1148 | Ga0501044_0025012 | |||
| 1149 | Ga0501044_0136032 | |||
| 1150 | Ga0501044_0199145 | |||
| 1151 | Ga0501045_0001032 | |||
| 1152 | Ga0501045_0026827 | |||
| 1153 | Ga0501045_0032274 | |||
| 1154 | Ga0501045_0041645 | |||
| 1155 | Ga0501045_0050059 | |||
| 1156 | Ga0501045_0055659 | |||
| 1157 | Ga0501045_0070820 | |||
| 1158 | Ga0501045_0085886 | |||
| 1159 | Ga0501045_0468387 | |||
| 1160 | Ga0501045_0615799 | |||
| 1161 | nmdc:mga00v17_6407_c1 | |||
| 1162 | nmdc:mga07m45_60679_c1 | |||
| 1163 | nmdc:mga05p37_135578_c1 | |||
| 1164 | nmdc:mga05p37_152400_c1 | |||
| 1165 | nmdc:mga05p37_20385_c1 | |||
| 1166 | nmdc:mga05p37_464267_c1 | |||
| 1167 | nmdc:mga09592_55073_c1 | |||
| 1168 | nmdc:mga08y16_1032489_c1 | |||
| 1169 | nmdc:mga08y16_12365_c1 | |||
| 1170 | nmdc:mga08y16_18447_c1 | |||
| 1171 | nmdc:mga08x19_339220_c1 | |||
| 1172 | nmdc:mga0a205_237416_c1 | |||
| 1173 | nmdc:mga0a205_246108_c1 | |||
| 1174 | nmdc:mga0a205_7972_c1 | |||
| 1175 | Ga0495619_0134260 | |||
| 1176 | Ga0501084_0038348 | |||
| 1177 | Ga0501084_0161318 | |||
| 1178 | Ga0501084_0244887 | |||
| 1179 | Ga0501084_0508918 | |||
| 1180 | Ga0501082_0057564 | |||
| 1181 | Ga0501082_0083637 | |||
| 1182 | Ga0501082_0154985 | |||
| 1183 | Ga0501082_0260023 | |||
| 1184 | Ga0501082_0351263 | |||
| 1185 | Ga0530510_0009774 | |||
| 1186 | Ga0530510_0021196 | |||
| 1187 | Ga0530510_0025725 | |||
| 1188 | Ga0530510_0087356 | |||
| 1189 | Ga0530510_0093670 | |||
| 1190 | Ga0530510_0135890 | |||
| 1191 | Ga0530510_0183481 | |||
| 1192 | Ga0530510_0827199 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pd7-assembly1.cif.gz_A | crocagin methyl transferase cgnl | 0.7744 | 17 | 145 |
| 6wlf-assembly1.cif.gz_A | phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus | 0.7565 | 15 | 148 |
| 5bsz-assembly1.cif.gz_A | x-ray structure of the sugar n-methyltransferase keds8 from streptoalloteichus sp atcc 53650 | 0.741 | 19 | 135 |
| 7wzg-assembly1.cif.gz_F | cypemycin n-terminal methyltransferase cypm | 0.7289 | 15 | 140 |
| 3ege-assembly1.cif.gz_A | crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution | 0.7206 | 13 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A386_35_265_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.806 | 18 | 141 | 3.40.50.150 |
| af_Q80WQ4_26_187_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7998 | 18 | 129 | 3.40.50.150 |
| af_Q18489_32_205_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7888 | 15 | 129 | 3.40.50.150 |
| af_Q8IJC4_363_592_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7801 | 14 | 145 | 3.40.50.150 |
| af_Q54HP2_594_839_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7665 | 83 | 129 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0QM31-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9698 | 50 | 205 |
GO:0008757
GO:0032259 |
| AF-A0A7V8XFN7-F1-model_v4 | Methyltransferase domain-containing protein | 0.9654 | 1 | 205 |
GO:0008757
GO:0032259 |
| AF-A0A538IAH6-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9606 | 1 | 205 |
GO:0008757
GO:0032259 |
| AF-A0A7W0QM31-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9578 | 50 | 205 |
GO:0008757
GO:0032259 |
| AF-A0A538HU48-F1-model_v4 | Methyltransferase domain-containing protein | 0.949 | 1 | 205 |
GO:0008757
GO:0032259 |