F467574

General Info

Members Datasets Scaffolds Average Seq Length
596 331 1192 121

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10053240|Ga0307516_100532403
Length 116
Sequence MSTSDTFLAVFLGSKTSAKMAAWNALPEAERRSREQQGIWVEKHQASLVELGGPLGKTTRVDSSGIADISNELGAFTVVRAASHEAAAKLFENHPHFAIFPGERVEIMPVLPIPGG

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
210 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
211 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
212 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
213 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
214 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
215 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
267 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
309 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
313 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
314 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
317 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
318 2791355199
319 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
320 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
321 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
322 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
323 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
324 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
325 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
326 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
327 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
328 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
329 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
330 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
331 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.17
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 1.51
Rhizoplane 9.23
Rhizosphere 75.5
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10053240 3300031730 Bacteria 3958
2 JGI24739J22299_10030504 3300001989 Bacteria 1868
3 JGI24737J22298_10002347 3300001990 Bacteria 6747
4 JGI24735J21928_10101567 3300002067 Bacteria 826
5 rootH1_10019068 3300003323 Bacteria 1033
6 Ga0055529_1049128 3300003763 Bacteria 506
7 Ga0070690_100037484 3300005330 Bacteria 3055
8 Ga0070690_100375042 3300005330 Bacteria 1039
9 Ga0070670_100060834 3300005331 Unclassified 3243
10 Ga0068869_100254987 3300005334 Bacteria 1402
11 Ga0070666_10004960 3300005335 Bacteria 8139
12 Ga0068868_100100778 3300005338 Bacteria 2337
13 Ga0068868_101978623 3300005338 Bacteria 553
14 Ga0070689_100470638 3300005340 Bacteria 1072
15 Ga0070689_100563710 3300005340 Bacteria 983
16 Ga0070691_10256568 3300005341 Bacteria 940
17 Ga0070668_100296204 3300005347 Bacteria 1355
18 Ga0070668_101140734 3300005347 Bacteria 705
19 Ga0070668_101579991 3300005347 Bacteria 601
20 Ga0070668_102149887 3300005347 Bacteria 515
21 Ga0070669_100235249 3300005353 Bacteria 1453
22 Ga0070675_100256096 3300005354 Bacteria 1533
23 Ga0070671_100674123 3300005355 Bacteria 896
24 Ga0070671_101096899 3300005355 Bacteria 699
25 Ga0070674_100888105 3300005356 Bacteria 776
26 Ga0070688_100137146 3300005365 Bacteria 1658
27 Ga0070659_101001387 3300005366 Bacteria 734
28 Ga0070667_100089815 3300005367 Bacteria 2639
29 Ga0070667_100495448 3300005367 Bacteria 1120
30 Ga0070667_101540081 3300005367 Bacteria 625
31 Ga0070703_10241851 3300005406 Bacteria 728
32 Ga0070709_10236761 3300005434 Unclassified 1309
33 Ga0070709_11203803 3300005434 Bacteria 609
34 Ga0070714_100290700 3300005435 Bacteria 1521
35 Ga0070714_101118137 3300005435 Bacteria 768
36 Ga0070713_100005990 3300005436 Bacteria 8366
37 Ga0070713_100291741 3300005436 Bacteria 1499
38 Ga0070713_100330419 3300005436 Bacteria 1410
39 Ga0070710_11148947 3300005437 Bacteria 572
40 Ga0070711_100004982 3300005439 Bacteria 7886
41 Ga0070711_100379279 3300005439 Bacteria 1143
42 Ga0070711_101062359 3300005439 Bacteria 696
43 Ga0070705_100951340 3300005440 Bacteria 694
44 Ga0070700_101974506 3300005441 Bacteria 506
45 Ga0070663_100073751 3300005455 Bacteria 2490
46 Ga0070663_100239235 3300005455 Bacteria 1432
47 Ga0070663_100319448 3300005455 Bacteria 1248
48 Ga0070663_100320808 3300005455 Bacteria 1246
49 Ga0070663_100505009 3300005455 Bacteria 1005
50 Ga0070663_101653058 3300005455 Bacteria 572
51 Ga0070678_100345611 3300005456 Bacteria 1277
52 Ga0070678_100483667 3300005456 Bacteria 1090
53 Ga0070678_100827993 3300005456 Unclassified 842
54 Ga0070678_101516938 3300005456 Bacteria 628
55 Ga0070662_100742709 3300005457 Bacteria 832
56 Ga0070662_101146000 3300005457 Bacteria 668
57 Ga0070681_10024432 3300005458 Bacteria 6084
58 Ga0070681_10080702 3300005458 Bacteria 3209
59 Ga0070681_10258569 3300005458 Bacteria 1653
60 Ga0070706_100415779 3300005467 Bacteria 1252
61 Ga0070698_100028998 3300005471 Bacteria 5744
62 Ga0070698_100911268 3300005471 Bacteria 825
63 Ga0070679_100009248 3300005530 Bacteria 9314
64 Ga0070679_100075893 3300005530 Bacteria 3351
65 Ga0068853_100210598 3300005539 Bacteria 1771
66 Ga0068853_100517318 3300005539 Bacteria 1128
67 Ga0070672_100968967 3300005543 Bacteria 753
68 Ga0070672_101091826 3300005543 Bacteria 709
69 Ga0070686_100487026 3300005544 Bacteria 955
70 Ga0070686_101570809 3300005544 Bacteria 556
71 Ga0070695_100359125 3300005545 Bacteria 1093
72 Ga0070693_100228290 3300005547 Bacteria 1223
73 Ga0070665_100013100 3300005548 Bacteria 8350
74 Ga0070665_100080609 3300005548 Bacteria 3260
75 Ga0070665_100732835 3300005548 Bacteria 1001
76 Ga0070665_101571943 3300005548 Bacteria 666
77 Ga0070704_101604942 3300005549 Bacteria 600
78 Ga0068855_100051001 3300005563 Bacteria 4875
79 Ga0068855_100193304 3300005563 Bacteria 2294
80 Ga0068855_101188578 3300005563 Bacteria 793
81 Ga0068855_101243336 3300005563 Bacteria 773
82 Ga0068857_100028661 3300005577 Bacteria 4913
83 Ga0068857_100980136 3300005577 Bacteria 813
84 Ga0068854_100014717 3300005578 Bacteria 5162
85 Ga0068856_100035106 3300005614 Bacteria 4913
86 Ga0068856_101039525 3300005614 Bacteria 837
87 Ga0070702_100256668 3300005615 Bacteria 1188
88 Ga0068859_100040226 3300005617 Bacteria 4693
89 Ga0068864_100235961 3300005618 Bacteria 1693
90 Ga0068864_100486535 3300005618 Bacteria 1185
91 Ga0068866_10302007 3300005718 Bacteria 1000
92 Ga0068861_100748718 3300005719 Bacteria 912
93 Ga0068861_102715415 3300005719 Bacteria 500
94 Ga0068870_10453388 3300005840 Bacteria 846
95 Ga0068870_11039597 3300005840 Bacteria 586
96 Ga0068863_100206790 3300005841 Bacteria 1889
97 Ga0068860_100027726 3300005843 Bacteria 5454
98 Ga0068860_100292732 3300005843 Bacteria 1593
99 Ga0068860_101015534 3300005843 Bacteria 848
100 Ga0068860_101759025 3300005843 Bacteria 642
101 Ga0068862_100228976 3300005844 Bacteria 1685
102 Ga0068862_100638985 3300005844 Bacteria 1025
103 Ga0081540_1005216 3300005983 Bacteria 9725
104 Ga0081540_1007193 3300005983 Bacteria 7985
105 Ga0081540_1076704 3300005983 Bacteria 1522
106 Ga0070717_10000460 3300006028 Bacteria 25862
107 Ga0070717_10110309 3300006028 Bacteria 2346
108 Ga0070717_11077288 3300006028 Bacteria 732
109 Ga0075365_10016437 3300006038 Bacteria 4501
110 Ga0075365_10075675 3300006038 Bacteria 2272
111 Ga0075365_10144811 3300006038 Bacteria 1651
112 Ga0075365_11209712 3300006038 Bacteria 531
113 Ga0075368_10070444 3300006042 Bacteria 1411
114 Ga0075368_10122637 3300006042 Bacteria 1077
115 Ga0075363_100014770 3300006048 Bacteria 3825
116 Ga0070715_10107371 3300006163 Bacteria 1312
117 Ga0070716_100034174 3300006173 Bacteria 2786
118 Ga0070716_100154821 3300006173 Bacteria 1478
119 Ga0070716_100970695 3300006173 Bacteria 670
120 Ga0070712_100073635 3300006175 Bacteria 2451
121 Ga0070712_101622439 3300006175 Bacteria 566
122 Ga0075362_10130809 3300006177 Bacteria 1193
123 Ga0075367_10040157 3300006178 Bacteria 2731
124 Ga0075367_10136379 3300006178 Bacteria 1518
125 Ga0075369_10117031 3300006186 Bacteria 1204
126 Ga0075369_10142974 3300006186 Bacteria 1091
127 Ga0075369_10191822 3300006186 Bacteria 942
128 Ga0075366_10032034 3300006195 Bacteria 3094
129 Ga0075366_10107607 3300006195 Bacteria 1676
130 Ga0075366_10874182 3300006195 Bacteria 560
131 Ga0097621_100774264 3300006237 Bacteria 888
132 Ga0075370_10020322 3300006353 Bacteria 3627
133 Ga0075370_10138407 3300006353 Bacteria 1423
134 Ga0068871_100154020 3300006358 Bacteria 1961
135 Ga0075428_101303858 3300006844 Bacteria 764
136 Ga0075433_10377914 3300006852 Bacteria 1251
137 Ga0075434_100016328 3300006871 Bacteria 7137
138 Ga0068865_100041421 3300006881 Bacteria 3134
139 Ga0068865_100109505 3300006881 Bacteria 2035
140 Ga0068865_100559409 3300006881 Bacteria 962
141 Ga0068865_101931941 3300006881 Bacteria 535
142 Ga0075436_100057729 3300006914 Bacteria 2680
143 Ga0075436_100059273 3300006914 Bacteria 2644
144 Ga0097620_100040226 3300006931 Bacteria 4693
145 Ga0075435_100704487 3300007076 Bacteria 878
146 Ga0099795_10000005 3300007788 Bacteria 107614
147 Ga0099795_10366344 3300007788 Bacteria 648
148 Ga0105240_10016877 3300009093 Bacteria 9867
149 Ga0105240_10087516 3300009093 Bacteria 3815
150 Ga0105240_10888648 3300009093 Unclassified 959
151 Ga0111539_10124402 3300009094 Bacteria 3022
152 Ga0111539_11133052 3300009094 Bacteria 909
153 Ga0111539_13203975 3300009094 Unclassified 527
154 Ga0105245_10014079 3300009098 Bacteria 6968
155 Ga0105245_10464643 3300009098 Bacteria 1276
156 Ga0105245_11950086 3300009098 Bacteria 640
157 Ga0105247_10080734 3300009101 Bacteria 2049
158 Ga0105247_10177383 3300009101 Bacteria 1420
159 Ga0105247_10207519 3300009101 Bacteria 1320
160 Ga0105247_10244064 3300009101 Bacteria 1225
161 Ga0105247_10394507 3300009101 Bacteria 984
162 Ga0105247_10583282 3300009101 Bacteria 827
163 Ga0105247_10913872 3300009101 Bacteria 679
164 Ga0114129_10144511 3300009147 Bacteria 3259
165 Ga0105243_10353713 3300009148 Bacteria 1350
166 Ga0105243_10501348 3300009148 Bacteria 1150
167 Ga0105243_10562906 3300009148 Bacteria 1091
168 Ga0105243_11385250 3300009148 Bacteria 723
169 Ga0105243_12123316 3300009148 Bacteria 598
170 Ga0105241_10225918 3300009174 Bacteria 1576
171 Ga0105242_10015747 3300009176 Bacteria 5874
172 Ga0105248_10330687 3300009177 Bacteria 1716
173 Ga0105248_10410344 3300009177 Bacteria 1525
174 Ga0105237_10106632 3300009545 Bacteria 2794
175 Ga0105237_10273970 3300009545 Bacteria 1690
176 Ga0105237_10276157 3300009545 Bacteria 1683
177 Ga0105237_10342514 3300009545 Bacteria 1499
178 Ga0105237_11336302 3300009545 Bacteria 723
179 Ga0105238_10305586 3300009551 Bacteria 1575
180 Ga0105238_10524792 3300009551 Bacteria 1187
181 Ga0105238_11735058 3300009551 Bacteria 656
182 Ga0105249_10513667 3300009553 Bacteria 1245
183 Ga0105249_10681283 3300009553 Bacteria 1087
184 Ga0105249_11022958 3300009553 Bacteria 895
185 Ga0105249_11065330 3300009553 Bacteria 878
186 Ga0105249_11122386 3300009553 Bacteria 857
187 Ga0099796_10000023 3300010159 Bacteria 39177
188 Ga0099796_10099297 3300010159 Bacteria 1093
189 Ga0105239_10015287 3300010375 Bacteria 8506
190 Ga0105239_10658645 3300010375 Bacteria 1196
191 Ga0105239_11224090 3300010375 Bacteria 865
192 Ga0105246_10206627 3300011119 Bacteria 1530
193 Ga0157369_10307557 3300013105 Bacteria 1648
194 Ga0157369_10488407 3300013105 Bacteria 1274
195 Ga0157374_10035603 3300013296 Bacteria 4555
196 Ga0157378_10677672 3300013297 Bacteria 1049
197 Ga0163162_10159796 3300013306 Bacteria 2375
198 Ga0163162_10351084 3300013306 Bacteria 1608
199 Ga0163162_10980066 3300013306 Bacteria 955
200 Ga0163162_11499894 3300013306 Bacteria 768
201 Ga0163162_11624024 3300013306 Bacteria 737
202 Ga0163162_12163275 3300013306 Bacteria 638
203 Ga0157375_10406560 3300013308 Bacteria 1528
204 Ga0157375_11029961 3300013308 Bacteria 962
205 Ga0157375_12416927 3300013308 Bacteria 627
206 Ga0157375_12758439 3300013308 Bacteria 587
207 Ga0157375_13293055 3300013308 Bacteria 538
208 Ga0163163_10012089 3300014325 Bacteria 7854
209 Ga0163163_10073225 3300014325 Bacteria 3416
210 Ga0163163_10203034 3300014325 Bacteria 2031
211 Ga0157380_10109465 3300014326 Bacteria 2318
212 Ga0157380_10283829 3300014326 Bacteria 1516
213 Ga0157380_10428354 3300014326 Bacteria 1264
214 Ga0157380_11317117 3300014326 Bacteria 770
215 Ga0157377_10356285 3300014745 Bacteria 983
216 Ga0157379_10023444 3300014968 Bacteria 5478
217 Ga0157379_10148040 3300014968 Bacteria 2118
218 Ga0157376_10014415 3300014969 Bacteria 5934
219 Ga0157376_10095961 3300014969 Bacteria 2580
220 Ga0157376_11195247 3300014969 Bacteria 788
221 Ga0157376_11385431 3300014969 Bacteria 734
222 Ga0157376_12989432 3300014969 Bacteria 512
223 Ga0163161_10149977 3300017792 Bacteria 1771
224 Ga0163161_10410046 3300017792 Bacteria 1088
225 Ga0163161_10790755 3300017792 Bacteria 796
226 Ga0163161_11129742 3300017792 Bacteria 675
227 Ga0228598_1013692 3300024227 Bacteria 1605
228 Ga0209148_1016579 3300025254 Bacteria 1265
229 Ga0209233_1000694 3300025261 Bacteria 15931
230 Ga0209455_1001710 3300025272 Bacteria 9395
231 Ga0207692_10474809 3300025898 Bacteria 790
232 Ga0207710_10201434 3300025900 Bacteria 983
233 Ga0207688_10088637 3300025901 Bacteria 1774
234 Ga0207688_10094246 3300025901 Bacteria 1722
235 Ga0207688_10187461 3300025901 Bacteria 1236
236 Ga0207680_10625090 3300025903 Bacteria 771
237 Ga0207680_10697480 3300025903 Unclassified 727
238 Ga0207647_10001253 3300025904 Bacteria 19532
239 Ga0207685_10117700 3300025905 Bacteria 1161
240 Ga0207699_10230614 3300025906 Bacteria 1268
241 Ga0207699_10646900 3300025906 Bacteria 772
242 Ga0207699_10801374 3300025906 Bacteria 692
243 Ga0207645_10267439 3300025907 Bacteria 1133
244 Ga0207643_10399027 3300025908 Bacteria 869
245 Ga0207643_10642631 3300025908 Bacteria 684
246 Ga0207684_10596827 3300025910 Bacteria 943
247 Ga0207707_10032842 3300025912 Bacteria 4542
248 Ga0207707_10089803 3300025912 Bacteria 2685
249 Ga0207695_10109077 3300025913 Bacteria 2751
250 Ga0207695_10112712 3300025913 Bacteria 2697
251 Ga0207695_10981668 3300025913 Unclassified 724
252 Ga0207671_10232053 3300025914 Bacteria 1448
253 Ga0207671_10307417 3300025914 Bacteria 1253
254 Ga0207671_10413225 3300025914 Bacteria 1073
255 Ga0207693_10009325 3300025915 Bacteria 8001
256 Ga0207693_10244528 3300025915 Bacteria 1408
257 Ga0207693_11156517 3300025915 Bacteria 585
258 Ga0207663_10025502 3300025916 Bacteria 3419
259 Ga0207663_10852348 3300025916 Bacteria 727
260 Ga0207660_11630639 3300025917 Bacteria 520
261 Ga0207662_10173318 3300025918 Bacteria 1384
262 Ga0207652_10010710 3300025921 Bacteria 7381
263 Ga0207681_10620603 3300025923 Bacteria 895
264 Ga0207650_10074994 3300025925 Bacteria 2551
265 Ga0207687_10441628 3300025927 Bacteria 1078
266 Ga0207687_10618365 3300025927 Bacteria 914
267 Ga0207700_10010911 3300025928 Bacteria 5768
268 Ga0207700_11183912 3300025928 Bacteria 682
269 Ga0207700_11922123 3300025928 Bacteria 518
270 Ga0207664_10059318 3300025929 Bacteria 3046
271 Ga0207664_10440064 3300025929 Bacteria 1163
272 Ga0207644_10871198 3300025931 Bacteria 754
273 Ga0207644_11143662 3300025931 Bacteria 654
274 Ga0207706_10231959 3300025933 Bacteria 1615
275 Ga0207706_11455376 3300025933 Bacteria 560
276 Ga0207686_10063429 3300025934 Bacteria 2350
277 Ga0207709_10613756 3300025935 Bacteria 862
278 Ga0207670_10388045 3300025936 Bacteria 1114
279 Ga0207669_10345806 3300025937 Bacteria 1147
280 Ga0207704_10568657 3300025938 Bacteria 924
281 Ga0207704_11232176 3300025938 Bacteria 638
282 Ga0207665_10023296 3300025939 Bacteria 4078
283 Ga0207665_10091265 3300025939 Bacteria 2112
284 Ga0207665_10412065 3300025939 Bacteria 1031
285 Ga0207665_10456128 3300025939 Bacteria 982
286 Ga0207711_10125296 3300025941 Bacteria 2297
287 Ga0207711_10333584 3300025941 Bacteria 1403
288 Ga0207711_10630299 3300025941 Bacteria 1000
289 Ga0207689_10184753 3300025942 Bacteria 1719
290 Ga0207667_10039623 3300025949 Bacteria 5021
291 Ga0207667_10108706 3300025949 Bacteria 2860
292 Ga0207667_10786977 3300025949 Bacteria 949
293 Ga0207667_10974270 3300025949 Bacteria 837
294 Ga0207651_10612600 3300025960 Bacteria 953
295 Ga0207712_10867750 3300025961 Bacteria 796
296 Ga0207668_10173030 3300025972 Bacteria 1695
297 Ga0207668_10624358 3300025972 Bacteria 941
298 Ga0207668_10951351 3300025972 Bacteria 766
299 Ga0207668_10979695 3300025972 Bacteria 755
300 Ga0207640_10021128 3300025981 Bacteria 3874
301 Ga0207658_10262033 3300025986 Bacteria 1474
302 Ga0207658_10312079 3300025986 Bacteria 1359
303 Ga0207658_10681309 3300025986 Unclassified 928
304 Ga0207658_11647929 3300025986 Bacteria 586
305 Ga0207677_10063069 3300026023 Bacteria 2574
306 Ga0207677_10535789 3300026023 Bacteria 1018
307 Ga0207677_12014990 3300026023 Bacteria 537
308 Ga0207703_10103043 3300026035 Bacteria 2422
309 Ga0207639_10474867 3300026041 Bacteria 1139
310 Ga0207639_10564999 3300026041 Bacteria 1046
311 Ga0207678_10025952 3300026067 Bacteria 5112
312 Ga0207678_10268443 3300026067 Bacteria 1463
313 Ga0207678_10402078 3300026067 Bacteria 1186
314 Ga0207678_11546810 3300026067 Bacteria 585
315 Ga0207708_10353523 3300026075 Bacteria 1206
316 Ga0207702_10013602 3300026078 Bacteria 6756
317 Ga0207641_10805947 3300026088 Bacteria 929
318 Ga0207641_11314141 3300026088 Bacteria 724
319 Ga0207641_11543134 3300026088 Bacteria 666
320 Ga0207676_11853785 3300026095 Bacteria 602
321 Ga0207674_10016173 3300026116 Bacteria 8171
322 Ga0207674_11053503 3300026116 Bacteria 782
323 Ga0207675_100251674 3300026118 Bacteria 1710
324 Ga0207675_101133473 3300026118 Bacteria 802
325 Ga0207683_10051305 3300026121 Bacteria 3614
326 Ga0207683_10155090 3300026121 Bacteria 2068
327 Ga0207683_10323726 3300026121 Bacteria 1412
328 Ga0209179_1000175 3300027512 Bacteria 6059
329 Ga0209813_10128353 3300027866 Bacteria 889
330 Ga0207428_10306685 3300027907 Bacteria 1174
331 Ga0207428_10368040 3300027907 Bacteria 1056
332 Ga0268266_10001136 3300028379 Bacteria 33101
333 Ga0268266_10124447 3300028379 Bacteria 2299
334 Ga0268266_11104722 3300028379 Bacteria 767
335 Ga0268265_10192550 3300028380 Bacteria 1762
336 Ga0268265_10198444 3300028380 Bacteria 1738
337 Ga0268264_10062809 3300028381 Bacteria 3120
338 Ga0268264_10865538 3300028381 Bacteria 906
339 Ga0307517_10000098 3300028786 Bacteria 126044
340 Ga0307515_10104075 3300028794 Bacteria 3396
341 Ga0265760_10333543 3300031090 Bacteria 541
342 Ga0265332_10113667 3300031238 Bacteria 1139
343 Ga0265325_10030068 3300031241 Bacteria 2915
344 Ga0265339_10102808 3300031249 Bacteria 1485
345 Ga0265339_10220362 3300031249 Bacteria 928
346 Ga0265331_10161814 3300031250 Bacteria 1014
347 Ga0265316_11123974 3300031344 Bacteria 544
348 Ga0307513_10418783 3300031456 Bacteria 1070
349 Ga0307508_10127944 3300031616 Bacteria 2143
350 Ga0265314_10156693 3300031711 Bacteria 1390
351 Ga0265342_10115041 3300031712 Bacteria 1519
352 Ga0307516_10171105 3300031730 Bacteria 1913
353 Ga0307412_10627228 3300031911 Bacteria 914
354 Ga0307416_100665573 3300032002 Bacteria 1127
355 Ga0307510_10327889 3300033180 Bacteria 986
356 Ga0307510_10453756 3300033180 Bacteria 723
357 Ga0307510_10587261 3300033180 Bacteria 564
358 Ga0373938_0012168 3300034957 Bacteria 1610
359 Ga0373938_0082383 3300034957 Bacteria 785
360 Ga0373929_0073539 3300035085 Bacteria 821
361 Ga0373940_0012825 3300035088 Bacteria 2014
362 Ga0373949_0023335 3300035090 Bacteria 1432
363 Ga0373949_0278187 3300035090 Unclassified 525
364 Ga0373923_0460800 3300035111 Bacteria 617
365 Ga0373939_0059957 3300035114 Bacteria 1208
366 Ga0373941_0041926 3300035115 Bacteria 1419
367 Ga0373941_0391181 3300035115 Bacteria 573
368 Ga0373945_0075784 3300035116 Bacteria 1281
369 Ga0373945_0467734 3300035116 Bacteria 559
370 Ga0373957_0342591 3300035120 Bacteria 638
371 Ga0373943_0136937 3300035170 Bacteria 1316
372 Ga0373961_0075393 3300035241 Bacteria 1051
373 Ga0373962_0030285 3300035242 Bacteria 1480
374 Ga0373962_0056827 3300035242 Bacteria 1140
375 Ga0373924_0161939 3300035410 Bacteria 981
376 Ga0373931_0003428 3300035691 Bacteria 7118
377 Ga0373931_0004512 3300035691 Bacteria 6368
378 Ga0373931_0020927 3300035691 Bacteria 3277
379 Ga0373935_0097809 3300035692 Bacteria 1931
380 Ga0373935_0344725 3300035692 Bacteria 1061
381 Ga0373927_0005938 3300035695 Bacteria 8359
382 Ga0373927_0039246 3300035695 Bacteria 3073
383 Ga0373927_0470479 3300035695 Bacteria 830
384 Ga0373933_0000026 3300035724 Bacteria 90309
385 Ga0373947_0052793 3300035725 Bacteria 2449
386 Ga0373947_0331050 3300035725 Bacteria 1020
387 Ga0373937_0613407 3300036401 Bacteria 1033
388 Ga0373925_0013452 3300037068 Bacteria 5923
389 Ga0373925_0120413 3300037068 Bacteria 2037
390 Ga0373925_0165062 3300037068 Bacteria 1746
391 Ga0395898_0035872 3300037466 Bacteria 4928
392 Ga0395898_0620566 3300037466 Bacteria 1024
393 Ga0395898_0991435 3300037466 Bacteria 776
394 Ga0395905_0462821 3300037471 Bacteria 1167
395 Ga0395901_0181283 3300038443 Bacteria 2209
396 Ga0436365_0939476 3300039437 Bacteria 1745
397 Ga0436363_0400675 3300039450 Bacteria 706
398 Ga0436362_0741099 3300039453 Bacteria 4353
399 Ga0451789_0967346 3300041443 Bacteria 611
400 Ga0451791_0402788 3300041451 Bacteria 642
401 Ga0451791_1176742 3300041451 Bacteria 584
402 Ga0451793_0828375 3300041452 Bacteria 623
403 Ga0451798_0016358 3300041458 Bacteria 1101
404 Ga0451802_1435137 3300041460 Bacteria 1094
405 Ga0451807_1414763 3300041486 Bacteria 738
406 Ga0451837_0986133 3300041494 Bacteria 611
407 Ga0451841_1414058 3300041498 Bacteria 504
408 Ga0451855_0305929 3300041511 Bacteria 576
409 Ga0466966_0038431 3300044684 Unclassified 3085
410 Ga0466961_0572202 3300044693 Bacteria 680
411 Ga0466963_0540088 3300044694 Bacteria 823
412 Ga0466964_0663256 3300044706 Bacteria 578
413 Ga0466959_0053125 3300045049 Bacteria 2963
414 Ga0466959_0394516 3300045049 Unclassified 941
415 Ga0466958_0752862 3300045836 Bacteria 635
416 Ga0466958_1080037 3300045836 Unclassified 524
417 Ga0466967_0563761 3300045976 Bacteria 1122
418 Ga0495617_015095 3300046452 Bacteria 2621
419 Ga0495627_124392 3300046453 Bacteria 727
420 Ga0495603_0043229 3300046455 Bacteria 2691
421 Ga0495603_0074854 3300046455 Bacteria 1988
422 Ga0495603_0689354 3300046455 Bacteria 584
423 Ga0495590_0220458 3300046457 Bacteria 700
424 Ga0495638_0576889 3300046460 Bacteria 555
425 Ga0495641_0092177 3300046461 Bacteria 1354
426 Ga0495651_0259012 3300046462 Bacteria 1184
427 Ga0495650_0063664 3300046471 Bacteria 1470
428 Ga0495650_0113151 3300046471 Bacteria 1006
429 Ga0495582_0357182 3300046473 Bacteria 842
430 Ga0495582_0812928 3300046473 Bacteria 541
431 Ga0495605_0241247 3300046474 Bacteria 776
432 Ga0495639_0050090 3300046475 Bacteria 1897
433 Ga0495585_0311796 3300046492 Bacteria 771
434 Ga0495596_0141335 3300046500 Bacteria 935
435 Ga0495596_0163228 3300046500 Bacteria 866
436 Ga0495607_0429765 3300046501 Bacteria 596
437 Ga0495607_0510177 3300046501 Bacteria 532
438 Ga0495630_0269329 3300046517 Bacteria 1301
439 Ga0495643_0074090 3300046522 Bacteria 1784
440 Ga0495644_0052273 3300046523 Bacteria 1534
441 Ga0495644_0088630 3300046523 Bacteria 1167
442 Ga0495663_0120853 3300046525 Bacteria 877
443 Ga0495665_0489016 3300046531 Bacteria 620
444 Ga0495598_0046091 3300046537 Bacteria 1294
445 Ga0495621_0018971 3300046539 Bacteria 2240
446 Ga0495621_0441835 3300046539 Bacteria 556
447 Ga0495645_0363161 3300046543 Bacteria 930
448 Ga0495622_0269882 3300046557 Bacteria 746
449 Ga0495633_0053651 3300046558 Bacteria 1897
450 Ga0495656_0084365 3300046615 Bacteria 1440
451 Ga0495656_0214078 3300046615 Bacteria 961
452 Ga0495656_0788141 3300046615 Bacteria 513
453 Ga0495668_0029504 3300046616 Bacteria 3099
454 Ga0495668_0052320 3300046616 Bacteria 2260
455 Ga0495668_0082172 3300046616 Bacteria 1767
456 Ga0495668_0332061 3300046616 Bacteria 834
457 Ga0495611_0442893 3300046648 Bacteria 592
458 Ga0495625_0376015 3300046660 Bacteria 892
459 Ga0495635_0145633 3300046663 Bacteria 1613
460 Ga0495588_0007336 3300046674 Bacteria 5012
461 Ga0495588_0110523 3300046674 Bacteria 1448
462 Ga0495647_0538129 3300046681 Bacteria 546
463 Ga0495669_0269583 3300046684 Bacteria 818
464 Ga0495670_0039207 3300046691 Bacteria 2362
465 Ga0495670_0112447 3300046691 Bacteria 1410
466 Ga0495670_0163148 3300046691 Bacteria 1171
467 Ga0495671_0089738 3300046692 Bacteria 1505
468 Ga0495589_0103033 3300046794 Bacteria 1380
469 Ga0495589_0111160 3300046794 Bacteria 1322
470 Ga0495604_0498872 3300047317 Bacteria 790
471 Ga0495636_0077561 3300047318 Bacteria 1426
472 Ga0495683_0474998 3300047323 Bacteria 510
473 Ga0495675_0606690 3300047444 Bacteria 620
474 Ga0495677_0067538 3300047445 Bacteria 1330
475 Ga0495677_0191472 3300047445 Bacteria 794
476 Ga0495679_160933 3300047446 Bacteria 600
477 Ga0495673_0083456 3300047469 Bacteria 1319
478 Ga0495673_0186672 3300047469 Bacteria 782
479 Ga0495684_0547276 3300047471 Bacteria 789
480 Ga0495615_0052012 3300048090 Bacteria 1057
481 Ga0495626_0127656 3300048091 Bacteria 1088
482 Ga0496100_0394592 3300048903 Bacteria 1053
483 Ga0496100_0641603 3300048903 Bacteria 826
484 Ga0496100_1409896 3300048903 Bacteria 550
485 Ga0496101_0075055 3300048904 Bacteria 2488
486 Ga0496101_0105094 3300048904 Bacteria 2119
487 Ga0496101_0453350 3300048904 Bacteria 1012
488 Ga0496101_0514497 3300048904 Bacteria 946
489 Ga0496102_0380154 3300048905 Bacteria 1329
490 Ga0496102_0962906 3300048905 Bacteria 774
491 Ga0496102_1057104 3300048905 Bacteria 732
492 Ga0496103_0296231 3300048906 Bacteria 1041
493 Ga0496103_0332347 3300048906 Bacteria 977
494 Ga0496103_0789321 3300048906 Bacteria 599
495 Ga0496104_0003553 3300048907 Bacteria 13448
496 Ga0496104_0026734 3300048907 Bacteria 5332
497 Ga0496104_0208151 3300048907 Bacteria 1868
498 Ga0496104_0273637 3300048907 Bacteria 1601
499 Ga0496104_0436381 3300048907 Bacteria 1221
500 Ga0496104_0558364 3300048907 Bacteria 1055
501 Ga0496105_0005843 3300048908 Bacteria 9384
502 Ga0496105_0066489 3300048908 Bacteria 2976
503 Ga0496105_0258568 3300048908 Bacteria 1409
504 Ga0496105_0345596 3300048908 Bacteria 1189
505 Ga0496106_0355229 3300048909 Bacteria 1177
506 Ga0496106_0806805 3300048909 Bacteria 744
507 Ga0496107_0537257 3300048910 Bacteria 866
508 Ga0496107_1132600 3300048910 Bacteria 564
509 Ga0496108_0020730 3300048911 Bacteria 5403
510 Ga0496108_0262230 3300048911 Bacteria 1504
511 Ga0496109_0188347 3300048912 Bacteria 1938
512 Ga0496109_1789872 3300048912 Bacteria 547
513 Ga0496110_0107424 3300048913 Bacteria 2505
514 Ga0496110_0371924 3300048913 Bacteria 1302
515 Ga0496110_0595230 3300048913 Bacteria 1003
516 Ga0496110_0615947 3300048913 Bacteria 984
517 Ga0496111_0040302 3300048914 Bacteria 3350
518 Ga0496111_0147239 3300048914 Bacteria 1746
519 Ga0496111_0209481 3300048914 Bacteria 1448
520 Ga0496111_0469200 3300048914 Bacteria 928
521 Ga0496112_0012229 3300048915 Bacteria 7879
522 Ga0496112_0025634 3300048915 Bacteria 5663
523 Ga0496113_0662113 3300048916 Bacteria 834
524 Ga0496114_0004423 3300048917 Bacteria 10907
525 Ga0496114_0913209 3300048917 Bacteria 759
526 Ga0496115_0014949 3300048918 Bacteria 5883
527 Ga0496115_0019746 3300048918 Bacteria 5189
528 Ga0496115_0128737 3300048918 Bacteria 2086
529 Ga0496115_0159969 3300048918 Bacteria 1861
530 Ga0496117_0125246 3300048920 Bacteria 1570
531 Ga0496118_0497839 3300048921 Bacteria 607
532 Ga0496121_0120593 3300048924 Bacteria 1981
533 Ga0496121_0270060 3300048924 Bacteria 1169
534 Ga0496121_0609782 3300048924 Bacteria 672
535 Ga0496124_0213718 3300048927 Bacteria 1457
536 Ga0496126_0005831 3300048929 Bacteria 13924
537 Ga0496126_0032606 3300048929 Bacteria 4906
538 Ga0496126_0389043 3300048929 Bacteria 1133
539 Ga0496126_0399776 3300048929 Bacteria 1114
540 Ga0501067_0383592 3300049583 Bacteria 784
541 nmdc:mga03683_491508_c1 3300050489 Bacteria 593
542 nmdc:mga03683_637886_c1 3300050489 Bacteria 523
543 nmdc:mga00v17_834495_c1 3300050491 Bacteria 586
544 nmdc:mga0yw44_125590_c1 3300050492 Bacteria 1657
545 nmdc:mga0yw44_31797_c1 3300050492 Bacteria 3071
546 nmdc:mga0yw44_503758_c1 3300050492 Bacteria 822
547 nmdc:mga0yw44_91277_c1 3300050492 Bacteria 1925
548 nmdc:mga0k408_148173_c1 3300050493 Bacteria 1397
549 nmdc:mga0k408_205461_c2 3300050493 Bacteria 800
550 nmdc:mga0k408_459337_c1 3300050493 Bacteria 756
551 nmdc:mga06z11_262640_c1 3300050494 Bacteria 1019
552 nmdc:mga06z11_452217_c1 3300050494 Bacteria 776
553 nmdc:mga06z11_8466_c1 3300050494 Bacteria 4291
554 nmdc:mga04h51_110906_c1 3300050495 Bacteria 1011
555 nmdc:mga04h51_55291_c1 3300050495 Bacteria 1344
556 nmdc:mga07m45_6750_c1 3300050496 Bacteria 1179
557 nmdc:mga05p37_196622_c1 3300050507 Bacteria 2445
558 nmdc:mga08y16_805746_c1 3300050511 Unclassified 932
559 nmdc:mga0n895_13760_c1 3300050512 Bacteria 7317
560 nmdc:mga0rr50_144231_c1 3300050513 Bacteria 1918
561 nmdc:mga0rr50_741232_c1 3300050513 Bacteria 838
562 nmdc:mga08x19_50119_c1 3300050514 Bacteria 2678
563 nmdc:mga08x19_61530_c1 3300050514 Bacteria 2433
564 nmdc:mga08x19_619177_c1 3300050514 Bacteria 767
565 nmdc:mga0a205_653515_c1 3300050515 Bacteria 903
566 nmdc:mga0sz30_145405_c1 3300050516 Bacteria 1047
567 nmdc:mga0sz30_360742_c1 3300050516 Bacteria 650
568 nmdc:mga0sz30_397579_c1 3300050516 Bacteria 617
569 Ga0495601_0301777 3300053077 Bacteria 1043
570 Ga0495612_0157977 3300053078 Bacteria 989
571 Ga0495595_0183165 3300053084 Bacteria 1039
572 Ga0495619_0059248 3300053085 Bacteria 2544
573 Ga0500583_0108192 3300053092 Bacteria 1367
574 Ga0500655_009005 3300053133 Bacteria 1796
575 Ga0500658_0072704 3300053134 Bacteria 1455
576 Ga0500559_0009452 3300053136 Bacteria 4218
577 Ga0500603_051358 3300053150 Bacteria 1129
578 Ga0500639_097955 3300053163 Bacteria 1449
579 Ga0500636_0049352 3300053177 Bacteria 2476
580 Ga0500645_029720 3300053730 Bacteria 1648
581 Ga0500601_003418 3300053737 Bacteria 1721
582 2509147817 2508501128 Bacteria 8613869
583 2793078833
584 2824685738 2824679649 Bacteria 8248951
585 2876817820 2876808645 Bacteria 8824342
586 2879116804 2879110137 Bacteria 8907982
587 2885387304 2885383462 Bacteria 9473874
588 2889034458 2889033259 Bacteria 9099371
589 2922366554 2922361189 Bacteria 7436256
590 2922389536 2922386360 Bacteria 7017218
591 2922398332 2922393267 Bacteria 8285685
592 8006932930 8006926726 Bacteria 6749210
593 8006971083 8006964411 Bacteria 8966052
594 8006996797 8006994254 Bacteria 8309700
595 8056675377 8056673599 Bacteria 7871253
596 8056685556 8056681323 Bacteria 8472857
597 Ga0307516_10053240
598 JGI24739J22299_10030504
599 JGI24737J22298_10002347
600 JGI24735J21928_10101567
601 rootH1_10019068
602 Ga0055529_1049128
603 Ga0070690_100037484
604 Ga0070690_100375042
605 Ga0070670_100060834
606 Ga0068869_100254987
607 Ga0070666_10004960
608 Ga0068868_100100778
609 Ga0068868_101978623
610 Ga0070689_100470638
611 Ga0070689_100563710
612 Ga0070691_10256568
613 Ga0070668_100296204
614 Ga0070668_101140734
615 Ga0070668_101579991
616 Ga0070668_102149887
617 Ga0070669_100235249
618 Ga0070675_100256096
619 Ga0070671_100674123
620 Ga0070671_101096899
621 Ga0070674_100888105
622 Ga0070688_100137146
623 Ga0070659_101001387
624 Ga0070667_100089815
625 Ga0070667_100495448
626 Ga0070667_101540081
627 Ga0070703_10241851
628 Ga0070709_10236761
629 Ga0070709_11203803
630 Ga0070714_100290700
631 Ga0070714_101118137
632 Ga0070713_100005990
633 Ga0070713_100291741
634 Ga0070713_100330419
635 Ga0070710_11148947
636 Ga0070711_100004982
637 Ga0070711_100379279
638 Ga0070711_101062359
639 Ga0070705_100951340
640 Ga0070700_101974506
641 Ga0070663_100073751
642 Ga0070663_100239235
643 Ga0070663_100319448
644 Ga0070663_100320808
645 Ga0070663_100505009
646 Ga0070663_101653058
647 Ga0070678_100345611
648 Ga0070678_100483667
649 Ga0070678_100827993
650 Ga0070678_101516938
651 Ga0070662_100742709
652 Ga0070662_101146000
653 Ga0070681_10024432
654 Ga0070681_10080702
655 Ga0070681_10258569
656 Ga0070706_100415779
657 Ga0070698_100028998
658 Ga0070698_100911268
659 Ga0070679_100009248
660 Ga0070679_100075893
661 Ga0068853_100210598
662 Ga0068853_100517318
663 Ga0070672_100968967
664 Ga0070672_101091826
665 Ga0070686_100487026
666 Ga0070686_101570809
667 Ga0070695_100359125
668 Ga0070693_100228290
669 Ga0070665_100013100
670 Ga0070665_100080609
671 Ga0070665_100732835
672 Ga0070665_101571943
673 Ga0070704_101604942
674 Ga0068855_100051001
675 Ga0068855_100193304
676 Ga0068855_101188578
677 Ga0068855_101243336
678 Ga0068857_100028661
679 Ga0068857_100980136
680 Ga0068854_100014717
681 Ga0068856_100035106
682 Ga0068856_101039525
683 Ga0070702_100256668
684 Ga0068859_100040226
685 Ga0068864_100235961
686 Ga0068864_100486535
687 Ga0068866_10302007
688 Ga0068861_100748718
689 Ga0068861_102715415
690 Ga0068870_10453388
691 Ga0068870_11039597
692 Ga0068863_100206790
693 Ga0068860_100027726
694 Ga0068860_100292732
695 Ga0068860_101015534
696 Ga0068860_101759025
697 Ga0068862_100228976
698 Ga0068862_100638985
699 Ga0081540_1005216
700 Ga0081540_1007193
701 Ga0081540_1076704
702 Ga0070717_10000460
703 Ga0070717_10110309
704 Ga0070717_11077288
705 Ga0075365_10016437
706 Ga0075365_10075675
707 Ga0075365_10144811
708 Ga0075365_11209712
709 Ga0075368_10070444
710 Ga0075368_10122637
711 Ga0075363_100014770
712 Ga0070715_10107371
713 Ga0070716_100034174
714 Ga0070716_100154821
715 Ga0070716_100970695
716 Ga0070712_100073635
717 Ga0070712_101622439
718 Ga0075362_10130809
719 Ga0075367_10040157
720 Ga0075367_10136379
721 Ga0075369_10117031
722 Ga0075369_10142974
723 Ga0075369_10191822
724 Ga0075366_10032034
725 Ga0075366_10107607
726 Ga0075366_10874182
727 Ga0097621_100774264
728 Ga0075370_10020322
729 Ga0075370_10138407
730 Ga0068871_100154020
731 Ga0075428_101303858
732 Ga0075433_10377914
733 Ga0075434_100016328
734 Ga0068865_100041421
735 Ga0068865_100109505
736 Ga0068865_100559409
737 Ga0068865_101931941
738 Ga0075436_100057729
739 Ga0075436_100059273
740 Ga0097620_100040226
741 Ga0075435_100704487
742 Ga0099795_10000005
743 Ga0099795_10366344
744 Ga0105240_10016877
745 Ga0105240_10087516
746 Ga0105240_10888648
747 Ga0111539_10124402
748 Ga0111539_11133052
749 Ga0111539_13203975
750 Ga0105245_10014079
751 Ga0105245_10464643
752 Ga0105245_11950086
753 Ga0105247_10080734
754 Ga0105247_10177383
755 Ga0105247_10207519
756 Ga0105247_10244064
757 Ga0105247_10394507
758 Ga0105247_10583282
759 Ga0105247_10913872
760 Ga0114129_10144511
761 Ga0105243_10353713
762 Ga0105243_10501348
763 Ga0105243_10562906
764 Ga0105243_11385250
765 Ga0105243_12123316
766 Ga0105241_10225918
767 Ga0105242_10015747
768 Ga0105248_10330687
769 Ga0105248_10410344
770 Ga0105237_10106632
771 Ga0105237_10273970
772 Ga0105237_10276157
773 Ga0105237_10342514
774 Ga0105237_11336302
775 Ga0105238_10305586
776 Ga0105238_10524792
777 Ga0105238_11735058
778 Ga0105249_10513667
779 Ga0105249_10681283
780 Ga0105249_11022958
781 Ga0105249_11065330
782 Ga0105249_11122386
783 Ga0099796_10000023
784 Ga0099796_10099297
785 Ga0105239_10015287
786 Ga0105239_10658645
787 Ga0105239_11224090
788 Ga0105246_10206627
789 Ga0157369_10307557
790 Ga0157369_10488407
791 Ga0157374_10035603
792 Ga0157378_10677672
793 Ga0163162_10159796
794 Ga0163162_10351084
795 Ga0163162_10980066
796 Ga0163162_11499894
797 Ga0163162_11624024
798 Ga0163162_12163275
799 Ga0157375_10406560
800 Ga0157375_11029961
801 Ga0157375_12416927
802 Ga0157375_12758439
803 Ga0157375_13293055
804 Ga0163163_10012089
805 Ga0163163_10073225
806 Ga0163163_10203034
807 Ga0157380_10109465
808 Ga0157380_10283829
809 Ga0157380_10428354
810 Ga0157380_11317117
811 Ga0157377_10356285
812 Ga0157379_10023444
813 Ga0157379_10148040
814 Ga0157376_10014415
815 Ga0157376_10095961
816 Ga0157376_11195247
817 Ga0157376_11385431
818 Ga0157376_12989432
819 Ga0163161_10149977
820 Ga0163161_10410046
821 Ga0163161_10790755
822 Ga0163161_11129742
823 Ga0228598_1013692
824 Ga0209148_1016579
825 Ga0209233_1000694
826 Ga0209455_1001710
827 Ga0207692_10474809
828 Ga0207710_10201434
829 Ga0207688_10088637
830 Ga0207688_10094246
831 Ga0207688_10187461
832 Ga0207680_10625090
833 Ga0207680_10697480
834 Ga0207647_10001253
835 Ga0207685_10117700
836 Ga0207699_10230614
837 Ga0207699_10646900
838 Ga0207699_10801374
839 Ga0207645_10267439
840 Ga0207643_10399027
841 Ga0207643_10642631
842 Ga0207684_10596827
843 Ga0207707_10032842
844 Ga0207707_10089803
845 Ga0207695_10109077
846 Ga0207695_10112712
847 Ga0207695_10981668
848 Ga0207671_10232053
849 Ga0207671_10307417
850 Ga0207671_10413225
851 Ga0207693_10009325
852 Ga0207693_10244528
853 Ga0207693_11156517
854 Ga0207663_10025502
855 Ga0207663_10852348
856 Ga0207660_11630639
857 Ga0207662_10173318
858 Ga0207652_10010710
859 Ga0207681_10620603
860 Ga0207650_10074994
861 Ga0207687_10441628
862 Ga0207687_10618365
863 Ga0207700_10010911
864 Ga0207700_11183912
865 Ga0207700_11922123
866 Ga0207664_10059318
867 Ga0207664_10440064
868 Ga0207644_10871198
869 Ga0207644_11143662
870 Ga0207706_10231959
871 Ga0207706_11455376
872 Ga0207686_10063429
873 Ga0207709_10613756
874 Ga0207670_10388045
875 Ga0207669_10345806
876 Ga0207704_10568657
877 Ga0207704_11232176
878 Ga0207665_10023296
879 Ga0207665_10091265
880 Ga0207665_10412065
881 Ga0207665_10456128
882 Ga0207711_10125296
883 Ga0207711_10333584
884 Ga0207711_10630299
885 Ga0207689_10184753
886 Ga0207667_10039623
887 Ga0207667_10108706
888 Ga0207667_10786977
889 Ga0207667_10974270
890 Ga0207651_10612600
891 Ga0207712_10867750
892 Ga0207668_10173030
893 Ga0207668_10624358
894 Ga0207668_10951351
895 Ga0207668_10979695
896 Ga0207640_10021128
897 Ga0207658_10262033
898 Ga0207658_10312079
899 Ga0207658_10681309
900 Ga0207658_11647929
901 Ga0207677_10063069
902 Ga0207677_10535789
903 Ga0207677_12014990
904 Ga0207703_10103043
905 Ga0207639_10474867
906 Ga0207639_10564999
907 Ga0207678_10025952
908 Ga0207678_10268443
909 Ga0207678_10402078
910 Ga0207678_11546810
911 Ga0207708_10353523
912 Ga0207702_10013602
913 Ga0207641_10805947
914 Ga0207641_11314141
915 Ga0207641_11543134
916 Ga0207676_11853785
917 Ga0207674_10016173
918 Ga0207674_11053503
919 Ga0207675_100251674
920 Ga0207675_101133473
921 Ga0207683_10051305
922 Ga0207683_10155090
923 Ga0207683_10323726
924 Ga0209179_1000175
925 Ga0209813_10128353
926 Ga0207428_10306685
927 Ga0207428_10368040
928 Ga0268266_10001136
929 Ga0268266_10124447
930 Ga0268266_11104722
931 Ga0268265_10192550
932 Ga0268265_10198444
933 Ga0268264_10062809
934 Ga0268264_10865538
935 Ga0307517_10000098
936 Ga0307515_10104075
937 Ga0265760_10333543
938 Ga0265332_10113667
939 Ga0265325_10030068
940 Ga0265339_10102808
941 Ga0265339_10220362
942 Ga0265331_10161814
943 Ga0265316_11123974
944 Ga0307513_10418783
945 Ga0307508_10127944
946 Ga0265314_10156693
947 Ga0265342_10115041
948 Ga0307516_10171105
949 Ga0307412_10627228
950 Ga0307416_100665573
951 Ga0307510_10327889
952 Ga0307510_10453756
953 Ga0307510_10587261
954 Ga0373938_0012168
955 Ga0373938_0082383
956 Ga0373929_0073539
957 Ga0373940_0012825
958 Ga0373949_0023335
959 Ga0373949_0278187
960 Ga0373923_0460800
961 Ga0373939_0059957
962 Ga0373941_0041926
963 Ga0373941_0391181
964 Ga0373945_0075784
965 Ga0373945_0467734
966 Ga0373957_0342591
967 Ga0373943_0136937
968 Ga0373961_0075393
969 Ga0373962_0030285
970 Ga0373962_0056827
971 Ga0373924_0161939
972 Ga0373931_0003428
973 Ga0373931_0004512
974 Ga0373931_0020927
975 Ga0373935_0097809
976 Ga0373935_0344725
977 Ga0373927_0005938
978 Ga0373927_0039246
979 Ga0373927_0470479
980 Ga0373933_0000026
981 Ga0373947_0052793
982 Ga0373947_0331050
983 Ga0373937_0613407
984 Ga0373925_0013452
985 Ga0373925_0120413
986 Ga0373925_0165062
987 Ga0395898_0035872
988 Ga0395898_0620566
989 Ga0395898_0991435
990 Ga0395905_0462821
991 Ga0395901_0181283
992 Ga0436365_0939476
993 Ga0436363_0400675
994 Ga0436362_0741099
995 Ga0451789_0967346
996 Ga0451791_0402788
997 Ga0451791_1176742
998 Ga0451793_0828375
999 Ga0451798_0016358
1000 Ga0451802_1435137
1001 Ga0451807_1414763
1002 Ga0451837_0986133
1003 Ga0451841_1414058
1004 Ga0451855_0305929
1005 Ga0466966_0038431
1006 Ga0466961_0572202
1007 Ga0466963_0540088
1008 Ga0466964_0663256
1009 Ga0466959_0053125
1010 Ga0466959_0394516
1011 Ga0466958_0752862
1012 Ga0466958_1080037
1013 Ga0466967_0563761
1014 Ga0495617_015095
1015 Ga0495627_124392
1016 Ga0495603_0043229
1017 Ga0495603_0074854
1018 Ga0495603_0689354
1019 Ga0495590_0220458
1020 Ga0495638_0576889
1021 Ga0495641_0092177
1022 Ga0495651_0259012
1023 Ga0495650_0063664
1024 Ga0495650_0113151
1025 Ga0495582_0357182
1026 Ga0495582_0812928
1027 Ga0495605_0241247
1028 Ga0495639_0050090
1029 Ga0495585_0311796
1030 Ga0495596_0141335
1031 Ga0495596_0163228
1032 Ga0495607_0429765
1033 Ga0495607_0510177
1034 Ga0495630_0269329
1035 Ga0495643_0074090
1036 Ga0495644_0052273
1037 Ga0495644_0088630
1038 Ga0495663_0120853
1039 Ga0495665_0489016
1040 Ga0495598_0046091
1041 Ga0495621_0018971
1042 Ga0495621_0441835
1043 Ga0495645_0363161
1044 Ga0495622_0269882
1045 Ga0495633_0053651
1046 Ga0495656_0084365
1047 Ga0495656_0214078
1048 Ga0495656_0788141
1049 Ga0495668_0029504
1050 Ga0495668_0052320
1051 Ga0495668_0082172
1052 Ga0495668_0332061
1053 Ga0495611_0442893
1054 Ga0495625_0376015
1055 Ga0495635_0145633
1056 Ga0495588_0007336
1057 Ga0495588_0110523
1058 Ga0495647_0538129
1059 Ga0495669_0269583
1060 Ga0495670_0039207
1061 Ga0495670_0112447
1062 Ga0495670_0163148
1063 Ga0495671_0089738
1064 Ga0495589_0103033
1065 Ga0495589_0111160
1066 Ga0495604_0498872
1067 Ga0495636_0077561
1068 Ga0495683_0474998
1069 Ga0495675_0606690
1070 Ga0495677_0067538
1071 Ga0495677_0191472
1072 Ga0495679_160933
1073 Ga0495673_0083456
1074 Ga0495673_0186672
1075 Ga0495684_0547276
1076 Ga0495615_0052012
1077 Ga0495626_0127656
1078 Ga0496100_0394592
1079 Ga0496100_0641603
1080 Ga0496100_1409896
1081 Ga0496101_0075055
1082 Ga0496101_0105094
1083 Ga0496101_0453350
1084 Ga0496101_0514497
1085 Ga0496102_0380154
1086 Ga0496102_0962906
1087 Ga0496102_1057104
1088 Ga0496103_0296231
1089 Ga0496103_0332347
1090 Ga0496103_0789321
1091 Ga0496104_0003553
1092 Ga0496104_0026734
1093 Ga0496104_0208151
1094 Ga0496104_0273637
1095 Ga0496104_0436381
1096 Ga0496104_0558364
1097 Ga0496105_0005843
1098 Ga0496105_0066489
1099 Ga0496105_0258568
1100 Ga0496105_0345596
1101 Ga0496106_0355229
1102 Ga0496106_0806805
1103 Ga0496107_0537257
1104 Ga0496107_1132600
1105 Ga0496108_0020730
1106 Ga0496108_0262230
1107 Ga0496109_0188347
1108 Ga0496109_1789872
1109 Ga0496110_0107424
1110 Ga0496110_0371924
1111 Ga0496110_0595230
1112 Ga0496110_0615947
1113 Ga0496111_0040302
1114 Ga0496111_0147239
1115 Ga0496111_0209481
1116 Ga0496111_0469200
1117 Ga0496112_0012229
1118 Ga0496112_0025634
1119 Ga0496113_0662113
1120 Ga0496114_0004423
1121 Ga0496114_0913209
1122 Ga0496115_0014949
1123 Ga0496115_0019746
1124 Ga0496115_0128737
1125 Ga0496115_0159969
1126 Ga0496117_0125246
1127 Ga0496118_0497839
1128 Ga0496121_0120593
1129 Ga0496121_0270060
1130 Ga0496121_0609782
1131 Ga0496124_0213718
1132 Ga0496126_0005831
1133 Ga0496126_0032606
1134 Ga0496126_0389043
1135 Ga0496126_0399776
1136 Ga0501067_0383592
1137 nmdc:mga03683_491508_c1
1138 nmdc:mga03683_637886_c1
1139 nmdc:mga00v17_834495_c1
1140 nmdc:mga0yw44_125590_c1
1141 nmdc:mga0yw44_31797_c1
1142 nmdc:mga0yw44_503758_c1
1143 nmdc:mga0yw44_91277_c1
1144 nmdc:mga0k408_148173_c1
1145 nmdc:mga0k408_205461_c2
1146 nmdc:mga0k408_459337_c1
1147 nmdc:mga06z11_262640_c1
1148 nmdc:mga06z11_452217_c1
1149 nmdc:mga06z11_8466_c1
1150 nmdc:mga04h51_110906_c1
1151 nmdc:mga04h51_55291_c1
1152 nmdc:mga07m45_6750_c1
1153 nmdc:mga05p37_196622_c1
1154 nmdc:mga08y16_805746_c1
1155 nmdc:mga0n895_13760_c1
1156 nmdc:mga0rr50_144231_c1
1157 nmdc:mga0rr50_741232_c1
1158 nmdc:mga08x19_50119_c1
1159 nmdc:mga08x19_61530_c1
1160 nmdc:mga08x19_619177_c1
1161 nmdc:mga0a205_653515_c1
1162 nmdc:mga0sz30_145405_c1
1163 nmdc:mga0sz30_360742_c1
1164 nmdc:mga0sz30_397579_c1
1165 Ga0495601_0301777
1166 Ga0495612_0157977
1167 Ga0495595_0183165
1168 Ga0495619_0059248
1169 Ga0500583_0108192
1170 Ga0500655_009005
1171 Ga0500658_0072704
1172 Ga0500559_0009452
1173 Ga0500603_051358
1174 Ga0500639_097955
1175 Ga0500636_0049352
1176 Ga0500645_029720
1177 Ga0500601_003418
1178 2509147817
1179 2793078833
1180 2824685738
1181 2876817820
1182 2879116804
1183 2885387304
1184 2889034458
1185 2922366554
1186 2922389536
1187 2922398332
1188 8006932930
1189 8006971083
1190 8006996797
1191 8056675377
1192 8056685556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6569 6 113
3nn3-assembly1.cif.gz_C structure of chlorite dismutase from candidatus nitrospira defluvii r173a mutant 0.6161 2 118
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6108 4 115
2nzc-assembly1.cif.gz_C the structure of uncharacterized protein tm1266 from thermotoga maritima. 0.5978 4 116
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.5942 6 113
ID Description Score Start End Superfamily
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6496 5 121 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6467 7 113 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6281 5 121 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6108 4 115 3.30.70.1060
2nzcC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6062 4 116 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A6N6STJ8-F1-model_v4 YCII-related domain-containing protein 0.9433 5 121
AF-A0A0Q7EPN5-F1-model_v4 YCII-related domain-containing protein 0.9407 4 118
AF-A0A3N8DQT5-F1-model_v4 deleted 0.9401 1 121
AF-A0A1E4FS47-F1-model_v4 YCII-related domain-containing protein 0.9399 2 121
AF-A0A2U0T9G8-F1-model_v4 deleted 0.9397 5 121

Map