F467583

General Info

Members Datasets Scaffolds Average Seq Length
596 518 250 301

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0537965|Ga0436364_0537965_162_1118
Length 318
Sequence LVFNTLNIPKPREEKSMLQVGIFNGYFPYPLEEQAKKIKSIGFNTVQLDLAFKDVDFSTPDSITAAKAKQVRETFRDYNLPICCISGYTNIVHPDPDKRKEKLDYLRALIRNARHFGSPYVISETGTFNPVSDWVSHPQNKTEEGFQECKKVIKELAQLAFDHGAVFLLETYVNNVVGSVEETVRMFAEVDHPGLALLMDPTNYFEAHNIDRMDQVLKQIFDTLAAKIRIAHAKDVKRAGAEKGEKHVDIDASEAHTFRGVGEIELPAPGLGSLNYDYYLERLAEKHPNIPIVIEHLEEADVPRAKKFLDGKLKALGL

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
13 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
16 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
17 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
22 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
23 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
24 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
25 2643221569 Achromobacter sp. Root565 Isolate Unclassified
26 2643221594 Achromobacter sp. Root170 Isolate Unclassified
27 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
28 2643221607 Rhizobium sp. Root73 Isolate Unclassified
29 2643221621 Achromobacter sp. Root83 Isolate Unclassified
30 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
31 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
32 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
33 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
34 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
35 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
36 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
37 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
38 2738541277 Variovorax sp. GV051 Isolate Unclassified
39 2738541293 Rhizobium sp. GV031 Isolate Unclassified
40 2738543019 Variovorax sp. GV040 Isolate Unclassified
41 2751185800 Brucella pituitosa AA2 Isolate Unclassified
42 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
43 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
44 2773857759 Microbacterium sp. 1294 Isolate Unclassified
45 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
46 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
47 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
48 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
49 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
50 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
51 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
52 2808606372 Agromyces sp. 23-23 Isolate Unclassified
53 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
54 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
55 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
56 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
57 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
58 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
59 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
60 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
61 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
62 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
63 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
64 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
65 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
66 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
67 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
68 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
69 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
70 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
71 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
72 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
73 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
74 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
75 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
76 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
77 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
78 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
79 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
80 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
81 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
82 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
83 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
84 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
85 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
86 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
87 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
88 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
89 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
90 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
91 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
92 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
93 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
94 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
95 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
96 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
97 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
98 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
99 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
100 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
101 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
102 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
103 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
104 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
105 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
106 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
107 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
108 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
109 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
110 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
111 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
112 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
113 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
114 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
115 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
116 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
117 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
118 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
119 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
120 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
121 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
122 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
123 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
124 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
125 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
126 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
127 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
128 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
129 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
130 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
131 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
132 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
133 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
134 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
135 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
136 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
137 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
138 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
139 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
140 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
141 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
142 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
143 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
144 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
145 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
146 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
147 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
148 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
149 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
150 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
151 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
152 2909042592 Labrys sp. LIt4 Isolate Nodule
153 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
154 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
155 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
156 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
157 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
158 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
159 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
160 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
161 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
162 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
163 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
164 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
165 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
166 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
167 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
168 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
169 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
170 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
171 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
172 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
173 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
174 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
175 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
176 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
177 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
178 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
179 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
180 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
181 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
182 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
183 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
184 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
185 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
186 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
187 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
188 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
189 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
190 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
191 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
192 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
193 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
194 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
195 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
196 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
197 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
198 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
199 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
200 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
201 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
202 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
203 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
204 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
205 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
206 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
207 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
208 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
209 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
210 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
211 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
212 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
213 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
214 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
215 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
216 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
217 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
218 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
219 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
220 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
221 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
222 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
223 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
224 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
225 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
226 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
227 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
228 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
229 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
230 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
231 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
232 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
233 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
234 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
235 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
236 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
237 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
238 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
239 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
240 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
241 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
242 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
243 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
244 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
245 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
246 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
247 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
248 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
249 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
250 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
251 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
252 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
253 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
254 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
255 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
256 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
257 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
258 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
259 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
260 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
261 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
262 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
263 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
264 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
265 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
266 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
267 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
268 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
269 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
270 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
271 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
272 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
273 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
274 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
275 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
276 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
277 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
278 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
279 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
280 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
281 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
282 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
283 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
284 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
285 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
286 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
287 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
288 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
289 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
290 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
291 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
292 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
293 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
294 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
295 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
296 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
297 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
298 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
299 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
300 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
301 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
302 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
303 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
304 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
305 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
306 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
307 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
308 3004167301 Mesorhizobium loti 582 Isolate Unclassified
309 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
310 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
311 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
312 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
313 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
314 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
315 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
316 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
317 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
318 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
319 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
320 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
321 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
322 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
323 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
324 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
325 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
326 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
327 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
328 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
329 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
330 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
331 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
332 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
333 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
334 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
335 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
336 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
337 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
338 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
339 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
340 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
341 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
342 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
343 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
344 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
345 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
346 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
347 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
348 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
349 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
350 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
351 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
352 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
353 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
354 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
355 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
356 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
357 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
358 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
359 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
360 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
361 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
362 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
363 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
364 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
365 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
366 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
367 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
368 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
369 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
370 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
371 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
372 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
373 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
374 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
375 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
377 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
378 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
380 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
381 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
382 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
384 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
385 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
387 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
388 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
390 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
406 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
407 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
408 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
411 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
412 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
413 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
414 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
415 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
416 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
417 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
418 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
419 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
420 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
421 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
422 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
423 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
424 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
425 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
426 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
427 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
428 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
429 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
430 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
431 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
432 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
433 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
434 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
435 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
436 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
437 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
438 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
439 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
440 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
441 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
442 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
443 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
444 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
445 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
446 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
447 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
448 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
449 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
450 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
452 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
453 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
458 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
465 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
477 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
478 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
479 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
480 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
482 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
483 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
484 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
485 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
486 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
487 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
488 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
489 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
490 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
491 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
492 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
493 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
494 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
495 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
496 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
497 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
498 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
499 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
500 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
501 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
502 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
503 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
504 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
505 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
506 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
507 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
508 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
509 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
510 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
511 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
512 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
513 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
514 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
515 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
516 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
517 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
518 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.95
Metatranscriptomes 0
Isolates 58.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.91
Nodule 47.82
Rhizoplane 1.17
Rhizosphere 23.83
Stem 0
Stem Tuber 0
Unclassified 15.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029009 3300001979 Bacteria 1822
2 JGI25156J39149_1005086 3300002705 Bacteria 3873
3 JGI25157J39369_1000455 3300002741 Bacteria 25895
4 JGI25152J39213_1000133 3300002773 Bacteria 50447
5 JGI25150J39212_1000097 3300002774 Bacteria 50447
6 JGI25159J45721_1000158 3300002987 Bacteria 31947
7 JGI25151J46595_10000143 3300003187 Bacteria 95160
8 JGI25151J46595_10000334 3300003187 Bacteria 50447
9 JGI25151J46595_10002569 3300003187 Bacteria 10754
10 JGI25165J46597_1000015 3300003214 Bacteria 380891
11 JGI25153J46596_10000583 3300003215 Bacteria 22446
12 JGI25160J50197_1000026 3300003354 Bacteria 184693
13 JGI25160J50197_1002298 3300003354 Bacteria 8960
14 JGI25161J50226_1000014 3300003374 Bacteria 191109
15 Ga0055542_1000532 3300003762 Bacteria 33817
16 Ga0055542_1001765 3300003762 Bacteria 9112
17 Ga0055529_1003471 3300003763 Bacteria 2605
18 Ga0055529_1004404 3300003763 Bacteria 2146
19 Ga0055543_1000079 3300004625 Bacteria 84916
20 Ga0065165_1000073 3300005262 Bacteria 164910
21 Ga0065714_10064446 3300005288 Bacteria 88320
22 Ga0065712_10101768 3300005290 Bacteria 2026
23 Ga0065715_10298065 3300005293 Bacteria 1047
24 Ga0070658_10122036 3300005327 Bacteria 2166
25 Ga0070676_10164701 3300005328 Bacteria 1430
26 Ga0070660_100098214 3300005339 Bacteria 2317
27 Ga0070660_100303653 3300005339 Bacteria 1309
28 Ga0070668_100009387 3300005347 Bacteria 7257
29 Ga0070668_100109891 3300005347 Bacteria 2193
30 Ga0070669_100112378 3300005353 Bacteria 2069
31 Ga0070711_100365133 3300005439 Bacteria 1164
32 Ga0070698_100075017 3300005471 Bacteria 3387
33 Ga0068853_100051509 3300005539 Bacteria 3543
34 Ga0068853_100238034 3300005539 Bacteria 1668
35 Ga0070665_100050304 3300005548 Bacteria 4181
36 Ga0070665_100176693 3300005548 Bacteria 2136
37 Ga0068857_100449195 3300005577 Bacteria 1205
38 Ga0068860_100113102 3300005843 Bacteria 2595
39 Ga0081540_1043571 3300005983 Bacteria 2300
40 Ga0081540_1094223 3300005983 Bacteria 1309
41 Ga0075365_10009599 3300006038 Bacteria 5578
42 Ga0075365_10021750 3300006038 Bacteria 4006
43 Ga0075365_10059563 3300006038 Bacteria 2545
44 Ga0075365_10119286 3300006038 Bacteria 1818
45 Ga0075363_100093821 3300006048 Bacteria 1654
46 Ga0075364_10015730 3300006051 Bacteria 4696
47 Ga0075362_10000827 3300006177 Bacteria 9277
48 Ga0075367_10081464 3300006178 Bacteria 1958
49 Ga0075369_10014686 3300006186 Bacteria 3133
50 Ga0075369_10016374 3300006186 Bacteria 2991
51 Ga0075369_10029051 3300006186 Bacteria 2320
52 Ga0075428_100543284 3300006844 Bacteria 1242
53 Ga0079104_1003039 3300006946 Bacteria 8217
54 Ga0105240_10759385 3300009093 Bacteria 1054
55 Ga0105243_10176169 3300009148 Bacteria 1856
56 Ga0105241_10013321 3300009174 Bacteria 6027
57 Ga0105242_10077064 3300009176 Bacteria 2781
58 Ga0105237_10000125 3300009545 Bacteria 107351
59 Ga0105237_10102563 3300009545 Bacteria 2853
60 Ga0105237_10637201 3300009545 Bacteria 1073
61 Ga0105238_10013126 3300009551 Bacteria 8361
62 Ga0105238_10129187 3300009551 Unclassified 2505
63 Ga0105238_10408526 3300009551 Bacteria 1351
64 Ga0105239_10015266 3300010375 Bacteria 8510
65 Ga0105239_10058202 3300010375 Bacteria 4241
66 Ga0105239_10070462 3300010375 Bacteria 3841
67 Ga0157370_10240304 3300013104 Bacteria 1676
68 Ga0157374_10314307 3300013296 Bacteria 1551
69 Ga0157378_10116506 3300013297 Bacteria 2457
70 Ga0182008_10000001 3300014497 Bacteria 540790
71 Ga0182008_10010683 3300014497 Bacteria 4908
72 Ga0182007_10043021 3300015262 Bacteria 1502
73 Ga0213872_10000651 3300021361 Bacteria 26313
74 Ga0228711_1005574 3300022739 Bacteria 19128
75 Ga0228710_1006649 3300022740 Bacteria 17425
76 Ga0209436_106181 3300025208 Bacteria 2653
77 Ga0209563_103720 3300025230 Bacteria 3082
78 Ga0207425_1000186 3300025245 Bacteria 50590
79 Ga0209026_1000025 3300025250 Bacteria 352548
80 Ga0209148_1000037 3300025254 Bacteria 494767
81 Ga0209148_1000233 3300025254 Bacteria 90861
82 Ga0209759_1000226 3300025256 Bacteria 84383
83 Ga0209129_1000165 3300025258 Bacteria 98917
84 Ga0209233_1000010 3300025261 Bacteria 1194329
85 Ga0209233_1026784 3300025261 Bacteria 1404
86 Ga0209455_1000036 3300025272 Bacteria 473309
87 Ga0209455_1000062 3300025272 Bacteria 335169
88 Ga0209673_1040200 3300025273 Bacteria 1340
89 Ga0209130_1000160 3300025284 Bacteria 100965
90 Ga0209130_1000219 3300025284 Bacteria 74906
91 Ga0209676_1011045 3300025292 Bacteria 3688
92 Ga0209025_1000079 3300025294 Bacteria 270973
93 Ga0209025_1000362 3300025294 Bacteria 96826
94 Ga0209025_1002435 3300025294 Bacteria 19728
95 Ga0209758_1000685 3300025297 Bacteria 50499
96 Ga0209758_1006651 3300025297 Bacteria 8179
97 Ga0209758_1022356 3300025297 Bacteria 2904
98 Ga0209050_1002036 3300025298 Bacteria 18705
99 Ga0207426_1000075 3300025302 Bacteria 321337
100 Ga0207426_1000098 3300025302 Bacteria 264264
101 Ga0207688_10226661 3300025901 Bacteria 1127
102 Ga0207647_10009585 3300025904 Bacteria 6874
103 Ga0207645_10010175 3300025907 Bacteria 6465
104 Ga0207654_10010522 3300025911 Bacteria 4711
105 Ga0207695_10083142 3300025913 Bacteria 3234
106 Ga0207671_10000112 3300025914 Bacteria 125310
107 Ga0207671_10015395 3300025914 Bacteria 5989
108 Ga0207663_10129969 3300025916 Bacteria 1739
109 Ga0207657_10093082 3300025919 Bacteria 2511
110 Ga0207657_10098874 3300025919 Bacteria 2424
111 Ga0207694_10008336 3300025924 Bacteria 7836
112 Ga0207691_10252801 3300025940 Bacteria 1521
113 Ga0207658_10632096 3300025986 Bacteria 964
114 Ga0207639_10004211 3300026041 Bacteria 9695
115 Ga0207702_10527941 3300026078 Bacteria 1153
116 Ga0207674_10175626 3300026116 Bacteria 2094
117 Ga0207698_10200082 3300026142 Bacteria 1788
118 Ga0209281_1001012 3300027111 Bacteria 21997
119 Ga0209281_1001545 3300027111 Bacteria 12743
120 Ga0209371_1025348 3300027312 Bacteria 1364
121 Ga0209282_1000296 3300027666 Bacteria 24574
122 Ga0268266_10043519 3300028379 Bacteria 3838
123 Ga0268266_10262133 3300028379 Bacteria 1602
124 Ga0268264_10136347 3300028381 Bacteria 2182
125 Ga0307515_10001908 3300028794 Bacteria 46296
126 Ga0307408_100062839 3300031548 Bacteria 2715
127 Ga0265313_10014006 3300031595 Bacteria 4774
128 Ga0307508_10000005 3300031616 Bacteria 286511
129 Ga0307514_10182031 3300031649 Bacteria 1353
130 Ga0307410_10267939 3300031852 Bacteria 1335
131 Ga0307406_10214332 3300031901 Bacteria 1427
132 Ga0307412_10000118 3300031911 Bacteria 60701
133 Ga0307412_10036177 3300031911 Bacteria 3160
134 Ga0307412_10337623 3300031911 Bacteria 1205
135 Ga0307409_100287892 3300031995 Bacteria 1522
136 Ga0307411_10080646 3300032005 Bacteria 2238
137 Ga0307411_10114731 3300032005 Bacteria 1936
138 Ga0315913_1000879 3300033430 Bacteria 30055
139 Ga0315915_1000436 3300033464 Bacteria 42125
140 Ga0316574_0348149 3300035398 Bacteria 938
141 Ga0395900_0082212 3300037418 Bacteria 3309
142 Ga0395900_0360901 3300037418 Bacteria 1424
143 Ga0395898_0027702 3300037466 Bacteria 5683
144 Ga0395905_0001090 3300037471 Bacteria 34130
145 Ga0395905_0004612 3300037471 Bacteria 14261
146 Ga0395905_0295975 3300037471 Bacteria 1505
147 Ga0436364_0168878 3300037853 Bacteria 3152
148 Ga0436364_0399177 3300037853 Bacteria 1421
149 Ga0436364_0537965 3300037853 Unclassified 1276
150 Ga0395901_0009893 3300038443 Bacteria 9667
151 Ga0395901_0058583 3300038443 Bacteria 4006
152 Ga0436365_0099515 3300039437 Bacteria 4266
153 Ga0436365_0249340 3300039437 Bacteria 8154
154 Ga0436365_0398577 3300039437 Bacteria 2912
155 Ga0436365_0518804 3300039437 Bacteria 1439
156 Ga0436363_0670840 3300039450 Bacteria 4841
157 Ga0436363_1435275 3300039450 Bacteria 3027
158 Ga0439465_0010933 3300041413 Bacteria 2848
159 Ga0439450_045474 3300042008 Bacteria 1031
160 Ga0439460_0042636 3300042461 Bacteria 1338
161 Ga0466972_0029598 3300044658 Bacteria 2696
162 Ga0466961_0132117 3300044693 Bacteria 1564
163 Ga0453684_0698365 3300044712 Bacteria 1103
164 Ga0466959_0018824 3300045049 Bacteria 5073
165 Ga0495603_0133073 3300046455 Bacteria 1448
166 Ga0495605_0145825 3300046474 Bacteria 1059
167 Ga0495606_0085245 3300046507 Bacteria 1954
168 Ga0495610_0015471 3300046512 Bacteria 4431
169 Ga0495616_0001511 3300046513 Bacteria 16058
170 Ga0495620_0046257 3300046515 Bacteria 1880
171 Ga0495637_0033281 3300046520 Bacteria 2265
172 Ga0495597_0072724 3300046542 Bacteria 1479
173 Ga0495625_0009794 3300046660 Bacteria 7973
174 Ga0495625_0095766 3300046660 Bacteria 2045
175 Ga0495649_0202374 3300046694 Bacteria 1031
176 Ga0495686_0020559 3300047472 Bacteria 4400
177 Ga0495686_0030357 3300047472 Bacteria 3511
178 Ga0495626_0027690 3300048091 Bacteria 2754
179 Ga0496101_0017056 3300048904 Bacteria 4917
180 Ga0496109_0207432 3300048912 Bacteria 1843
181 Ga0496112_0298352 3300048915 Bacteria 1557
182 Ga0496114_0501900 3300048917 Bacteria 1073
183 Ga0496115_0162015 3300048918 Bacteria 1849
184 Ga0496116_0002699 3300048919 Bacteria 18297
185 Ga0496116_0077486 3300048919 Bacteria 2076
186 Ga0496116_0105072 3300048919 Bacteria 1676
187 Ga0496117_0066325 3300048920 Bacteria 2449
188 Ga0496118_0080856 3300048921 Bacteria 2285
189 Ga0496118_0102332 3300048921 Bacteria 1931
190 Ga0496119_0110831 3300048922 Bacteria 1524
191 Ga0496120_0002324 3300048923 Bacteria 19584
192 Ga0496120_0073780 3300048923 Bacteria 1866
193 Ga0496120_0185592 3300048923 Bacteria 1018
194 Ga0496121_0000094 3300048924 Bacteria 212726
195 Ga0496121_0012904 3300048924 Bacteria 9034
196 Ga0496121_0037347 3300048924 Bacteria 4316
197 Ga0496122_0000115 3300048925 Bacteria 183402
198 Ga0496122_0101364 3300048925 Bacteria 1923
199 Ga0496123_0000129 3300048926 Bacteria 153816
200 Ga0496123_0106651 3300048926 Bacteria 1613
201 Ga0496123_0139666 3300048926 Bacteria 1327
202 Ga0496125_0002647 3300048928 Bacteria 22880
203 Ga0496125_0007911 3300048928 Bacteria 11225
204 Ga0496125_0015143 3300048928 Bacteria 7473
205 Ga0496125_0097661 3300048928 Bacteria 2176
206 Ga0496125_0101246 3300048928 Bacteria 2121
207 Ga0496125_0138776 3300048928 Bacteria 1694
208 Ga0496126_0066029 3300048929 Bacteria 3236
209 Ga0496126_0134567 3300048929 Bacteria 2133
210 Ga0496126_0352677 3300048929 Bacteria 1203
211 Ga0495678_009223 3300049459 Bacteria 4905
212 Ga0501031_0019207 3300049568 Bacteria 4449
213 Ga0501032_0089869 3300049569 Bacteria 2038
214 Ga0501033_0104327 3300049570 Bacteria 2066
215 Ga0501033_0138740 3300049570 Bacteria 1758
216 Ga0501034_0059185 3300049571 Bacteria 3848
217 Ga0501036_0148991 3300049572 Bacteria 1973
218 Ga0501037_0051430 3300049573 Bacteria 3013
219 Ga0501038_0106544 3300049574 Bacteria 2326
220 Ga0501039_0075262 3300049575 Bacteria 2624
221 Ga0501043_0041749 3300049579 Bacteria 3603
222 Ga0501046_0001581 3300049580 Bacteria 21776
223 Ga0501047_0086413 3300049581 Bacteria 3013
224 Ga0501070_0071672 3300049586 Bacteria 2869
225 Ga0501073_0001496 3300049589 Bacteria 17294
226 Ga0501080_0046966 3300049742 Bacteria 4019
227 Ga0501080_0095045 3300049742 Bacteria 2768
228 Ga0501083_0024864 3300049744 Bacteria 4148
229 Ga0501035_0121622 3300049822 Bacteria 2281
230 Ga0501044_0153732 3300049823 Bacteria 2281
231 nmdc:mga03683_2860_c1 3300050489 Bacteria 4985
232 nmdc:mga00v17_22373_c1 3300050491 Bacteria 3647
233 nmdc:mga00v17_35760_c1 3300050491 Bacteria 2958
234 nmdc:mga00v17_6326_c1 3300050491 Bacteria 6277
235 nmdc:mga0yw44_216500_c1 3300050492 Bacteria 1268
236 nmdc:mga0yw44_37113_c1 3300050492 Bacteria 2876
237 nmdc:mga0k408_84977_c1 3300050493 Bacteria 1857
238 nmdc:mga07m45_70184_c1 3300050496 Bacteria 1993
239 nmdc:mga0sz30_1726_c1 3300050516 Bacteria 6568
240 nmdc:mga0sz30_86724_c1 3300050516 Bacteria 1359
241 Ga0500644_0001691 3300053088 Bacteria 5752
242 Ga0500658_0017990 3300053134 Bacteria 2645
243 Ga0500658_0070135 3300053134 Bacteria 1477
244 Ga0500559_0000405 3300053136 Bacteria 31024
245 Ga0500559_0001297 3300053136 Bacteria 14433
246 Ga0500568_0000361 3300053139 Bacteria 35246
247 Ga0500616_0000010 3300053153 Bacteria 761410
248 Ga0500620_000018 3300053155 Bacteria 33396
249 Ga0500622_0000159 3300053156 Bacteria 71047
250 Ga0500611_005533 3300053727 Bacteria 1784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0095766 Ga0495625_0095766_32_823 263
2 3300035398 Ga0316574_0348149 Ga0316574_0348149_13_813 266
3 iso_pu_bacteria 2937868953 2937869489 283
4 3300003187 JGI25151J46595_10000143 JGI25151J46595_1000014312 290
5 3300003354 JGI25160J50197_1002298 JGI25160J50197_10022986 290
6 3300005983 Ga0081540_1094223 Ga0081540_10942231 290
7 3300025284 Ga0209130_1000160 Ga0209130_100016080 290
8 3300025294 Ga0209025_1002435 Ga0209025_100243511 290
9 3300025297 Ga0209758_1006651 Ga0209758_10066514 290
10 3300025302 Ga0207426_1000098 Ga0207426_100009884 290
11 3300046694 Ga0495649_0202374 Ga0495649_0202374_11_916 290
12 3300049742 Ga0501080_0095045 Ga0501080_0095045_1296_2201 290
13 3300025986 Ga0207658_10632096 Ga0207658_106320961 291
14 iso_pu_bacteria 2738541277 2738721102 297
15 iso_pu_bacteria 2738543019 2739280301 297
16 iso_pu_bacteria 2821443989 2821450887 297
17 iso_pu_bacteria 2883291878 2883293746 297
18 iso_pu_bacteria 2883354860 2883357717 297
19 iso_pu_bacteria 2904541872 2904547640 297
20 iso_pu_bacteria 2929160207 2929167119 297
21 iso_pu_bacteria 2857576091 2857579472 298
22 iso_pu_bacteria 2869234852 2869239293 299
23 iso_pu_bacteria 2869242130 2869248454 299
24 iso_pu_bacteria 2874109183 2874115708 299
25 iso_pu_bacteria 2903513507 2903515862 299
26 iso_pu_bacteria 2906427513 2906432626 299
27 iso_pu_bacteria 2916061851 2916066741 299
28 iso_pu_bacteria 2921250672 2921254810 299
29 3300049575 Ga0501039_0075262 Ga0501039_0075262_278_1255 300
30 iso_pu_bacteria 2503198000 2503201436 300
31 iso_pu_bacteria 2508501123 2509113034 300
32 iso_pu_bacteria 2508501127 2509143980 300
33 iso_pu_bacteria 2509276018 2509367926 300
34 iso_pu_bacteria 2509276022 2509396208 300
35 iso_pu_bacteria 2510065057 2510304793 300
36 iso_pu_bacteria 2510065059 2510315608 300
37 iso_pu_bacteria 2512875016 2512931591 300
38 iso_pu_bacteria 2512875024 2512959429 300
39 iso_pu_bacteria 2512875026 2512975370 300
40 iso_pu_bacteria 2513237089 2513605680 300
41 iso_pu_bacteria 2513237090 2513611383 300
42 iso_pu_bacteria 2513237091 2513616011 300
43 iso_pu_bacteria 2513237160 2514008624 300
44 iso_pu_bacteria 2513237164 2514033514 300
45 iso_pu_bacteria 2513237305 2514419662 300
46 iso_pu_bacteria 2513237351 2514588015 300
47 iso_pu_bacteria 2515154107 2515610122 300
48 iso_pu_bacteria 2516653046 2516898073 300
49 iso_pu_bacteria 2517487022 2517566977 300
50 iso_pu_bacteria 2551306091 2551725805 300
51 iso_pu_bacteria 2588253730 2588517437 300
52 iso_pu_bacteria 2599185292 2599904306 300
53 iso_pu_bacteria 2599185301 2599936840 300
54 iso_pu_bacteria 2643221569 2643859462 300
55 iso_pu_bacteria 2643221594 2643982954 300
56 iso_pu_bacteria 2643221595 2643986892 300
57 iso_pu_bacteria 2643221607 2644048076 300
58 iso_pu_bacteria 2643221621 2644123662 300
59 iso_pu_bacteria 2643221627 2644156265 300
60 iso_pu_bacteria 2643221636 2644200332 300
61 iso_pu_bacteria 2643221686 2644480871 300
62 iso_pu_bacteria 2643221689 2644502038 300
63 iso_pu_bacteria 2687453392 2688598345 300
64 iso_pu_bacteria 2693429783 2694630986 300
65 iso_pu_bacteria 2693429784 2694636516 300
66 iso_pu_bacteria 2721755686 2723575294 300
67 iso_pu_bacteria 2738541293 2738805639 300
68 iso_pu_bacteria 2751185800 2753357085 300
69 iso_pu_bacteria 2756170246 2756672502 300
70 iso_pu_bacteria 2758568016 2758639371 300
71 iso_pu_bacteria 2773857759 2774382213 300
72 iso_pu_bacteria 2791355123 2792752698 300
73 iso_pu_bacteria 2802428858 2802721170 300
74 iso_pu_bacteria 2802428859 2802728384 300
75 iso_pu_bacteria 2802428860 2802733852 300
76 iso_pu_bacteria 2802428861 2802740508 300
77 iso_pu_bacteria 2802428862 2802746791 300
78 iso_pu_bacteria 2802428863 2802753648 300
79 iso_pu_bacteria 2808606372 2808903588 300
80 iso_pu_bacteria 2808606395 2809033541 300
81 iso_pu_bacteria 2837651117 2837654039 300
82 iso_pu_bacteria 2841734538 2841739102 300
83 iso_pu_bacteria 2844002411 2844007536 300
84 iso_pu_bacteria 2844009547 2844013598 300
85 iso_pu_bacteria 2844852863 2844853365 300
86 iso_pu_bacteria 2847686936 2847692180 300
87 iso_pu_bacteria 2852387548 2852395196 300
88 iso_pu_bacteria 2852677369 2852678288 300
89 iso_pu_bacteria 2856320880 2856327582 300
90 iso_pu_bacteria 2856328259 2856334463 300
91 iso_pu_bacteria 2856334872 2856338929 300
92 iso_pu_bacteria 2856342000 2856343935 300
93 iso_pu_bacteria 2856364286 2856369377 300
94 iso_pu_bacteria 2857349434 2857351240 300
95 iso_pu_bacteria 2857367948 2857370889 300
96 iso_pu_bacteria 2869169390 2869169868 300
97 iso_pu_bacteria 2869249662 2869255574 300
98 iso_pu_bacteria 2869256925 2869257872 300
99 iso_pu_bacteria 2869264136 2869268028 300
100 iso_pu_bacteria 2869271264 2869276901 300
101 iso_pu_bacteria 2869278585 2869280471 300
102 iso_pu_bacteria 2869285874 2869286550 300
103 iso_pu_bacteria 2871429161 2871434703 300
104 iso_pu_bacteria 2871435913 2871436410 300
105 iso_pu_bacteria 2871444079 2871448020 300
106 iso_pu_bacteria 2871451962 2871456361 300
107 iso_pu_bacteria 2871459585 2871464214 300
108 iso_pu_bacteria 2871466892 2871468550 300
109 iso_pu_bacteria 2871474448 2871480688 300
110 iso_pu_bacteria 2871481445 2871485556 300
111 iso_pu_bacteria 2871495908 2871496595 300
112 iso_pu_bacteria 2874102143 2874103571 300
113 iso_pu_bacteria 2874116593 2874119570 300
114 iso_pu_bacteria 2874123672 2874130514 300
115 iso_pu_bacteria 2874131515 2874135634 300
116 iso_pu_bacteria 2874139085 2874144117 300
117 iso_pu_bacteria 2874146452 2874149908 300
118 iso_pu_bacteria 2874155637 2874158166 300
119 iso_pu_bacteria 2874162495 2874163622 300
120 iso_pu_bacteria 2874168670 2874169758 300
121 iso_pu_bacteria 2876363079 2876368572 300
122 iso_pu_bacteria 2876369609 2876370265 300
123 iso_pu_bacteria 2876377896 2876382188 300
124 iso_pu_bacteria 2876386047 2876391866 300
125 iso_pu_bacteria 2876392853 2876398355 300
126 iso_pu_bacteria 2876399893 2876403627 300
127 iso_pu_bacteria 2876406927 2876409328 300
128 iso_pu_bacteria 2876413966 2876416370 300
129 iso_pu_bacteria 2876420981 2876425548 300
130 iso_pu_bacteria 2878730984 2878736606 300
131 iso_pu_bacteria 2878738818 2878745112 300
132 iso_pu_bacteria 2878745973 2878751836 300
133 iso_pu_bacteria 2878760144 2878760822 300
134 iso_pu_bacteria 2878767105 2878767785 300
135 iso_pu_bacteria 2878774303 2878775725 300
136 iso_pu_bacteria 2878781027 2878782099 300
137 iso_pu_bacteria 2878788777 2878795706 300
138 iso_pu_bacteria 2881147464 2881151234 300
139 iso_pu_bacteria 2881161766 2881167444 300
140 iso_pu_bacteria 2882632389 2882636188 300
141 iso_pu_bacteria 2885305155 2885309341 300
142 iso_pu_bacteria 2885312484 2885318071 300
143 iso_pu_bacteria 2885326080 2885328282 300
144 iso_pu_bacteria 2888337043 2888339326 300
145 iso_pu_bacteria 2888343758 2888346710 300
146 iso_pu_bacteria 2888350351 2888355670 300
147 iso_pu_bacteria 2889010040 2889010608 300
148 iso_pu_bacteria 2889016732 2889017693 300
149 iso_pu_bacteria 2889790730 2889792420 300
150 iso_pu_bacteria 2894817345 2894818263 300
151 iso_pu_bacteria 2903448605 2903451222 300
152 iso_pu_bacteria 2903492973 2903504782 300
153 iso_pu_bacteria 2903521522 2903527571 300
154 iso_pu_bacteria 2903528002 2903534025 300
155 iso_pu_bacteria 2903540706 2903541393 300
156 iso_pu_bacteria 2904659560 2904664910 300
157 iso_pu_bacteria 2905926851 2905930550 300
158 iso_pu_bacteria 2906308376 2906314234 300
159 iso_pu_bacteria 2906321335 2906327400 300
160 iso_pu_bacteria 2906328253 2906330084 300
161 iso_pu_bacteria 2906354277 2906357219 300
162 iso_pu_bacteria 2906363423 2906363644 300
163 iso_pu_bacteria 2906370794 2906373174 300
164 iso_pu_bacteria 2906378014 2906383784 300
165 iso_pu_bacteria 2906386501 2906389851 300
166 iso_pu_bacteria 2906393657 2906397038 300
167 iso_pu_bacteria 2906401398 2906403060 300
168 iso_pu_bacteria 2906408224 2906412465 300
169 iso_pu_bacteria 2909042592 2909046139 300
170 iso_pu_bacteria 2915650412 2915654433 300
171 iso_pu_bacteria 2915980308 2915983421 300
172 iso_pu_bacteria 2916021584 2916025630 300
173 iso_pu_bacteria 2916041962 2916043202 300
174 iso_pu_bacteria 2916048683 2916049387 300
175 iso_pu_bacteria 2916076590 2916076608 300
176 iso_pu_bacteria 2921257292 2921259668 300
177 iso_pu_bacteria 2922130491 2922135612 300
178 iso_pu_bacteria 2922151315 2922157822 300
179 iso_pu_bacteria 2922158528 2922161436 300
180 iso_pu_bacteria 2922172374 2922175335 300
181 iso_pu_bacteria 2922185730 2922192479 300
182 iso_pu_bacteria 2924726620 2924726757 300
183 iso_pu_bacteria 2924733363 2924735835 300
184 iso_pu_bacteria 2924741084 2924742239 300
185 iso_pu_bacteria 2924748358 2924749383 300
186 iso_pu_bacteria 2924754689 2924762580 300
187 iso_pu_bacteria 2924762789 2924765026 300
188 iso_pu_bacteria 2924762789 2924768280 300
189 iso_pu_bacteria 2924776078 2924783249 300
190 iso_pu_bacteria 2936996657 2936999496 300
191 iso_pu_bacteria 2937009748 2937012316 300
192 iso_pu_bacteria 2937023124 2937026254 300
193 iso_pu_bacteria 2937029754 2937032180 300
194 iso_pu_bacteria 2937036028 2937039530 300
195 iso_pu_bacteria 2937078374 2937081877 300
196 iso_pu_bacteria 2937084907 2937088360 300
197 iso_pu_bacteria 2937813078 2937815656 300
198 iso_pu_bacteria 2937822353 2937824359 300
199 iso_pu_bacteria 2937836603 2937843146 300
200 iso_pu_bacteria 2937848649 2937853457 300
201 iso_pu_bacteria 2937861824 2937861836 300
202 iso_pu_bacteria 2937877337 2937882224 300
203 iso_pu_bacteria 2937891427 2937894010 300
204 iso_pu_bacteria 2937972304 2937978685 300
205 iso_pu_bacteria 2937980651 2937987375 300
206 iso_pu_bacteria 2937994558 2937995249 300
207 iso_pu_bacteria 2938014810 2938021277 300
208 iso_pu_bacteria 2939660829 2939664360 300
209 iso_pu_bacteria 2939669807 2939671050 300
210 iso_pu_bacteria 2941479691 2941484512 300
211 iso_pu_bacteria 2946003308 2946006690 300
212 iso_pu_bacteria 2957375807 2957380364 300
213 iso_pu_bacteria 2957382221 2957384049 300
214 iso_pu_bacteria 2957395598 2957399671 300
215 iso_pu_bacteria 2957402308 2957405390 300
216 iso_pu_bacteria 2957408893 2957412747 300
217 iso_pu_bacteria 2957437181 2957443743 300
218 iso_pu_bacteria 2957450854 2957454142 300
219 iso_pu_bacteria 2958034702 2958036342 300
220 iso_pu_bacteria 2958041894 2958045705 300
221 iso_pu_bacteria 2958064165 2958064470 300
222 iso_pu_bacteria 2958071322 2958072027 300
223 iso_pu_bacteria 2958084443 2958089346 300
224 iso_pu_bacteria 2958092219 2958099700 300
225 iso_pu_bacteria 2958100919 2958107298 300
226 iso_pu_bacteria 2958108152 2958109259 300
227 iso_pu_bacteria 2958115193 2958118383 300
228 iso_pu_bacteria 2958122699 2958123734 300
229 iso_pu_bacteria 2958130278 2958130953 300
230 iso_pu_bacteria 2958137437 2958139212 300
231 iso_pu_bacteria 2958144490 2958147441 300
232 iso_pu_bacteria 2958158011 2958165015 300
233 iso_pu_bacteria 2958165035 2958165725 300
234 iso_pu_bacteria 2958172287 2958172370 300
235 iso_pu_bacteria 2958179912 2958184874 300
236 iso_pu_bacteria 2960591022 2960592989 300
237 iso_pu_bacteria 2960610863 2960611538 300
238 iso_pu_bacteria 2960631154 2960633566 300
239 iso_pu_bacteria 2960680706 2960683915 300
240 iso_pu_bacteria 2960687367 2960691277 300
241 iso_pu_bacteria 2960693952 2960698491 300
242 iso_pu_bacteria 2961077736 2961083041 300
243 iso_pu_bacteria 2961114664 2961119909 300
244 iso_pu_bacteria 2961136820 2961143029 300
245 iso_pu_bacteria 2961163497 2961164184 300
246 iso_pu_bacteria 2961183825 2961185154 300
247 iso_pu_bacteria 2963644680 2963647621 300
248 iso_pu_bacteria 2964615318 2964617693 300
249 iso_pu_bacteria 2964636051 2964638703 300
250 iso_pu_bacteria 2964698721 2964701115 300
251 iso_pu_bacteria 2965018300 2965019173 300
252 iso_pu_bacteria 2965025482 2965031856 300
253 iso_pu_bacteria 2965032056 2965038017 300
254 iso_pu_bacteria 2965040258 2965046045 300
255 iso_pu_bacteria 2965047637 2965053885 300
256 iso_pu_bacteria 2965062239 2965064170 300
257 iso_pu_bacteria 2965089291 2965095032 300
258 iso_pu_bacteria 2965102966 2965110968 300
259 iso_pu_bacteria 2965110997 2965112931 300
260 iso_pu_bacteria 2965119406 2965122312 300
261 iso_pu_bacteria 2967686174 2967691106 300
262 iso_pu_bacteria 2967728569 2967731902 300
263 iso_pu_bacteria 2967755722 2967756844 300
264 iso_pu_bacteria 2968016561 2968018552 300
265 iso_pu_bacteria 2968083720 2968090252 300
266 iso_pu_bacteria 2968091066 2968096289 300
267 iso_pu_bacteria 2968097103 2968098790 300
268 iso_pu_bacteria 2968110612 2968116266 300
269 iso_pu_bacteria 2968117919 2968119866 300
270 iso_pu_bacteria 2968128360 2968129813 300
271 iso_pu_bacteria 2968138860 2968145823 300
272 iso_pu_bacteria 2968171901 2968172584 300
273 iso_pu_bacteria 2970026789 2970033154 300
274 iso_pu_bacteria 2970102677 2970106304 300
275 iso_pu_bacteria 2970122695 2970127970 300
276 iso_pu_bacteria 2970143518 2970147923 300
277 iso_pu_bacteria 2970177841 2970183548 300
278 iso_pu_bacteria 2970469710 2970471275 300
279 iso_pu_bacteria 2970489779 2970492983 300
280 iso_pu_bacteria 2970510686 2970516367 300
281 iso_pu_bacteria 2970524798 2970528494 300
282 iso_pu_bacteria 2970532167 2970532202 300
283 iso_pu_bacteria 2970540015 2970546819 300
284 iso_pu_bacteria 2970547951 2970548904 300
285 iso_pu_bacteria 2970554993 2970555677 300
286 iso_pu_bacteria 2970593180 2970595068 300
287 iso_pu_bacteria 2970619444 2970620283 300
288 iso_pu_bacteria 2970627176 2970627781 300
289 iso_pu_bacteria 2977516862 2977517510 300
290 iso_pu_bacteria 2977530762 2977536543 300
291 iso_pu_bacteria 2977544691 2977550964 300
292 iso_pu_bacteria 2977565890 2977567783 300
293 iso_pu_bacteria 2977843712 2977845892 300
294 iso_pu_bacteria 2977851361 2977851904 300
295 iso_pu_bacteria 2977864932 2977867169 300
296 iso_pu_bacteria 2977872689 2977879788 300
297 iso_pu_bacteria 2977907340 2977909681 300
298 iso_pu_bacteria 2977915119 2977915518 300
299 iso_pu_bacteria 2977922695 2977924124 300
300 iso_pu_bacteria 2977935797 2977936117 300
301 iso_pu_bacteria 2977942078 2977942664 300
302 iso_pu_bacteria 2977950692 2977955447 300
303 iso_pu_bacteria 2977957713 2977958250 300
304 iso_pu_bacteria 2977971508 2977972482 300
305 iso_pu_bacteria 2977986579 2977988781 300
306 iso_pu_bacteria 2979710463 2979711241 300
307 iso_pu_bacteria 2979764755 2979766722 300
308 iso_pu_bacteria 2979772303 2979777758 300
309 iso_pu_bacteria 2979779861 2979785570 300
310 iso_pu_bacteria 2979793036 2979800597 300
311 iso_pu_bacteria 2987636660 2987638424 300
312 iso_pu_bacteria 2987645492 2987650581 300
313 iso_pu_bacteria 2987652177 2987654628 300
314 iso_pu_bacteria 2987659509 2987660190 300
315 iso_pu_bacteria 2987666974 2987667932 300
316 iso_pu_bacteria 2987666974 2987671301 300
317 iso_pu_bacteria 2987673487 2987679052 300
318 iso_pu_bacteria 2989771324 2989772968 300
319 iso_pu_bacteria 2996310559 2996315019 300
320 iso_pu_bacteria 2996341866 2996346167 300
321 iso_pu_bacteria 2996348954 2996350066 300
322 iso_pu_bacteria 2996386984 2996391382 300
323 iso_pu_bacteria 3000135777 3000140766 300
324 iso_pu_bacteria 3004167301 3004168794 300
325 iso_pu_bacteria 3004188549 3004189239 300
326 iso_pu_bacteria 3004195979 3004202367 300
327 iso_pu_bacteria 3004203850 3004205332 300
328 iso_pu_bacteria 3004211236 3004215859 300
329 iso_pu_bacteria 3004218560 3004220234 300
330 iso_pu_bacteria 3004232784 3004233835 300
331 iso_pu_bacteria 3004239961 3004243091 300
332 iso_pu_bacteria 3004248173 3004250217 300
333 iso_pu_bacteria 3004268573 3004274835 300
334 iso_pu_bacteria 3004275668 3004276765 300
335 iso_pu_bacteria 3004289098 3004290141 300
336 iso_pu_bacteria 3004334049 3004334462 300
337 iso_pu_bacteria 637000159 637074696 300
338 iso_pu_bacteria 648276728 648736257 300
339 iso_pu_bacteria 649633066 649872875 300
340 iso_pu_bacteria 8003992118 8003998617 300
341 iso_pu_bacteria 8003999396 8004005552 300
342 iso_pu_bacteria 8004300914 8004303868 300
343 iso_pu_bacteria 8004312739 8004316092 300
344 iso_pu_bacteria 8004361976 8004366106 300
345 iso_pu_bacteria 8004387939 8004393724 300
346 iso_pu_bacteria 8004395343 8004402923 300
347 iso_pu_bacteria 8004445564 8004447447 300
348 iso_pu_bacteria 8004633249 8004637803 300
349 iso_pu_bacteria 8004640170 8004640917 300
350 iso_pu_bacteria 8004695233 8004699976 300
351 iso_pu_bacteria 8004703790 8004709285 300
352 iso_pu_bacteria 8004714634 8004720492 300
353 iso_pu_bacteria 8004727605 8004732812 300
354 iso_pu_bacteria 8024486573 8024487310 300
355 iso_pu_bacteria 8055034563 8055035385 300
356 iso_pu_bacteria 8055037949 8055040114 300
357 iso_pu_bacteria 8055617313 8055620683 300
358 iso_pu_bacteria 8056037122 8056038653 300
359 iso_pu_bacteria 8057575449 8057576469 300
360 3300003187 JGI25151J46595_10002569 JGI25151J46595_100025697 301
361 3300005288 Ga0065714_10064446 Ga0065714_1006444651 301
362 3300005548 Ga0070665_100176693 Ga0070665_1001766932 301
363 3300006051 Ga0075364_10015730 Ga0075364_100157302 301
364 3300009174 Ga0105241_10013321 Ga0105241_100133214 301
365 3300009545 Ga0105237_10000125 Ga0105237_1000012556 301
366 3300009545 Ga0105237_10102563 Ga0105237_101025631 301
367 3300009551 Ga0105238_10129187 Ga0105238_101291872 301
368 3300014497 Ga0182008_10000001 Ga0182008_10000001305 301
369 3300021361 Ga0213872_10000651 Ga0213872_1000065110 301
370 3300025294 Ga0209025_1000079 Ga0209025_1000079139 301
371 3300025911 Ga0207654_10010522 Ga0207654_100105224 301
372 3300025914 Ga0207671_10000112 Ga0207671_1000011271 301
373 3300026078 Ga0207702_10527941 Ga0207702_105279411 301
374 3300031595 Ga0265313_10014006 Ga0265313_100140063 301
375 3300032005 Ga0307411_10080646 Ga0307411_100806462 301
376 3300037853 Ga0436364_0168878 Ga0436364_0168878_34_942 301
377 3300037853 Ga0436364_0399177 Ga0436364_0399177_231_1139 301
378 3300037853 Ga0436364_0537965 Ga0436364_0537965_162_1118 301
379 3300039437 Ga0436365_0099515 Ga0436365_0099515_290_1198 301
380 3300039437 Ga0436365_0249340 Ga0436365_0249340_1499_2404 301
381 3300039437 Ga0436365_0398577 Ga0436365_0398577_113_1018 301
382 3300039437 Ga0436365_0518804 Ga0436365_0518804_21_929 301
383 3300039450 Ga0436363_0670840 Ga0436363_0670840_492_1448 301
384 3300044712 Ga0453684_0698365 Ga0453684_0698365_175_1080 301
385 3300046513 Ga0495616_0001511 Ga0495616_0001511_3781_4686 301
386 3300047472 Ga0495686_0020559 Ga0495686_0020559_1171_2082 301
387 3300048904 Ga0496101_0017056 Ga0496101_0017056_3475_4386 301
388 3300048928 Ga0496125_0002647 Ga0496125_0002647_4029_4940 301
389 3300049459 Ga0495678_009223 Ga0495678_009223_2571_3476 301
390 3300049744 Ga0501083_0024864 Ga0501083_0024864_2855_3763 301
391 3300050491 nmdc:mga00v17_22373_c1 nmdc:mga00v17_22373_c1_857_1768 301
392 3300025913 Ga0207695_10083142 Ga0207695_100831423 303
393 3300031616 Ga0307508_10000005 Ga0307508_10000005133 303
394 3300046660 Ga0495625_0009794 Ga0495625_0009794_2299_3210 303
395 3300048923 Ga0496120_0073780 Ga0496120_0073780_871_1782 303
396 3300048928 Ga0496125_0097661 Ga0496125_0097661_638_1549 303
397 3300049570 Ga0501033_0138740 Ga0501033_0138740_569_1480 303
398 3300050491 nmdc:mga00v17_35760_c1 nmdc:mga00v17_35760_c1_1439_2350 303
399 3300050492 nmdc:mga0yw44_37113_c1 nmdc:mga0yw44_37113_c1_1611_2522 303
400 3300053134 Ga0500658_0070135 Ga0500658_0070135_12_923 303
401 3300053139 Ga0500568_0000361 Ga0500568_0000361_22271_23182 303
402 3300053155 Ga0500620_000018 Ga0500620_000018_13935_14846 303
403 3300001979 JGI24740J21852_10029009 JGI24740J21852_100290091 304
404 3300002705 JGI25156J39149_1005086 JGI25156J39149_10050864 304
405 3300002741 JGI25157J39369_1000455 JGI25157J39369_100045510 304
406 3300002773 JGI25152J39213_1000133 JGI25152J39213_100013315 304
407 3300002774 JGI25150J39212_1000097 JGI25150J39212_100009715 304
408 3300002987 JGI25159J45721_1000158 JGI25159J45721_10001583 304
409 3300003187 JGI25151J46595_10000334 JGI25151J46595_1000033415 304
410 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015276 304
411 3300003215 JGI25153J46596_10000583 JGI25153J46596_100005833 304
412 3300003354 JGI25160J50197_1000026 JGI25160J50197_100002659 304
413 3300003374 JGI25161J50226_1000014 JGI25161J50226_1000014131 304
414 3300003762 Ga0055542_1000532 Ga0055542_10005325 304
415 3300003762 Ga0055542_1001765 Ga0055542_100176510 304
416 3300003763 Ga0055529_1003471 Ga0055529_10034712 304
417 3300003763 Ga0055529_1004404 Ga0055529_10044041 304
418 3300004625 Ga0055543_1000079 Ga0055543_100007971 304
419 3300005262 Ga0065165_1000073 Ga0065165_1000073108 304
420 3300005290 Ga0065712_10101768 Ga0065712_101017682 304
421 3300005293 Ga0065715_10298065 Ga0065715_102980651 304
422 3300005327 Ga0070658_10122036 Ga0070658_101220362 304
423 3300005328 Ga0070676_10164701 Ga0070676_101647012 304
424 3300005339 Ga0070660_100098214 Ga0070660_1000982142 304
425 3300005339 Ga0070660_100303653 Ga0070660_1003036532 304
426 3300005347 Ga0070668_100009387 Ga0070668_1000093876 304
427 3300005347 Ga0070668_100109891 Ga0070668_1001098912 304
428 3300005353 Ga0070669_100112378 Ga0070669_1001123782 304
429 3300005439 Ga0070711_100365133 Ga0070711_1003651331 304
430 3300005471 Ga0070698_100075017 Ga0070698_1000750173 304
431 3300005539 Ga0068853_100051509 Ga0068853_1000515092 304
432 3300005539 Ga0068853_100238034 Ga0068853_1002380342 304
433 3300005548 Ga0070665_100050304 Ga0070665_1000503042 304
434 3300005577 Ga0068857_100449195 Ga0068857_1004491951 304
435 3300005843 Ga0068860_100113102 Ga0068860_1001131022 304
436 3300005983 Ga0081540_1043571 Ga0081540_10435712 304
437 3300006038 Ga0075365_10009599 Ga0075365_100095993 304
438 3300006038 Ga0075365_10021750 Ga0075365_100217503 304
439 3300006038 Ga0075365_10059563 Ga0075365_100595632 304
440 3300006038 Ga0075365_10119286 Ga0075365_101192862 304
441 3300006048 Ga0075363_100093821 Ga0075363_1000938212 304
442 3300006177 Ga0075362_10000827 Ga0075362_100008277 304
443 3300006178 Ga0075367_10081464 Ga0075367_100814642 304
444 3300006186 Ga0075369_10014686 Ga0075369_100146863 304
445 3300006186 Ga0075369_10016374 Ga0075369_100163743 304
446 3300006186 Ga0075369_10029051 Ga0075369_100290512 304
447 3300006844 Ga0075428_100543284 Ga0075428_1005432841 304
448 3300006946 Ga0079104_1003039 Ga0079104_10030397 304
449 3300009093 Ga0105240_10759385 Ga0105240_107593851 304
450 3300009148 Ga0105243_10176169 Ga0105243_101761692 304
451 3300009176 Ga0105242_10077064 Ga0105242_100770643 304
452 3300009545 Ga0105237_10637201 Ga0105237_106372012 304
453 3300009551 Ga0105238_10013126 Ga0105238_100131262 304
454 3300009551 Ga0105238_10408526 Ga0105238_104085262 304
455 3300010375 Ga0105239_10015266 Ga0105239_100152662 304
456 3300010375 Ga0105239_10058202 Ga0105239_100582023 304
457 3300010375 Ga0105239_10070462 Ga0105239_100704623 304
458 3300013104 Ga0157370_10240304 Ga0157370_102403042 304
459 3300013296 Ga0157374_10314307 Ga0157374_103143072 304
460 3300013297 Ga0157378_10116506 Ga0157378_101165062 304
461 3300014497 Ga0182008_10010683 Ga0182008_100106831 304
462 3300015262 Ga0182007_10043021 Ga0182007_100430212 304
463 3300022739 Ga0228711_1005574 Ga0228711_100557416 304
464 3300022740 Ga0228710_1006649 Ga0228710_100664916 304
465 3300025208 Ga0209436_106181 Ga0209436_1061812 304
466 3300025230 Ga0209563_103720 Ga0209563_1037203 304
467 3300025245 Ga0207425_1000186 Ga0207425_100018615 304
468 3300025250 Ga0209026_1000025 Ga0209026_100002544 304
469 3300025254 Ga0209148_1000037 Ga0209148_1000037533 304
470 3300025254 Ga0209148_1000233 Ga0209148_100023387 304
471 3300025256 Ga0209759_1000226 Ga0209759_100022658 304
472 3300025258 Ga0209129_1000165 Ga0209129_100016538 304
473 3300025261 Ga0209233_1000010 Ga0209233_1000010373 304
474 3300025261 Ga0209233_1026784 Ga0209233_10267842 304
475 3300025272 Ga0209455_1000036 Ga0209455_1000036510 304
476 3300025272 Ga0209455_1000062 Ga0209455_1000062335 304
477 3300025273 Ga0209673_1040200 Ga0209673_10402002 304
478 3300025284 Ga0209130_1000219 Ga0209130_100021967 304
479 3300025292 Ga0209676_1011045 Ga0209676_10110452 304
480 3300025294 Ga0209025_1000362 Ga0209025_100036260 304
481 3300025297 Ga0209758_1000685 Ga0209758_100068515 304
482 3300025297 Ga0209758_1022356 Ga0209758_10223563 304
483 3300025298 Ga0209050_1002036 Ga0209050_100203612 304
484 3300025302 Ga0207426_1000075 Ga0207426_1000075147 304
485 3300025901 Ga0207688_10226661 Ga0207688_102266612 304
486 3300025904 Ga0207647_10009585 Ga0207647_100095852 304
487 3300025907 Ga0207645_10010175 Ga0207645_100101756 304
488 3300025914 Ga0207671_10015395 Ga0207671_100153954 304
489 3300025916 Ga0207663_10129969 Ga0207663_101299692 304
490 3300025919 Ga0207657_10093082 Ga0207657_100930822 304
491 3300025919 Ga0207657_10098874 Ga0207657_100988742 304
492 3300025924 Ga0207694_10008336 Ga0207694_100083362 304
493 3300025940 Ga0207691_10252801 Ga0207691_102528011 304
494 3300026041 Ga0207639_10004211 Ga0207639_100042117 304
495 3300026116 Ga0207674_10175626 Ga0207674_101756262 304
496 3300026142 Ga0207698_10200082 Ga0207698_102000822 304
497 3300027111 Ga0209281_1001012 Ga0209281_100101221 304
498 3300027111 Ga0209281_1001545 Ga0209281_100154510 304
499 3300027312 Ga0209371_1025348 Ga0209371_10253482 304
500 3300027666 Ga0209282_1000296 Ga0209282_10002969 304
501 3300028379 Ga0268266_10043519 Ga0268266_100435193 304
502 3300028379 Ga0268266_10262133 Ga0268266_102621332 304
503 3300028381 Ga0268264_10136347 Ga0268264_101363472 304
504 3300028794 Ga0307515_10001908 Ga0307515_1000190816 304
505 3300031548 Ga0307408_100062839 Ga0307408_1000628393 304
506 3300031649 Ga0307514_10182031 Ga0307514_101820312 304
507 3300031852 Ga0307410_10267939 Ga0307410_102679392 304
508 3300031901 Ga0307406_10214332 Ga0307406_102143322 304
509 3300031911 Ga0307412_10000118 Ga0307412_1000011810 304
510 3300031911 Ga0307412_10036177 Ga0307412_100361772 304
511 3300031911 Ga0307412_10337623 Ga0307412_103376231 304
512 3300031995 Ga0307409_100287892 Ga0307409_1002878921 304
513 3300032005 Ga0307411_10114731 Ga0307411_101147312 304
514 3300033430 Ga0315913_1000879 Ga0315913_100087928 304
515 3300033464 Ga0315915_1000436 Ga0315915_100043612 304
516 3300037418 Ga0395900_0082212 Ga0395900_0082212_925_1839 304
517 3300037418 Ga0395900_0360901 Ga0395900_0360901_337_1251 304
518 3300037466 Ga0395898_0027702 Ga0395898_0027702_2460_3374 304
519 3300037471 Ga0395905_0001090 Ga0395905_0001090_27956_28870 304
520 3300037471 Ga0395905_0004612 Ga0395905_0004612_10323_11237 304
521 3300037471 Ga0395905_0295975 Ga0395905_0295975_329_1243 304
522 3300038443 Ga0395901_0009893 Ga0395901_0009893_6549_7463 304
523 3300038443 Ga0395901_0058583 Ga0395901_0058583_2766_3680 304
524 3300039450 Ga0436363_1435275 Ga0436363_1435275_1279_2193 304
525 3300041413 Ga0439465_0010933 Ga0439465_0010933_562_1476 304
526 3300042008 Ga0439450_045474 Ga0439450_045474_83_997 304
527 3300042461 Ga0439460_0042636 Ga0439460_0042636_408_1322 304
528 3300044658 Ga0466972_0029598 Ga0466972_0029598_1287_2201 304
529 3300044693 Ga0466961_0132117 Ga0466961_0132117_606_1520 304
530 3300045049 Ga0466959_0018824 Ga0466959_0018824_1323_2237 304
531 3300046455 Ga0495603_0133073 Ga0495603_0133073_440_1354 304
532 3300046474 Ga0495605_0145825 Ga0495605_0145825_130_1044 304
533 3300046507 Ga0495606_0085245 Ga0495606_0085245_340_1254 304
534 3300046512 Ga0495610_0015471 Ga0495610_0015471_2000_2914 304
535 3300046515 Ga0495620_0046257 Ga0495620_0046257_485_1399 304
536 3300046520 Ga0495637_0033281 Ga0495637_0033281_37_951 304
537 3300046542 Ga0495597_0072724 Ga0495597_0072724_235_1149 304
538 3300047472 Ga0495686_0030357 Ga0495686_0030357_1815_2729 304
539 3300048091 Ga0495626_0027690 Ga0495626_0027690_258_1172 304
540 3300048912 Ga0496109_0207432 Ga0496109_0207432_563_1477 304
541 3300048915 Ga0496112_0298352 Ga0496112_0298352_350_1264 304
542 3300048917 Ga0496114_0501900 Ga0496114_0501900_105_1019 304
543 3300048918 Ga0496115_0162015 Ga0496115_0162015_45_959 304
544 3300048919 Ga0496116_0002699 Ga0496116_0002699_623_1537 304
545 3300048919 Ga0496116_0077486 Ga0496116_0077486_576_1490 304
546 3300048919 Ga0496116_0105072 Ga0496116_0105072_630_1544 304
547 3300048920 Ga0496117_0066325 Ga0496117_0066325_637_1551 304
548 3300048921 Ga0496118_0080856 Ga0496118_0080856_456_1370 304
549 3300048921 Ga0496118_0102332 Ga0496118_0102332_401_1315 304
550 3300048922 Ga0496119_0110831 Ga0496119_0110831_19_933 304
551 3300048923 Ga0496120_0002324 Ga0496120_0002324_11646_12560 304
552 3300048923 Ga0496120_0185592 Ga0496120_0185592_39_953 304
553 3300048924 Ga0496121_0000094 Ga0496121_0000094_138618_139532 304
554 3300048924 Ga0496121_0012904 Ga0496121_0012904_6395_7309 304
555 3300048924 Ga0496121_0037347 Ga0496121_0037347_2959_3873 304
556 3300048925 Ga0496122_0000115 Ga0496122_0000115_82190_83104 304
557 3300048925 Ga0496122_0101364 Ga0496122_0101364_943_1857 304
558 3300048926 Ga0496123_0000129 Ga0496123_0000129_45887_46801 304
559 3300048926 Ga0496123_0106651 Ga0496123_0106651_513_1427 304
560 3300048926 Ga0496123_0139666 Ga0496123_0139666_275_1189 304
561 3300048928 Ga0496125_0007911 Ga0496125_0007911_2770_3684 304
562 3300048928 Ga0496125_0015143 Ga0496125_0015143_4334_5248 304
563 3300048928 Ga0496125_0101246 Ga0496125_0101246_565_1479 304
564 3300048928 Ga0496125_0138776 Ga0496125_0138776_99_1013 304
565 3300048929 Ga0496126_0066029 Ga0496126_0066029_26_979 304
566 3300048929 Ga0496126_0134567 Ga0496126_0134567_777_1691 304
567 3300048929 Ga0496126_0352677 Ga0496126_0352677_26_940 304
568 3300049568 Ga0501031_0019207 Ga0501031_0019207_1413_2327 304
569 3300049569 Ga0501032_0089869 Ga0501032_0089869_875_1789 304
570 3300049570 Ga0501033_0104327 Ga0501033_0104327_278_1192 304
571 3300049571 Ga0501034_0059185 Ga0501034_0059185_493_1407 304
572 3300049572 Ga0501036_0148991 Ga0501036_0148991_567_1481 304
573 3300049573 Ga0501037_0051430 Ga0501037_0051430_1822_2736 304
574 3300049574 Ga0501038_0106544 Ga0501038_0106544_278_1192 304
575 3300049579 Ga0501043_0041749 Ga0501043_0041749_1825_2739 304
576 3300049580 Ga0501046_0001581 Ga0501046_0001581_3850_4764 304
577 3300049581 Ga0501047_0086413 Ga0501047_0086413_278_1192 304
578 3300049586 Ga0501070_0071672 Ga0501070_0071672_1558_2472 304
579 3300049589 Ga0501073_0001496 Ga0501073_0001496_8813_9727 304
580 3300049742 Ga0501080_0046966 Ga0501080_0046966_2646_3560 304
581 3300049822 Ga0501035_0121622 Ga0501035_0121622_875_1789 304
582 3300049823 Ga0501044_0153732 Ga0501044_0153732_493_1407 304
583 3300050489 nmdc:mga03683_2860_c1 nmdc:mga03683_2860_c1_3916_4830 304
584 3300050491 nmdc:mga00v17_6326_c1 nmdc:mga00v17_6326_c1_607_1521 304
585 3300050492 nmdc:mga0yw44_216500_c1 nmdc:mga0yw44_216500_c1_211_1125 304
586 3300050493 nmdc:mga0k408_84977_c1 nmdc:mga0k408_84977_c1_388_1302 304
587 3300050496 nmdc:mga07m45_70184_c1 nmdc:mga07m45_70184_c1_667_1581 304
588 3300050516 nmdc:mga0sz30_1726_c1 nmdc:mga0sz30_1726_c1_1150_2064 304
589 3300050516 nmdc:mga0sz30_86724_c1 nmdc:mga0sz30_86724_c1_83_997 304
590 3300053088 Ga0500644_0001691 Ga0500644_0001691_981_1895 304
591 3300053134 Ga0500658_0017990 Ga0500658_0017990_1267_2181 304
592 3300053136 Ga0500559_0000405 Ga0500559_0000405_9056_9973 304
593 3300053136 Ga0500559_0001297 Ga0500559_0001297_8131_9048 304
594 3300053153 Ga0500616_0000010 Ga0500616_0000010_525440_526354 304
595 3300053156 Ga0500622_0000159 Ga0500622_0000159_25580_26494 304
596 3300053727 Ga0500611_005533 Ga0500611_005533_377_1291 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

35

312

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.7906 1 304
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.788 1 304
3wqo-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase-like protein 0.7793 2 303
3tva-assembly2.cif.gz_B crystal structure of xylose isomerase domain protein from planctomyces limnophilus 0.7704 2 303
3wqo-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase-like protein 0.7661 2 303
ID Description Score Start End Superfamily
3wqoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7945 1 303 3.20.20.150
3wqoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7813 1 303 3.20.20.150
af_Q58587_1_265_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7705 1 299 3.20.20.150
af_Q58587_1_265_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7679 1 299 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7662 2 301 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A528EJ84-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9959 1 165 GO:0016853
AF-A0A659YLP6-F1-model_v4 deleted 0.9947 1 139
AF-A0A3S1P251-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9945 1 211 GO:0016853
AF-A0A527ZNA7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.994 1 208 GO:0016853
AF-A0A0D5LZJ2-F1-model_v4 Xylose isomerase domain-containing protein TIM barrel 0.9932 34 304 GO:0016853

Feature Viewer

pLDDT pTM Quality
94.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map