F467566

General Info

Members Datasets Scaffolds Average Seq Length
596 291 436 307

Family's Representative Sequence

Representative Sequence 3300027312|Ga0209371_1001911|Ga0209371_10019117
Length 339
Sequence MEFLNFPITHSNRPGQLQTSDLTVNNNMINANRPILNLDLDLLRTFVAVADLNTFAAAAVAVSRTQSAVSQQMQRLEQLVGKELFARHGRNKLLTEHGIQLLGYARKILRFNDEACMSLMFSNLQGVLTLGASDETADTILPFVLSRITSVYPKLALDVRVKRNPQMQDMLAQQEVDLIITAHRQLQGESVVLRRSPTLWYCAADYILQPGEPIPLVLLDDPSPCRDLLLAKLNEAGLSWRIAYVASTLPAMRAAVKAGLGITARPVEMMSPELRVLGQSEGLPLLPETEYHLSRNPNSVNELADVIFEAMESLQTPWRYTAPVDGGDDSVLLDGSISE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
8 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
9 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
10 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
11 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
44 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
45 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
46 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
47 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
48 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
49 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
50 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
51 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
52 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
53 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
54 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
55 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
56 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
57 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
58 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
59 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
60 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
61 2636415599 Klebsiella variicola DX120E Isolate Unclassified
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
64 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
65 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
66 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
67 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
68 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
69 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
70 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
71 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
72 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
73 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
74 2751185917 Enterobacter sp. HK169 Isolate Unclassified
75 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
76 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
77 2775507074 Klebsiella sp. D5A Isolate Unclassified
78 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
79 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
80 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
81 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
82 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
83 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
84 2821118458 Enterobacter asburiae 609 Isolate Unclassified
85 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
86 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
87 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
88 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
89 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
90 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
91 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
92 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
93 2847085930 Erwinia persicina B64 Isolate Bulb
94 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
95 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
96 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
97 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
98 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
99 2865014394 Pantoea sp. R-71966 Isolate Unclassified
100 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
101 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
102 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
103 2876601092 Pantoea endophytica 596 Isolate Unclassified
104 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
105 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
106 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
107 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
108 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
109 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
110 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
111 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
112 2904504865 Serratia marcescens 1822 Isolate Unclassified
113 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
114 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
115 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
116 2919150387 Rahnella aceris 1817 Isolate Unclassified
117 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
118 2927143783 Rahnella sp. 2050 Isolate Unclassified
119 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
120 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
121 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
122 2932406140 Serratia sp. 2723 Isolate Rhizosphere
123 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
124 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
125 2937539931 Pantoea sp. LS15 Isolate Unclassified
126 2937967321 Serratia sp. YC16 Isolate Unclassified
127 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
128 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
129 2939577877 Serratia sp. 509 Isolate Rhizosphere
130 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
131 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
132 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
133 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
134 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
135 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
136 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
137 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
138 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
139 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
140 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
141 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
142 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
143 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
144 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
145 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
146 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
147 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
148 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
149 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
150 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
151 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
152 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
153 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
154 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
155 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
156 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
157 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
158 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
159 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
160 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
161 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
162 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
165 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
166 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
167 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
168 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
169 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
170 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
171 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
174 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
175 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
184 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
185 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
186 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
187 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
188 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
191 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
197 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
198 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
199 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
201 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
202 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
215 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
220 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
225 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
226 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
227 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
273 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 640753048 Serratia proteamaculans 568 Isolate Endosphere
277 8004592986 Serratia sp. S119 Isolate Unclassified
278 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
279 8018221730 Enterobacter sp. CM29 Isolate Unclassified
280 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
281 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
282 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
283 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
284 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
285 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
286 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
287 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
288 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
289 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
290 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
291 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.15
Metatranscriptomes 0
Isolates 26.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0.17
Endosphere 5.87
Nodule 3.86
Rhizoplane 10.23
Rhizosphere 49.5
Stem 0
Stem Tuber 0.84
Unclassified 28.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1007981 2162886007 Bacteria 1633
2 SwRhRL2b_contig_249162 2162886007 Bacteria 1767
3 SwRhRL2b_contig_2803902 2162886007 Bacteria 1879
4 JGI24739J22299_10000706 3300001989 Bacteria 12127
5 JGI25162J39368_1001723 3300002737 Bacteria 10554
6 JGI25163J39215_1000024 3300002771 Bacteria 70395
7 JGI25164J39214_1000006 3300002772 Bacteria 342675
8 JGI25152J39213_1000602 3300002773 Bacteria 19375
9 rootH2_10052056 3300003320 Bacteria 13419
10 rootL2_10241135 3300003322 Bacteria 1176
11 JGI25404J52841_10011797 3300003659 Bacteria 1888
12 Ga0055538_1000003 3300003751 Bacteria 663004
13 Ga0055539_1000003 3300003752 Bacteria 663004
14 Ga0055533_1000005 3300003756 Bacteria 663004
15 Ga0055525_1000005 3300003759 Bacteria 663004
16 Ga0055541_1000003 3300003841 Bacteria 663004
17 Ga0058692_1000092 3300003856 Bacteria 60796
18 Ga0058692_1000734 3300003856 Bacteria 13270
19 Ga0058692_1001682 3300003856 Bacteria 7946
20 Ga0058692_1006885 3300003856 Bacteria 3068
21 Ga0058692_1010042 3300003856 Bacteria 2356
22 Ga0065704_10000626 3300005289 Bacteria 28367
23 Ga0065704_10000641 3300005289 Bacteria 21869
24 Ga0065704_10002692 3300005289 Bacteria 11284
25 Ga0065704_10007183 3300005289 Bacteria 4853
26 Ga0065704_10226666 3300005289 Bacteria 1054
27 Ga0070668_100001634 3300005347 Bacteria 16235
28 Ga0070659_100116473 3300005366 Bacteria 2160
29 Ga0070665_100000374 3300005548 Bacteria 66650
30 Ga0070665_100003075 3300005548 Bacteria 17973
31 Ga0068857_100003218 3300005577 Bacteria 13546
32 Ga0081540_1000318 3300005983 Bacteria 49953
33 Ga0075364_10029957 3300006051 Bacteria 3492
34 Ga0075364_10042583 3300006051 Bacteria 2951
35 Ga0075364_10075610 3300006051 Bacteria 2222
36 Ga0075364_10123318 3300006051 Bacteria 1736
37 Ga0075366_10036629 3300006195 Bacteria 2893
38 Ga0079104_1000135 3300006946 Bacteria 103632
39 Ga0079104_1000487 3300006946 Bacteria 43465
40 Ga0079104_1001580 3300006946 Bacteria 14875
41 Ga0079104_1002664 3300006946 Bacteria 9242
42 Ga0079104_1003160 3300006946 Bacteria 7982
43 Ga0079104_1012092 3300006946 Bacteria 2736
44 Ga0079104_1023007 3300006946 Bacteria 1665
45 Ga0079104_1031496 3300006946 Bacteria 1314
46 Ga0105251_10000500 3300009011 Bacteria 37162
47 Ga0105251_10001963 3300009011 Bacteria 16815
48 Ga0105251_10002226 3300009011 Bacteria 15475
49 Ga0105251_10005553 3300009011 Bacteria 8207
50 Ga0105251_10005950 3300009011 Bacteria 7876
51 Ga0105251_10006165 3300009011 Bacteria 7711
52 Ga0105251_10008186 3300009011 Bacteria 6324
53 Ga0105251_10020515 3300009011 Bacteria 3470
54 Ga0105251_10025169 3300009011 Bacteria 3048
55 Ga0105251_10025176 3300009011 Bacteria 3048
56 Ga0105251_10029601 3300009011 Bacteria 2757
57 Ga0105251_10036377 3300009011 Bacteria 2423
58 Ga0105251_10036378 3300009011 Bacteria 2423
59 Ga0105251_10102414 3300009011 Bacteria 1308
60 Ga0105251_10105297 3300009011 Bacteria 1288
61 Ga0105244_10000040 3300009036 Bacteria 157237
62 Ga0105244_10000246 3300009036 Bacteria 55589
63 Ga0105244_10000337 3300009036 Bacteria 44183
64 Ga0105244_10000342 3300009036 Bacteria 43837
65 Ga0105244_10001474 3300009036 Bacteria 19004
66 Ga0105244_10002267 3300009036 Bacteria 14624
67 Ga0105244_10007356 3300009036 Bacteria 7000
68 Ga0105244_10007923 3300009036 Bacteria 6694
69 Ga0105244_10012460 3300009036 Bacteria 5022
70 Ga0105244_10017173 3300009036 Bacteria 4099
71 Ga0105244_10022204 3300009036 Bacteria 3495
72 Ga0105244_10031622 3300009036 Bacteria 2808
73 Ga0105244_10050424 3300009036 Bacteria 2123
74 Ga0105244_10069894 3300009036 Bacteria 1753
75 Ga0105244_10112999 3300009036 Bacteria 1320
76 Ga0105244_10161342 3300009036 Bacteria 1070
77 Ga0105250_10000007 3300009092 Bacteria 355249
78 Ga0105250_10000018 3300009092 Bacteria 246692
79 Ga0105250_10001567 3300009092 Bacteria 12288
80 Ga0105250_10002387 3300009092 Bacteria 9478
81 Ga0105250_10003285 3300009092 Bacteria 7696
82 Ga0105250_10004377 3300009092 Bacteria 6504
83 Ga0105250_10019273 3300009092 Bacteria 2758
84 Ga0105250_10025714 3300009092 Bacteria 2372
85 Ga0105250_10049421 3300009092 Bacteria 1687
86 Ga0105240_10084455 3300009093 Bacteria 3893
87 Ga0105247_10000166 3300009101 Bacteria 64598
88 Ga0105241_10000001 3300009174 Bacteria 879793
89 Ga0105237_10078031 3300009545 Bacteria 3301
90 Ga0105237_10124291 3300009545 Bacteria 2575
91 Ga0105246_10596673 3300011119 Bacteria 954
92 Ga0157373_10000400 3300013100 Bacteria 34834
93 Ga0157373_10003007 3300013100 Bacteria 12751
94 Ga0157373_10009285 3300013100 Bacteria 7271
95 Ga0157373_10012111 3300013100 Bacteria 6340
96 Ga0157371_10000006 3300013102 Bacteria 404774
97 Ga0157371_10000560 3300013102 Bacteria 44059
98 Ga0157371_10000574 3300013102 Bacteria 43590
99 Ga0157371_10001683 3300013102 Bacteria 22533
100 Ga0157371_10002986 3300013102 Bacteria 15709
101 Ga0157371_10167023 3300013102 Bacteria 1572
102 Ga0157370_10000618 3300013104 Bacteria 44184
103 Ga0157370_10000644 3300013104 Bacteria 43467
104 Ga0157370_10002604 3300013104 Bacteria 21687
105 Ga0157369_10000375 3300013105 Bacteria 59272
106 Ga0157369_10375777 3300013105 Bacteria 1475
107 Ga0163162_10022107 3300013306 Bacteria 6268
108 Ga0163162_10033088 3300013306 Bacteria 5135
109 Ga0163162_10158966 3300013306 Bacteria 2381
110 Ga0157372_10001955 3300013307 Bacteria 22388
111 Ga0157372_10002168 3300013307 Bacteria 21369
112 Ga0157372_10016311 3300013307 Bacteria 7972
113 Ga0157372_10021477 3300013307 Bacteria 6975
114 Ga0157372_10469661 3300013307 Bacteria 1466
115 Ga0157372_10470659 3300013307 Bacteria 1465
116 Ga0157375_10449390 3300013308 Bacteria 1454
117 Ga0182006_1000024 3300015261 Bacteria 257431
118 Ga0183366_1001 3300015679 Bacteria 2743932
119 Ga0183370_1001 3300015680 Bacteria 2743932
120 Ga0183369_1001 3300015685 Bacteria 2743932
121 Ga0183368_1001 3300015687 Bacteria 2743932
122 Ga0163161_10000003 3300017792 Bacteria 339847
123 Ga0163161_10057860 3300017792 Bacteria 2817
124 Ga0213876_10000023 3300021384 Bacteria 255370
125 Ga0209760_100093 3300025207 Bacteria 71626
126 Ga0209784_100001 3300025224 Bacteria 3600592
127 Ga0209566_100001 3300025225 Bacteria 3600765
128 Ga0209674_100002 3300025226 Bacteria 3600592
129 Ga0209563_100002 3300025230 Bacteria 2045675
130 Ga0207427_100009 3300025231 Bacteria 663036
131 Ga0209437_100001 3300025233 Bacteria 2045675
132 Ga0209437_100103 3300025233 Bacteria 221904
133 Ga0207425_1006185 3300025245 Bacteria 3304
134 Ga0209677_100002 3300025253 Bacteria 2045675
135 Ga0209129_1000037 3300025258 Bacteria 326534
136 Ga0209233_1001125 3300025261 Bacteria 10912
137 Ga0207696_1000001 3300025711 Bacteria 2579611
138 Ga0207696_1000013 3300025711 Bacteria 524881
139 Ga0207696_1000029 3300025711 Bacteria 398074
140 Ga0207696_1000067 3300025711 Bacteria 228478
141 Ga0207696_1000100 3300025711 Bacteria 171029
142 Ga0207696_1000124 3300025711 Bacteria 139229
143 Ga0207696_1000185 3300025711 Bacteria 97304
144 Ga0207696_1000275 3300025711 Bacteria 61367
145 Ga0207696_1000766 3300025711 Bacteria 21229
146 Ga0207696_1001267 3300025711 Bacteria 14132
147 Ga0207696_1003311 3300025711 Bacteria 7418
148 Ga0207655_1000002 3300025728 Bacteria 1148694
149 Ga0207655_1000004 3300025728 Bacteria 1021221
150 Ga0207655_1000007 3300025728 Bacteria 773492
151 Ga0207655_1000041 3300025728 Bacteria 333962
152 Ga0207655_1000062 3300025728 Bacteria 258054
153 Ga0207655_1000115 3300025728 Bacteria 162114
154 Ga0207655_1000205 3300025728 Bacteria 102993
155 Ga0207655_1000540 3300025728 Bacteria 47892
156 Ga0207655_1004167 3300025728 Bacteria 10378
157 Ga0207655_1006042 3300025728 Bacteria 8094
158 Ga0207655_1007903 3300025728 Bacteria 6830
159 Ga0207655_1010252 3300025728 Bacteria 5699
160 Ga0207655_1017004 3300025728 Bacteria 3945
161 Ga0207655_1020977 3300025728 Bacteria 3335
162 Ga0207655_1027012 3300025728 Bacteria 2744
163 Ga0207655_1051112 3300025728 Bacteria 1673
164 Ga0207713_1000001 3300025735 Bacteria 2295391
165 Ga0207713_1000023 3300025735 Bacteria 346097
166 Ga0207713_1000083 3300025735 Bacteria 160973
167 Ga0207713_1000241 3300025735 Bacteria 72891
168 Ga0207713_1001368 3300025735 Bacteria 19839
169 Ga0207713_1006051 3300025735 Bacteria 7462
170 Ga0207713_1006520 3300025735 Bacteria 7095
171 Ga0207713_1007504 3300025735 Bacteria 6421
172 Ga0207713_1014533 3300025735 Bacteria 4085
173 Ga0207713_1017449 3300025735 Bacteria 3598
174 Ga0207713_1028203 3300025735 Bacteria 2536
175 Ga0207713_1033439 3300025735 Bacteria 2246
176 Ga0207713_1038593 3300025735 Bacteria 2025
177 Ga0207713_1070861 3300025735 Bacteria 1287
178 Ga0207710_10000051 3300025900 Bacteria 182751
179 Ga0207654_10000004 3300025911 Bacteria 902334
180 Ga0207695_10092453 3300025913 Bacteria 3036
181 Ga0207671_10084931 3300025914 Bacteria 2378
182 Ga0207668_10012208 3300025972 Bacteria 5251
183 Ga0207674_10006670 3300026116 Bacteria 13558
184 Ga0209281_1000004 3300027111 Bacteria 1253949
185 Ga0209281_1000014 3300027111 Bacteria 643021
186 Ga0209281_1000095 3300027111 Bacteria 238108
187 Ga0209281_1000219 3300027111 Bacteria 123456
188 Ga0209281_1000286 3300027111 Bacteria 94163
189 Ga0209281_1000404 3300027111 Bacteria 65885
190 Ga0209281_1000523 3300027111 Bacteria 49786
191 Ga0209281_1001556 3300027111 Bacteria 12619
192 Ga0209281_1001951 3300027111 Bacteria 9618
193 Ga0209281_1004107 3300027111 Bacteria 4476
194 Ga0209281_1019742 3300027111 Bacteria 1328
195 Ga0209371_1000001 3300027312 Bacteria 2771503
196 Ga0209371_1000005 3300027312 Bacteria 1061740
197 Ga0209371_1000015 3300027312 Bacteria 659640
198 Ga0209371_1000108 3300027312 Bacteria 141822
199 Ga0209371_1000118 3300027312 Bacteria 134470
200 Ga0209371_1000559 3300027312 Bacteria 34100
201 Ga0209371_1000623 3300027312 Bacteria 31527
202 Ga0209371_1000688 3300027312 Bacteria 28987
203 Ga0209371_1001155 3300027312 Bacteria 19322
204 Ga0209371_1001486 3300027312 Bacteria 15660
205 Ga0209371_1001911 3300027312 Bacteria 12728
206 Ga0209371_1001929 3300027312 Bacteria 12659
207 Ga0209371_1003423 3300027312 Bacteria 7729
208 Ga0209371_1004251 3300027312 Bacteria 6361
209 Ga0209371_1012876 3300027312 Bacteria 2390
210 Ga0268266_10000922 3300028379 Bacteria 37700
211 Ga0268266_10006866 3300028379 Bacteria 10362
212 Ga0268266_10014247 3300028379 Bacteria 6838
213 Ga0268256_1000001 3300030500 Bacteria 2771065
214 Ga0268256_1000006 3300030500 Bacteria 1063991
215 Ga0268256_1000018 3300030500 Bacteria 594572
216 Ga0268256_1000076 3300030500 Bacteria 178295
217 Ga0268256_1000100 3300030500 Bacteria 134526
218 Ga0268256_1000662 3300030500 Bacteria 26147
219 Ga0268256_1001225 3300030500 Bacteria 16220
220 Ga0268256_1001273 3300030500 Bacteria 15660
221 Ga0268256_1002311 3300030500 Bacteria 9873
222 Ga0268256_1003984 3300030500 Bacteria 6361
223 Ga0268256_1005534 3300030500 Bacteria 4927
224 Ga0268256_1006757 3300030500 Bacteria 4209
225 Ga0268256_1014089 3300030500 Bacteria 2390
226 Ga0268256_1016647 3300030500 Bacteria 2097
227 Ga0316575_10035091 3300031665 Bacteria 1971
228 Ga0307409_100148730 3300031995 Unclassified 2030
229 Ga0316574_0012769 3300035398 Bacteria 4814
230 Ga0436365_0965775 3300039437 Bacteria 470291
231 Ga0439438_000002 3300041405 Bacteria 618223
232 Ga0439438_005231 3300041405 Bacteria 4814
233 Ga0439438_005860 3300041405 Bacteria 4450
234 Ga0439447_001765 3300041407 Bacteria 7934
235 Ga0439447_004016 3300041407 Bacteria 5147
236 Ga0439466_0000001 3300041411 Bacteria 647258
237 Ga0451797_0353171 3300041453 Bacteria 2071
238 Ga0439432_010498 3300042006 Bacteria 3205
239 Ga0439432_027729 3300042006 Bacteria 1847
240 Ga0439452_000002 3300042010 Bacteria 1377577
241 Ga0439452_000015 3300042010 Bacteria 342948
242 Ga0439452_000020 3300042010 Bacteria 309345
243 Ga0439452_002528 3300042010 Bacteria 6726
244 Ga0439452_009657 3300042010 Bacteria 2836
245 Ga0439464_0002445 3300042439 Bacteria 4568
246 Ga0450893_0013697 3300042532 Bacteria 1354
247 Ga0466981_0000013 3300044669 Bacteria 129274
248 Ga0495627_000044 3300046453 Bacteria 182964
249 Ga0495591_000001 3300046458 Bacteria 503087
250 Ga0495591_000294 3300046458 Bacteria 45588
251 Ga0495591_007157 3300046458 Bacteria 4788
252 Ga0495638_0000330 3300046460 Bacteria 59733
253 Ga0495638_0007143 3300046460 Bacteria 8045
254 Ga0495650_0000018 3300046471 Bacteria 538888
255 Ga0495650_0000047 3300046471 Bacteria 335136
256 Ga0495650_0000065 3300046471 Bacteria 275124
257 Ga0495650_0017382 3300046471 Bacteria 3607
258 Ga0495584_0009860 3300046491 Bacteria 4911
259 Ga0495596_0008414 3300046500 Bacteria 4595
260 Ga0495606_0002485 3300046507 Bacteria 21334
261 Ga0495616_0032206 3300046513 Bacteria 2741
262 Ga0495620_0017851 3300046515 Bacteria 3527
263 Ga0495643_0020777 3300046522 Bacteria 3778
264 Ga0495644_0005253 3300046523 Bacteria 5060
265 Ga0495648_0012791 3300046524 Bacteria 6232
266 Ga0495648_0014761 3300046524 Bacteria 5694
267 Ga0495654_0000009 3300046530 Bacteria 381872
268 Ga0495654_0001323 3300046530 Bacteria 17296
269 Ga0495654_0002421 3300046530 Bacteria 12017
270 Ga0495654_0012165 3300046530 Bacteria 4630
271 Ga0495654_0025329 3300046530 Bacteria 3057
272 Ga0495654_0052955 3300046530 Bacteria 1974
273 Ga0495597_0002085 3300046542 Bacteria 13313
274 Ga0495668_0068223 3300046616 Bacteria 1956
275 Ga0495625_0011960 3300046660 Bacteria 7044
276 Ga0495671_0002913 3300046692 Bacteria 10671
277 Ga0495649_0006292 3300046694 Bacteria 7387
278 Ga0495649_0007204 3300046694 Bacteria 6820
279 Ga0495649_0044879 3300046694 Bacteria 2412
280 Ga0495589_0000003 3300046794 Bacteria 453448
281 Ga0495589_0015919 3300046794 Bacteria 3866
282 Ga0495660_0000004 3300046810 Bacteria 1003183
283 Ga0495660_0000017 3300046810 Bacteria 320655
284 Ga0495660_0051401 3300046810 Bacteria 2242
285 Ga0495672_0000001 3300047320 Bacteria 1458820
286 Ga0495672_0000009 3300047320 Bacteria 557755
287 Ga0495672_0000038 3300047320 Bacteria 273489
288 Ga0495672_0018695 3300047320 Bacteria 4591
289 Ga0495672_0152440 3300047320 Bacteria 1197
290 Ga0495679_000032 3300047446 Bacteria 171636
291 Ga0495679_001387 3300047446 Bacteria 13885
292 Ga0495679_004343 3300047446 Bacteria 6569
293 Ga0495673_0000019 3300047469 Bacteria 554389
294 Ga0495673_0000071 3300047469 Bacteria 217117
295 Ga0495681_0092937 3300047470 Bacteria 1329
296 Ga0495686_0000890 3300047472 Bacteria 37754
297 Ga0496100_0192608 3300048903 Bacteria 1481
298 Ga0496101_0000060 3300048904 Bacteria 128504
299 Ga0496102_0446199 3300048905 Bacteria 1214
300 Ga0496104_0000212 3300048907 Bacteria 51443
301 Ga0496104_0043660 3300048907 Bacteria 4210
302 Ga0496116_0000007 3300048919 Bacteria 795464
303 Ga0496116_0000118 3300048919 Bacteria 168946
304 Ga0496116_0000420 3300048919 Bacteria 59988
305 Ga0496116_0000446 3300048919 Bacteria 57660
306 Ga0496116_0008956 3300048919 Bacteria 8605
307 Ga0496116_0045032 3300048919 Bacteria 2990
308 Ga0496116_0094903 3300048919 Bacteria 1802
309 Ga0496116_0101262 3300048919 Bacteria 1720
310 Ga0496117_0000009 3300048920 Bacteria 613759
311 Ga0496117_0000113 3300048920 Bacteria 181737
312 Ga0496117_0000504 3300048920 Bacteria 64550
313 Ga0496117_0002374 3300048920 Bacteria 24004
314 Ga0496117_0008055 3300048920 Bacteria 10097
315 Ga0496117_0015866 3300048920 Bacteria 6387
316 Ga0496117_0022485 3300048920 Bacteria 5056
317 Ga0496117_0023323 3300048920 Bacteria 4935
318 Ga0496117_0026137 3300048920 Bacteria 4572
319 Ga0496117_0028793 3300048920 Bacteria 4294
320 Ga0496117_0034473 3300048920 Bacteria 3812
321 Ga0496118_0000017 3300048921 Bacteria 549445
322 Ga0496118_0001101 3300048921 Bacteria 41978
323 Ga0496118_0001258 3300048921 Bacteria 38870
324 Ga0496118_0003548 3300048921 Bacteria 19494
325 Ga0496118_0003973 3300048921 Bacteria 18041
326 Ga0496118_0007913 3300048921 Bacteria 11131
327 Ga0496118_0027245 3300048921 Bacteria 4842
328 Ga0496118_0030028 3300048921 Bacteria 4546
329 Ga0496118_0032195 3300048921 Bacteria 4328
330 Ga0496118_0048594 3300048921 Bacteria 3274
331 Ga0496118_0063503 3300048921 Bacteria 2716
332 Ga0496118_0064079 3300048921 Bacteria 2699
333 Ga0496119_0000012 3300048922 Bacteria 411917
334 Ga0496119_0000129 3300048922 Bacteria 106571
335 Ga0496119_0000194 3300048922 Bacteria 85475
336 Ga0496119_0000202 3300048922 Bacteria 84354
337 Ga0496119_0008725 3300048922 Bacteria 8846
338 Ga0496119_0008995 3300048922 Bacteria 8669
339 Ga0496119_0009094 3300048922 Bacteria 8605
340 Ga0496119_0009390 3300048922 Bacteria 8405
341 Ga0496119_0065211 3300048922 Bacteria 2158
342 Ga0496119_0068678 3300048922 Bacteria 2085
343 Ga0496119_0112989 3300048922 Bacteria 1504
344 Ga0496119_0114688 3300048922 Bacteria 1490
345 Ga0496120_0000004 3300048923 Bacteria 534793
346 Ga0496120_0000081 3300048923 Bacteria 158294
347 Ga0496120_0000179 3300048923 Bacteria 107658
348 Ga0496120_0000186 3300048923 Bacteria 106450
349 Ga0496120_0000291 3300048923 Bacteria 84354
350 Ga0496120_0000632 3300048923 Bacteria 52410
351 Ga0496120_0002896 3300048923 Bacteria 16415
352 Ga0496120_0003856 3300048923 Bacteria 13168
353 Ga0496120_0007026 3300048923 Bacteria 8460
354 Ga0496120_0007219 3300048923 Bacteria 8318
355 Ga0496120_0025306 3300048923 Bacteria 3686
356 Ga0496120_0061959 3300048923 Bacteria 2085
357 Ga0496120_0061961 3300048923 Bacteria 2085
358 Ga0496120_0074672 3300048923 Bacteria 1851
359 Ga0496120_0083692 3300048923 Bacteria 1721
360 Ga0496120_0094160 3300048923 Bacteria 1595
361 Ga0496120_0139123 3300048923 Bacteria 1234
362 Ga0496121_0000224 3300048924 Bacteria 122378
363 Ga0496121_0000287 3300048924 Bacteria 104774
364 Ga0496121_0004374 3300048924 Bacteria 19089
365 Ga0496121_0005804 3300048924 Bacteria 15651
366 Ga0496121_0014381 3300048924 Bacteria 8402
367 Ga0496121_0014797 3300048924 Bacteria 8241
368 Ga0496121_0015535 3300048924 Bacteria 7962
369 Ga0496121_0030731 3300048924 Bacteria 4927
370 Ga0496121_0032050 3300048924 Bacteria 4785
371 Ga0496121_0073114 3300048924 Bacteria 2749
372 Ga0496121_0092980 3300048924 Bacteria 2349
373 Ga0496121_0102893 3300048924 Unclassified 2198
374 Ga0496121_0143252 3300048924 Bacteria 1770
375 Ga0496122_0000003 3300048925 Bacteria 645810
376 Ga0496122_0000303 3300048925 Bacteria 108668
377 Ga0496122_0001179 3300048925 Bacteria 44684
378 Ga0496122_0001758 3300048925 Bacteria 33261
379 Ga0496122_0001770 3300048925 Bacteria 33106
380 Ga0496122_0008975 3300048925 Bacteria 10628
381 Ga0496122_0019515 3300048925 Bacteria 6188
382 Ga0496122_0022640 3300048925 Bacteria 5577
383 Ga0496122_0026269 3300048925 Bacteria 5024
384 Ga0496122_0069458 3300048925 Bacteria 2523
385 Ga0496123_0000012 3300048926 Bacteria 458760
386 Ga0496123_0000250 3300048926 Bacteria 108668
387 Ga0496123_0001176 3300048926 Bacteria 38560
388 Ga0496123_0003273 3300048926 Bacteria 18349
389 Ga0496123_0007059 3300048926 Bacteria 10686
390 Ga0496123_0008944 3300048926 Bacteria 9107
391 Ga0496123_0013533 3300048926 Bacteria 6833
392 Ga0496123_0013718 3300048926 Bacteria 6776
393 Ga0496123_0052416 3300048926 Bacteria 2707
394 Ga0496123_0057447 3300048926 Bacteria 2532
395 Ga0496124_0000027 3300048927 Bacteria 376097
396 Ga0496124_0000028 3300048927 Bacteria 357219
397 Ga0496124_0000738 3300048927 Bacteria 53538
398 Ga0496124_0001085 3300048927 Bacteria 42903
399 Ga0496124_0009187 3300048927 Bacteria 10204
400 Ga0496124_0019429 3300048927 Bacteria 6322
401 Ga0496124_0029037 3300048927 Bacteria 4934
402 Ga0496124_0031900 3300048927 Bacteria 4659
403 Ga0496124_0054137 3300048927 Bacteria 3397
404 Ga0496124_0058592 3300048927 Bacteria 3238
405 Ga0496124_0061003 3300048927 Bacteria 3162
406 Ga0496124_0070220 3300048927 Bacteria 2906
407 Ga0496124_0122247 3300048927 Bacteria 2078
408 Ga0496124_0130881 3300048927 Bacteria 1993
409 Ga0496125_0000052 3300048928 Bacteria 281862
410 Ga0496125_0000296 3300048928 Bacteria 98054
411 Ga0496125_0008709 3300048928 Bacteria 10558
412 Ga0496125_0018411 3300048928 Bacteria 6634
413 Ga0496125_0161645 3300048928 Bacteria 1520
414 Ga0496125_0177661 3300048928 Bacteria 1422
415 Ga0496126_0000410 3300048929 Bacteria 87052
416 Ga0496126_0021260 3300048929 Bacteria 6341
417 Ga0496126_0032462 3300048929 Bacteria 4918
418 Ga0496126_0032812 3300048929 Bacteria 4888
419 Ga0496126_0087522 3300048929 Unclassified 2745
420 Ga0496126_0103446 3300048929 Bacteria 2488
421 Ga0496126_0182957 3300048929 Bacteria 1779
422 Ga0496126_0204324 3300048929 Bacteria 1666
423 Ga0496126_0292835 3300048929 Bacteria 1345
424 Ga0496126_0315378 3300048929 Bacteria 1286
425 Ga0496126_0408428 3300048929 Bacteria 1100
426 Ga0496126_0463109 3300048929 Bacteria 1018
427 Ga0495678_002124 3300049459 Bacteria 14078
428 Ga0495682_0001613 3300049460 Bacteria 11619
429 nmdc:mga00v17_22048_c1 3300050491 Bacteria 3671
430 nmdc:mga00v17_87343_c1 3300050491 Bacteria 1955
431 nmdc:mga00v17_9293_c1 3300050491 Bacteria 5316
432 nmdc:mga0k408_37628_c1 3300050493 Bacteria 2778
433 Ga0500595_005441 3300053119 Bacteria 5560
434 Ga0500621_000070 3300053126 Bacteria 11635
435 Ga0500616_0000390 3300053153 Bacteria 61067
436 Ga0500636_0007910 3300053177 Bacteria 6148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10050424 Ga0105244_100504241 274
2 3300013102 Ga0157371_10000574 Ga0157371_1000057457 274
3 iso_pu_bacteria 2547132416 2548650785 277
4 iso_pu_bacteria 2897803580 2897808431 279
5 iso_pu_bacteria 2597490356 2599102963 280
6 iso_pu_bacteria 2846952575 2846952837 280
7 iso_pu_bacteria 2848858292 2848858371 280
8 iso_pu_bacteria 2821443989 2821447422 281
9 iso_pu_bacteria 2844533157 2844539628 281
10 3300005548 Ga0070665_100003075 Ga0070665_10000307516 282
11 3300028379 Ga0268266_10006866 Ga0268266_100068662 282
12 3300031995 Ga0307409_100148730 Ga0307409_1001487302 282
13 3300046460 Ga0495638_0000330 Ga0495638_0000330_40413_41285 282
14 3300047320 Ga0495672_0018695 Ga0495672_0018695_2244_3116 282
15 3300047472 Ga0495686_0000890 Ga0495686_0000890_19639_20511 282
16 3300048920 Ga0496117_0022485 Ga0496117_0022485_2734_3606 282
17 3300048921 Ga0496118_0032195 Ga0496118_0032195_1711_2583 282
18 3300048922 Ga0496119_0065211 Ga0496119_0065211_21_887 282
19 3300048924 Ga0496121_0000287 Ga0496121_0000287_71018_71890 282
20 3300048924 Ga0496121_0004374 Ga0496121_0004374_9510_10382 282
21 3300048924 Ga0496121_0032050 Ga0496121_0032050_3534_4406 282
22 3300048924 Ga0496121_0073114 Ga0496121_0073114_608_1480 282
23 3300048924 Ga0496121_0143252 Ga0496121_0143252_134_994 282
24 3300048929 Ga0496126_0087522 Ga0496126_0087522_124_984 282
25 3300053119 Ga0500595_005441 Ga0500595_005441_1159_2019 282
26 3300053153 Ga0500616_0000390 Ga0500616_0000390_27741_28613 282
27 3300053177 Ga0500636_0007910 Ga0500636_0007910_4058_4930 282
28 3300048924 Ga0496121_0102893 Ga0496121_0102893_536_1399 283
29 iso_pu_bacteria 2929615660 2929618283 284
30 iso_pu_bacteria 2929624759 2929632471 284
31 iso_pu_bacteria 2933577622 2933580211 284
32 iso_pu_bacteria 8055742211 8055746128 284
33 3300003322 rootL2_10241135 rootL2_102411351 285
34 3300048924 Ga0496121_0005804 Ga0496121_0005804_9510_10391 288
35 3300048929 Ga0496126_0408428 Ga0496126_0408428_53_934 288
36 iso_pu_bacteria 2522572158 2523103002 288
37 iso_pu_bacteria 2824653114 2824660527 288
38 iso_pu_bacteria 2888419890 2888426322 288
39 3300003659 JGI25404J52841_10011797 JGI25404J52841_100117972 289
40 3300005983 Ga0081540_1000318 Ga0081540_100031836 289
41 3300031665 Ga0316575_10035091 Ga0316575_100350912 289
42 3300035398 Ga0316574_0012769 Ga0316574_0012769_3878_4804 289
43 3300047320 Ga0495672_0152440 Ga0495672_0152440_231_1118 289
44 3300048929 Ga0496126_0182957 Ga0496126_0182957_803_1690 289
45 iso_pu_bacteria 8054002106 8054003431 289
46 3300048929 Ga0496126_0463109 Ga0496126_0463109_41_943 294
47 3300048925 Ga0496122_0069458 Ga0496122_0069458_280_1224 295
48 iso_pu_bacteria 2511231221 2512032051 295
49 iso_pu_bacteria 2706794495 2707098836 295
50 iso_pu_bacteria 8055693939 8055696849 295
51 3300009011 Ga0105251_10002226 Ga0105251_1000222610 297
52 3300009011 Ga0105251_10025169 Ga0105251_100251694 298
53 3300009092 Ga0105250_10003285 Ga0105250_100032855 298
54 3300009101 Ga0105247_10000166 Ga0105247_100001663 298
55 3300001989 JGI24739J22299_10000706 JGI24739J22299_100007067 299
56 3300002737 JGI25162J39368_1001723 JGI25162J39368_10017233 299
57 3300003856 Ga0058692_1000092 Ga0058692_100009236 299
58 3300003856 Ga0058692_1000734 Ga0058692_10007347 299
59 3300003856 Ga0058692_1001682 Ga0058692_10016828 299
60 3300005347 Ga0070668_100001634 Ga0070668_1000016347 299
61 3300006051 Ga0075364_10042583 Ga0075364_100425832 299
62 3300006051 Ga0075364_10075610 Ga0075364_100756101 299
63 3300009011 Ga0105251_10000500 Ga0105251_100005004 299
64 3300009011 Ga0105251_10006165 Ga0105251_100061658 299
65 3300009011 Ga0105251_10008186 Ga0105251_100081861 299
66 3300009011 Ga0105251_10029601 Ga0105251_100296011 299
67 3300009011 Ga0105251_10036377 Ga0105251_100363771 299
68 3300009011 Ga0105251_10036378 Ga0105251_100363782 299
69 3300009036 Ga0105244_10000246 Ga0105244_1000024633 299
70 3300009036 Ga0105244_10007923 Ga0105244_100079237 299
71 3300009036 Ga0105244_10017173 Ga0105244_100171732 299
72 3300009036 Ga0105244_10031622 Ga0105244_100316222 299
73 3300009036 Ga0105244_10161342 Ga0105244_101613421 299
74 3300009092 Ga0105250_10000007 Ga0105250_10000007184 299
75 3300009092 Ga0105250_10000018 Ga0105250_1000001873 299
76 3300009092 Ga0105250_10019273 Ga0105250_100192733 299
77 3300009092 Ga0105250_10025714 Ga0105250_100257142 299
78 3300009545 Ga0105237_10078031 Ga0105237_100780312 299
79 3300011119 Ga0105246_10596673 Ga0105246_105966731 299
80 3300013100 Ga0157373_10000400 Ga0157373_100004005 299
81 3300013100 Ga0157373_10003007 Ga0157373_1000300713 299
82 3300013100 Ga0157373_10009285 Ga0157373_100092851 299
83 3300013100 Ga0157373_10012111 Ga0157373_100121117 299
84 3300013102 Ga0157371_10000560 Ga0157371_1000056024 299
85 3300013102 Ga0157371_10001683 Ga0157371_100016839 299
86 3300013102 Ga0157371_10002986 Ga0157371_100029869 299
87 3300013104 Ga0157370_10000644 Ga0157370_1000064428 299
88 3300013105 Ga0157369_10375777 Ga0157369_103757771 299
89 3300013306 Ga0163162_10022107 Ga0163162_100221074 299
90 3300013306 Ga0163162_10158966 Ga0163162_101589661 299
91 3300013307 Ga0157372_10021477 Ga0157372_100214777 299
92 3300013307 Ga0157372_10469661 Ga0157372_104696611 299
93 3300013307 Ga0157372_10470659 Ga0157372_104706591 299
94 3300025233 Ga0209437_100103 Ga0209437_10010399 299
95 3300025711 Ga0207696_1000013 Ga0207696_1000013335 299
96 3300025711 Ga0207696_1000029 Ga0207696_1000029219 299
97 3300025711 Ga0207696_1000124 Ga0207696_100012455 299
98 3300025711 Ga0207696_1000766 Ga0207696_100076616 299
99 3300025728 Ga0207655_1000007 Ga0207655_1000007587 299
100 3300025728 Ga0207655_1006042 Ga0207655_10060426 299
101 3300025728 Ga0207655_1007903 Ga0207655_10079033 299
102 3300025728 Ga0207655_1020977 Ga0207655_10209772 299
103 3300025728 Ga0207655_1027012 Ga0207655_10270121 299
104 3300025735 Ga0207713_1000001 Ga0207713_10000011834 299
105 3300025735 Ga0207713_1000023 Ga0207713_100002393 299
106 3300025735 Ga0207713_1000241 Ga0207713_100024166 299
107 3300025735 Ga0207713_1006051 Ga0207713_10060516 299
108 3300025735 Ga0207713_1028203 Ga0207713_10282031 299
109 3300025735 Ga0207713_1038593 Ga0207713_10385931 299
110 3300025914 Ga0207671_10084931 Ga0207671_100849311 299
111 3300025972 Ga0207668_10012208 Ga0207668_100122081 299
112 3300027312 Ga0209371_1000005 Ga0209371_1000005907 299
113 3300027312 Ga0209371_1000118 Ga0209371_100011890 299
114 3300027312 Ga0209371_1000559 Ga0209371_10005598 299
115 3300027312 Ga0209371_1000688 Ga0209371_10006881 299
116 3300027312 Ga0209371_1001155 Ga0209371_100115517 299
117 3300027312 Ga0209371_1001486 Ga0209371_10014868 299
118 3300027312 Ga0209371_1001929 Ga0209371_10019299 299
119 3300027312 Ga0209371_1003423 Ga0209371_10034236 299
120 3300027312 Ga0209371_1004251 Ga0209371_10042511 299
121 3300028379 Ga0268266_10014247 Ga0268266_100142475 299
122 3300030500 Ga0268256_1000006 Ga0268256_1000006150 299
123 3300030500 Ga0268256_1000100 Ga0268256_100010090 299
124 3300030500 Ga0268256_1000662 Ga0268256_100066226 299
125 3300030500 Ga0268256_1001225 Ga0268256_10012259 299
126 3300030500 Ga0268256_1001273 Ga0268256_10012737 299
127 3300030500 Ga0268256_1003984 Ga0268256_10039846 299
128 3300030500 Ga0268256_1005534 Ga0268256_10055342 299
129 3300030500 Ga0268256_1006757 Ga0268256_10067571 299
130 3300041405 Ga0439438_000002 Ga0439438_000002_349667_350602 299
131 3300041407 Ga0439447_001765 Ga0439447_001765_3890_4813 299
132 3300041411 Ga0439466_0000001 Ga0439466_0000001_404725_405648 299
133 3300042006 Ga0439432_010498 Ga0439432_010498_1647_2582 299
134 3300042010 Ga0439452_000015 Ga0439452_000015_40198_41121 299
135 3300042439 Ga0439464_0002445 Ga0439464_0002445_301_1224 299
136 3300046458 Ga0495591_000001 Ga0495591_000001_312171_313094 299
137 3300046471 Ga0495650_0017382 Ga0495650_0017382_2233_3159 299
138 3300046500 Ga0495596_0008414 Ga0495596_0008414_245_1168 299
139 3300046522 Ga0495643_0020777 Ga0495643_0020777_889_1812 299
140 3300046524 Ga0495648_0012791 Ga0495648_0012791_4385_5308 299
141 3300046530 Ga0495654_0000009 Ga0495654_0000009_288637_289560 299
142 3300046616 Ga0495668_0068223 Ga0495668_0068223_465_1388 299
143 3300046810 Ga0495660_0051401 Ga0495660_0051401_412_1335 299
144 3300047320 Ga0495672_0000038 Ga0495672_0000038_121417_122340 299
145 3300047446 Ga0495679_004343 Ga0495679_004343_3485_4408 299
146 3300048903 Ga0496100_0192608 Ga0496100_0192608_84_1019 299
147 3300048904 Ga0496101_0000060 Ga0496101_0000060_2497_3432 299
148 3300048905 Ga0496102_0446199 Ga0496102_0446199_245_1168 299
149 3300048919 Ga0496116_0000420 Ga0496116_0000420_35510_36433 299
150 3300048919 Ga0496116_0000446 Ga0496116_0000446_2616_3554 299
151 3300048919 Ga0496116_0045032 Ga0496116_0045032_853_1776 299
152 3300048920 Ga0496117_0000009 Ga0496117_0000009_523314_524237 299
153 3300048920 Ga0496117_0000113 Ga0496117_0000113_86300_87223 299
154 3300048920 Ga0496117_0000504 Ga0496117_0000504_24960_25883 299
155 3300048920 Ga0496117_0023323 Ga0496117_0023323_868_1794 299
156 3300048921 Ga0496118_0000017 Ga0496118_0000017_459000_459923 299
157 3300048921 Ga0496118_0001258 Ga0496118_0001258_18922_19845 299
158 3300048921 Ga0496118_0003973 Ga0496118_0003973_9424_10347 299
159 3300048921 Ga0496118_0027245 Ga0496118_0027245_396_1322 299
160 3300048922 Ga0496119_0000129 Ga0496119_0000129_84959_85882 299
161 3300048922 Ga0496119_0000202 Ga0496119_0000202_82995_83918 299
162 3300048922 Ga0496119_0008995 Ga0496119_0008995_2392_3330 299
163 3300048922 Ga0496119_0009390 Ga0496119_0009390_6639_7565 299
164 3300048922 Ga0496119_0114688 Ga0496119_0114688_192_1115 299
165 3300048923 Ga0496120_0000179 Ga0496120_0000179_11617_12555 299
166 3300048923 Ga0496120_0000186 Ga0496120_0000186_20690_21613 299
167 3300048923 Ga0496120_0000291 Ga0496120_0000291_437_1360 299
168 3300048923 Ga0496120_0000632 Ga0496120_0000632_30673_31596 299
169 3300048923 Ga0496120_0007026 Ga0496120_0007026_6670_7596 299
170 3300048923 Ga0496120_0074672 Ga0496120_0074672_32_958 299
171 3300048924 Ga0496121_0000224 Ga0496121_0000224_99975_100898 299
172 3300048925 Ga0496122_0001179 Ga0496122_0001179_43276_44199 299
173 3300048925 Ga0496122_0001770 Ga0496122_0001770_27399_28322 299
174 3300048926 Ga0496123_0003273 Ga0496123_0003273_486_1409 299
175 3300048926 Ga0496123_0013533 Ga0496123_0013533_2218_3141 299
176 3300048927 Ga0496124_0000738 Ga0496124_0000738_47664_48602 299
177 3300048927 Ga0496124_0019429 Ga0496124_0019429_2618_3541 299
178 3300048927 Ga0496124_0031900 Ga0496124_0031900_2478_3401 299
179 3300048927 Ga0496124_0070220 Ga0496124_0070220_735_1661 299
180 3300048927 Ga0496124_0122247 Ga0496124_0122247_148_1071 299
181 3300048927 Ga0496124_0130881 Ga0496124_0130881_436_1359 299
182 3300048928 Ga0496125_0161645 Ga0496125_0161645_311_1237 299
183 3300048929 Ga0496126_0032812 Ga0496126_0032812_855_1781 299
184 3300048929 Ga0496126_0103446 Ga0496126_0103446_225_1148 299
185 3300050491 nmdc:mga00v17_87343_c1 nmdc:mga00v17_87343_c1_457_1380 299
186 iso_pu_bacteria 2511231025 2511380072 299
187 iso_pu_bacteria 2511231035 2511434940 299
188 iso_pu_bacteria 2554235234 2555259857 299
189 iso_pu_bacteria 2599185169 2599411256 299
190 iso_pu_bacteria 2599185299 2599926517 299
191 iso_pu_bacteria 2600255254 2601524251 299
192 iso_pu_bacteria 2600255255 2601529405 299
193 iso_pu_bacteria 2600255280 2601616239 299
194 iso_pu_bacteria 2600255281 2601620961 299
195 iso_pu_bacteria 2600255287 2601644308 299
196 iso_pu_bacteria 2600255288 2601649358 299
197 iso_pu_bacteria 2600255289 2601654285 299
198 iso_pu_bacteria 2600255290 2601659707 299
199 iso_pu_bacteria 2600255291 2601664130 299
200 iso_pu_bacteria 2600255298 2601697090 299
201 iso_pu_bacteria 2600255299 2601702136 299
202 iso_pu_bacteria 2600255300 2601707029 299
203 iso_pu_bacteria 2600255301 2601712019 299
204 iso_pu_bacteria 2600255302 2601717546 299
205 iso_pu_bacteria 2600255303 2601722184 299
206 iso_pu_bacteria 2600255304 2601727474 299
207 iso_pu_bacteria 2600255305 2601732461 299
208 iso_pu_bacteria 2600255306 2601737024 299
209 iso_pu_bacteria 2600255307 2601741306 299
210 iso_pu_bacteria 2600255309 2601752440 299
211 iso_pu_bacteria 2600255392 2602019281 299
212 iso_pu_bacteria 2602042052 2603662293 299
213 iso_pu_bacteria 2602042053 2603667189 299
214 iso_pu_bacteria 2602042103 2603839898 299
215 iso_pu_bacteria 2602042104 2603844975 299
216 iso_pu_bacteria 2602042105 2603850021 299
217 iso_pu_bacteria 2602042106 2603855116 299
218 iso_pu_bacteria 2602042109 2603867933 299
219 iso_pu_bacteria 2602042110 2603872696 299
220 iso_pu_bacteria 2602042111 2603878000 299
221 iso_pu_bacteria 2603880178 2606049847 299
222 iso_pu_bacteria 2603880184 2606071507 299
223 iso_pu_bacteria 2603880202 2606147560 299
224 iso_pu_bacteria 2603880211 2606177736 299
225 iso_pu_bacteria 2608642108 2608670032 299
226 iso_pu_bacteria 2636415599 2637224073 299
227 iso_pu_bacteria 2648501693 2650895758 299
228 iso_pu_bacteria 2675903046 2676405481 299
229 iso_pu_bacteria 2684622997 2686354169 299
230 iso_pu_bacteria 2775507074 2777020954 299
231 iso_pu_bacteria 2791354903 2791922292 299
232 iso_pu_bacteria 2808606414 2809125200 299
233 iso_pu_bacteria 2844528606 2844529135 299
234 iso_pu_bacteria 2847797336 2847798971 299
235 iso_pu_bacteria 2852103415 2852107029 299
236 iso_pu_bacteria 2865014394 2865016567 299
237 iso_pu_bacteria 2876601092 2876603270 299
238 iso_pu_bacteria 2881609920 2881612015 299
239 iso_pu_bacteria 2888373701 2888377366 299
240 iso_pu_bacteria 2904504865 2904506453 299
241 iso_pu_bacteria 2904513164 2904515387 299
242 iso_pu_bacteria 2919108558 2919110973 299
243 iso_pu_bacteria 2939602548 2939604805 299
244 iso_pu_bacteria 2945951305 2945952217 299
245 iso_pu_bacteria 2969079654 2969081107 299
246 iso_pu_bacteria 2971820967 2971822489 299
247 iso_pu_bacteria 2978975091 2978978691 299
248 iso_pu_bacteria 2984494565 2984497535 299
249 iso_pu_bacteria 2984559226 2984563565 299
250 iso_pu_bacteria 2984595703 2984596299 299
251 iso_pu_bacteria 2990261002 2990261484 299
252 iso_pu_bacteria 8016733728 8016735062 299
253 iso_pu_bacteria 8019499862 8019501456 299
254 3300013307 Ga0157372_10001955 Ga0157372_1000195512 300
255 3300013308 Ga0157375_10449390 Ga0157375_104493901 300
256 3300027312 Ga0209371_1000623 Ga0209371_100062310 300
257 3300030500 Ga0268256_1016647 Ga0268256_10166471 300
258 3300041405 Ga0439438_005860 Ga0439438_005860_2141_3067 300
259 3300041407 Ga0439447_004016 Ga0439447_004016_1822_2748 300
260 3300046458 Ga0495591_007157 Ga0495591_007157_1880_2806 300
261 3300046471 Ga0495650_0000065 Ga0495650_0000065_103357_104283 300
262 3300046491 Ga0495584_0009860 Ga0495584_0009860_2053_2979 300
263 3300046507 Ga0495606_0002485 Ga0495606_0002485_7128_8054 300
264 3300046513 Ga0495616_0032206 Ga0495616_0032206_1586_2512 300
265 3300046523 Ga0495644_0005253 Ga0495644_0005253_599_1525 300
266 3300046524 Ga0495648_0014761 Ga0495648_0014761_4436_5362 300
267 3300046530 Ga0495654_0001323 Ga0495654_0001323_4482_5408 300
268 3300046692 Ga0495671_0002913 Ga0495671_0002913_931_1857 300
269 3300046694 Ga0495649_0044879 Ga0495649_0044879_523_1449 300
270 3300046794 Ga0495589_0015919 Ga0495589_0015919_2751_3677 300
271 3300046810 Ga0495660_0000017 Ga0495660_0000017_5006_5932 300
272 3300047320 Ga0495672_0000001 Ga0495672_0000001_1127156_1128082 300
273 3300047469 Ga0495673_0000019 Ga0495673_0000019_236872_237798 300
274 3300048922 Ga0496119_0000012 Ga0496119_0000012_320381_321319 300
275 3300048922 Ga0496119_0008725 Ga0496119_0008725_5498_6436 300
276 3300048923 Ga0496120_0000004 Ga0496120_0000004_90599_91537 300
277 3300048923 Ga0496120_0000081 Ga0496120_0000081_33485_34423 300
278 3300049459 Ga0495678_002124 Ga0495678_002124_573_1499 300
279 3300049460 Ga0495682_0001613 Ga0495682_0001613_3474_4400 300
280 3300053126 Ga0500621_000070 Ga0500621_000070_7219_8145 300
281 iso_pu_bacteria 2667528172 2671101118 300
282 iso_pu_bacteria 2751185917 2753856918 300
283 iso_pu_bacteria 2765235842 2765590023 300
284 iso_pu_bacteria 2823373977 2823375676 300
285 iso_pu_bacteria 2846540461 2846540470 300
286 iso_pu_bacteria 2847085930 2847086611 300
287 iso_pu_bacteria 2908669403 2908672430 300
288 iso_pu_bacteria 2974310843 2974311089 300
289 iso_pu_bacteria 2537561728 2538425395 302
290 iso_pu_bacteria 2711768156 2712468877 302
291 iso_pu_bacteria 2855195626 2855199625 302
292 iso_pu_bacteria 2858466076 2858466762 302
293 iso_pu_bacteria 2871272651 2871275951 302
294 iso_pu_bacteria 2871282230 2871285808 302
295 iso_pu_bacteria 2900051742 2900052976 302
296 2162886007 SwRhRL2b_contig_249162 SwRhRL2b_0748.00000370 303
297 3300002771 JGI25163J39215_1000024 JGI25163J39215_100002433 303
298 3300002772 JGI25164J39214_1000006 JGI25164J39214_1000006275 303
299 3300002773 JGI25152J39213_1000602 JGI25152J39213_10006029 303
300 3300003751 Ga0055538_1000003 Ga0055538_1000003390 303
301 3300003752 Ga0055539_1000003 Ga0055539_1000003229 303
302 3300003756 Ga0055533_1000005 Ga0055533_1000005229 303
303 3300003759 Ga0055525_1000005 Ga0055525_1000005390 303
304 3300003841 Ga0055541_1000003 Ga0055541_1000003390 303
305 3300003856 Ga0058692_1006885 Ga0058692_10068852 303
306 3300005289 Ga0065704_10000641 Ga0065704_100006414 303
307 3300005289 Ga0065704_10226666 Ga0065704_102266661 303
308 3300006946 Ga0079104_1000135 Ga0079104_100013552 303
309 3300009011 Ga0105251_10001963 Ga0105251_1000196318 303
310 3300009011 Ga0105251_10005950 Ga0105251_100059501 303
311 3300009036 Ga0105244_10000040 Ga0105244_1000004018 303
312 3300009036 Ga0105244_10000337 Ga0105244_1000033726 303
313 3300009036 Ga0105244_10002267 Ga0105244_100022679 303
314 3300009036 Ga0105244_10012460 Ga0105244_100124601 303
315 3300009036 Ga0105244_10022204 Ga0105244_100222041 303
316 3300009036 Ga0105244_10069894 Ga0105244_100698942 303
317 3300009092 Ga0105250_10002387 Ga0105250_100023876 303
318 3300009092 Ga0105250_10004377 Ga0105250_100043774 303
319 3300009174 Ga0105241_10000001 Ga0105241_10000001696 303
320 3300013102 Ga0157371_10000006 Ga0157371_10000006138 303
321 3300013104 Ga0157370_10000618 Ga0157370_100006186 303
322 3300013105 Ga0157369_10000375 Ga0157369_100003752 303
323 3300013306 Ga0163162_10033088 Ga0163162_100330883 303
324 3300013307 Ga0157372_10002168 Ga0157372_1000216812 303
325 3300017792 Ga0163161_10000003 Ga0163161_10000003184 303
326 3300025207 Ga0209760_100093 Ga0209760_10009318 303
327 3300025224 Ga0209784_100001 Ga0209784_1000012988 303
328 3300025225 Ga0209566_100001 Ga0209566_1000012988 303
329 3300025226 Ga0209674_100002 Ga0209674_1000022988 303
330 3300025230 Ga0209563_100002 Ga0209563_1000021523 303
331 3300025231 Ga0207427_100009 Ga0207427_100009385 303
332 3300025233 Ga0209437_100001 Ga0209437_1000011523 303
333 3300025245 Ga0207425_1006185 Ga0207425_10061853 303
334 3300025253 Ga0209677_100002 Ga0209677_1000021523 303
335 3300025258 Ga0209129_1000037 Ga0209129_1000037185 303
336 3300025261 Ga0209233_1001125 Ga0209233_10011254 303
337 3300025711 Ga0207696_1000001 Ga0207696_10000012334 303
338 3300025711 Ga0207696_1000185 Ga0207696_100018539 303
339 3300025711 Ga0207696_1000275 Ga0207696_10002759 303
340 3300025728 Ga0207655_1000041 Ga0207655_100004172 303
341 3300025728 Ga0207655_1000205 Ga0207655_100020543 303
342 3300025728 Ga0207655_1000540 Ga0207655_100054022 303
343 3300025728 Ga0207655_1017004 Ga0207655_10170042 303
344 3300025728 Ga0207655_1051112 Ga0207655_10511122 303
345 3300025735 Ga0207713_1001368 Ga0207713_100136818 303
346 3300025735 Ga0207713_1006520 Ga0207713_10065201 303
347 3300025735 Ga0207713_1017449 Ga0207713_10174491 303
348 3300025900 Ga0207710_10000051 Ga0207710_100000513 303
349 3300025911 Ga0207654_10000004 Ga0207654_10000004724 303
350 3300027111 Ga0209281_1000095 Ga0209281_1000095187 303
351 3300027111 Ga0209281_1004107 Ga0209281_10041073 303
352 3300027312 Ga0209371_1000015 Ga0209371_1000015297 303
353 3300027312 Ga0209371_1001911 Ga0209371_10019117 303
354 3300027312 Ga0209371_1012876 Ga0209371_10128762 303
355 3300030500 Ga0268256_1000018 Ga0268256_1000018327 303
356 3300030500 Ga0268256_1002311 Ga0268256_10023116 303
357 3300030500 Ga0268256_1014089 Ga0268256_10140892 303
358 3300042010 Ga0439452_000020 Ga0439452_000020_21640_22578 303
359 3300042010 Ga0439452_009657 Ga0439452_009657_912_1847 303
360 3300042532 Ga0450893_0013697 Ga0450893_0013697_285_1229 303
361 3300046453 Ga0495627_000044 Ga0495627_000044_168_1103 303
362 3300046471 Ga0495650_0000018 Ga0495650_0000018_61389_62333 303
363 3300046530 Ga0495654_0002421 Ga0495654_0002421_2919_3854 303
364 3300046530 Ga0495654_0012165 Ga0495654_0012165_2869_3804 303
365 3300046530 Ga0495654_0052955 Ga0495654_0052955_729_1664 303
366 3300046542 Ga0495597_0002085 Ga0495597_0002085_1439_2374 303
367 3300046660 Ga0495625_0011960 Ga0495625_0011960_2291_3226 303
368 3300046794 Ga0495589_0000003 Ga0495589_0000003_261889_262824 303
369 3300046810 Ga0495660_0000004 Ga0495660_0000004_296496_297440 303
370 3300047320 Ga0495672_0000009 Ga0495672_0000009_156079_157014 303
371 3300047446 Ga0495679_000032 Ga0495679_000032_69057_69992 303
372 3300047470 Ga0495681_0092937 Ga0495681_0092937_214_1149 303
373 3300048907 Ga0496104_0043660 Ga0496104_0043660_2463_3407 303
374 3300048919 Ga0496116_0000007 Ga0496116_0000007_300660_301595 303
375 3300048919 Ga0496116_0000118 Ga0496116_0000118_105881_106825 303
376 3300048919 Ga0496116_0101262 Ga0496116_0101262_243_1181 303
377 3300048920 Ga0496117_0002374 Ga0496117_0002374_15300_16235 303
378 3300048920 Ga0496117_0008055 Ga0496117_0008055_5318_6262 303
379 3300048920 Ga0496117_0026137 Ga0496117_0026137_2688_3626 303
380 3300048921 Ga0496118_0001101 Ga0496118_0001101_29769_30713 303
381 3300048921 Ga0496118_0003548 Ga0496118_0003548_16415_17350 303
382 3300048921 Ga0496118_0007913 Ga0496118_0007913_8755_9699 303
383 3300048921 Ga0496118_0063503 Ga0496118_0063503_540_1478 303
384 3300048922 Ga0496119_0000194 Ga0496119_0000194_63136_64074 303
385 3300048922 Ga0496119_0068678 Ga0496119_0068678_375_1319 303
386 3300048922 Ga0496119_0112989 Ga0496119_0112989_511_1455 303
387 3300048923 Ga0496120_0002896 Ga0496120_0002896_7744_8688 303
388 3300048923 Ga0496120_0061959 Ga0496120_0061959_375_1319 303
389 3300048923 Ga0496120_0061961 Ga0496120_0061961_375_1319 303
390 3300048923 Ga0496120_0083692 Ga0496120_0083692_540_1478 303
391 3300048923 Ga0496120_0094160 Ga0496120_0094160_327_1262 303
392 3300048925 Ga0496122_0000303 Ga0496122_0000303_62310_63254 303
393 3300048926 Ga0496123_0000250 Ga0496123_0000250_45415_46359 303
394 3300048927 Ga0496124_0000027 Ga0496124_0000027_288000_288944 303
395 3300048927 Ga0496124_0000028 Ga0496124_0000028_176933_177877 303
396 3300048927 Ga0496124_0054137 Ga0496124_0054137_2394_3332 303
397 3300048928 Ga0496125_0000052 Ga0496125_0000052_200160_201104 303
398 3300048928 Ga0496125_0008709 Ga0496125_0008709_3130_4068 303
399 3300048929 Ga0496126_0000410 Ga0496126_0000410_66605_67549 303
400 3300048929 Ga0496126_0021260 Ga0496126_0021260_2725_3663 303
401 iso_pu_bacteria 2506520007 2506579587 303
402 iso_pu_bacteria 2506520008 2506584726 303
403 iso_pu_bacteria 2508501071 2508853375 303
404 iso_pu_bacteria 2585427591 2585827731 303
405 iso_pu_bacteria 2585427592 2585835064 303
406 iso_pu_bacteria 2654587920 2656276981 303
407 iso_pu_bacteria 2667528173 2671107106 303
408 iso_pu_bacteria 2671180115 2671584543 303
409 iso_pu_bacteria 2687453601 2689446109 303
410 iso_pu_bacteria 2806310673 2807179699 303
411 iso_pu_bacteria 2869551831 2869555457 303
412 iso_pu_bacteria 2891670763 2891672348 303
413 iso_pu_bacteria 2904474040 2904476030 303
414 iso_pu_bacteria 2919150387 2919152199 303
415 iso_pu_bacteria 2927143783 2927144868 303
416 iso_pu_bacteria 2932406140 2932410810 303
417 iso_pu_bacteria 2935625433 2935625763 303
418 iso_pu_bacteria 2937967321 2937968641 303
419 iso_pu_bacteria 2939577877 2939582313 303
420 iso_pu_bacteria 2939617950 2939618488 303
421 iso_pu_bacteria 2974435778 2974439283 303
422 iso_pu_bacteria 3000376612 3000378356 303
423 iso_pu_bacteria 640753048 640938855 303
424 iso_pu_bacteria 8004592986 8004596171 303
425 iso_pu_bacteria 8019504834 8019505174 303
426 iso_pu_bacteria 8054844752 8054846627 303
427 iso_pu_bacteria 8054849141 8054851969 303
428 2162886007 SwRhRL2b_contig_1007981 SwRhRL2b_0742.00002430 304
429 2162886007 SwRhRL2b_contig_2803902 SwRhRL2b_0565.00006720 304
430 3300003320 rootH2_10052056 rootH2_100520567 304
431 3300003856 Ga0058692_1010042 Ga0058692_10100421 304
432 3300005289 Ga0065704_10000626 Ga0065704_100006261 304
433 3300005289 Ga0065704_10002692 Ga0065704_100026929 304
434 3300005289 Ga0065704_10007183 Ga0065704_100071834 304
435 3300005366 Ga0070659_100116473 Ga0070659_1001164732 304
436 3300005548 Ga0070665_100000374 Ga0070665_10000037464 304
437 3300005577 Ga0068857_100003218 Ga0068857_1000032182 304
438 3300006051 Ga0075364_10029957 Ga0075364_100299572 304
439 3300006051 Ga0075364_10123318 Ga0075364_101233181 304
440 3300006195 Ga0075366_10036629 Ga0075366_100366292 304
441 3300006946 Ga0079104_1000487 Ga0079104_10004878 304
442 3300006946 Ga0079104_1001580 Ga0079104_10015805 304
443 3300006946 Ga0079104_1002664 Ga0079104_10026642 304
444 3300006946 Ga0079104_1003160 Ga0079104_10031601 304
445 3300006946 Ga0079104_1012092 Ga0079104_10120921 304
446 3300006946 Ga0079104_1023007 Ga0079104_10230072 304
447 3300006946 Ga0079104_1031496 Ga0079104_10314961 304
448 3300009011 Ga0105251_10005553 Ga0105251_100055532 304
449 3300009011 Ga0105251_10020515 Ga0105251_100205151 304
450 3300009011 Ga0105251_10025176 Ga0105251_100251761 304
451 3300009011 Ga0105251_10102414 Ga0105251_101024141 304
452 3300009011 Ga0105251_10105297 Ga0105251_101052971 304
453 3300009036 Ga0105244_10000342 Ga0105244_100003427 304
454 3300009036 Ga0105244_10001474 Ga0105244_100014748 304
455 3300009036 Ga0105244_10007356 Ga0105244_100073561 304
456 3300009036 Ga0105244_10112999 Ga0105244_101129991 304
457 3300009092 Ga0105250_10001567 Ga0105250_1000156711 304
458 3300009092 Ga0105250_10049421 Ga0105250_100494211 304
459 3300009093 Ga0105240_10084455 Ga0105240_100844553 304
460 3300009545 Ga0105237_10124291 Ga0105237_101242911 304
461 3300013102 Ga0157371_10167023 Ga0157371_101670231 304
462 3300013104 Ga0157370_10002604 Ga0157370_1000260421 304
463 3300013307 Ga0157372_10016311 Ga0157372_100163113 304
464 3300015261 Ga0182006_1000024 Ga0182006_100002413 304
465 3300015679 Ga0183366_1001 Ga0183366_10012384 304
466 3300015680 Ga0183370_1001 Ga0183370_10012384 304
467 3300015685 Ga0183369_1001 Ga0183369_10012385 304
468 3300015687 Ga0183368_1001 Ga0183368_10012384 304
469 3300017792 Ga0163161_10057860 Ga0163161_100578602 304
470 3300021384 Ga0213876_10000023 Ga0213876_1000002365 304
471 3300025711 Ga0207696_1000067 Ga0207696_100006782 304
472 3300025711 Ga0207696_1000100 Ga0207696_100010058 304
473 3300025711 Ga0207696_1001267 Ga0207696_100126710 304
474 3300025711 Ga0207696_1003311 Ga0207696_10033117 304
475 3300025728 Ga0207655_1000002 Ga0207655_1000002257 304
476 3300025728 Ga0207655_1000004 Ga0207655_1000004245 304
477 3300025728 Ga0207655_1000062 Ga0207655_10000628 304
478 3300025728 Ga0207655_1000115 Ga0207655_100011561 304
479 3300025728 Ga0207655_1004167 Ga0207655_10041679 304
480 3300025728 Ga0207655_1010252 Ga0207655_10102525 304
481 3300025735 Ga0207713_1000083 Ga0207713_1000083116 304
482 3300025735 Ga0207713_1007504 Ga0207713_10075041 304
483 3300025735 Ga0207713_1014533 Ga0207713_10145334 304
484 3300025735 Ga0207713_1033439 Ga0207713_10334391 304
485 3300025735 Ga0207713_1070861 Ga0207713_10708611 304
486 3300025913 Ga0207695_10092453 Ga0207695_100924534 304
487 3300026116 Ga0207674_10006670 Ga0207674_1000667010 304
488 3300027111 Ga0209281_1000004 Ga0209281_1000004215 304
489 3300027111 Ga0209281_1000014 Ga0209281_1000014372 304
490 3300027111 Ga0209281_1000219 Ga0209281_100021982 304
491 3300027111 Ga0209281_1000286 Ga0209281_100028686 304
492 3300027111 Ga0209281_1000404 Ga0209281_100040462 304
493 3300027111 Ga0209281_1000523 Ga0209281_100052330 304
494 3300027111 Ga0209281_1001556 Ga0209281_10015569 304
495 3300027111 Ga0209281_1001951 Ga0209281_10019519 304
496 3300027111 Ga0209281_1019742 Ga0209281_10197421 304
497 3300027312 Ga0209371_1000001 Ga0209371_10000012376 304
498 3300027312 Ga0209371_1000108 Ga0209371_100010832 304
499 3300028379 Ga0268266_10000922 Ga0268266_1000092210 304
500 3300030500 Ga0268256_1000001 Ga0268256_1000001264 304
501 3300030500 Ga0268256_1000076 Ga0268256_1000076169 304
502 3300039437 Ga0436365_0965775 Ga0436365_0965775_77960_78898 304
503 3300041405 Ga0439438_005231 Ga0439438_005231_2568_3506 304
504 3300041453 Ga0451797_0353171 Ga0451797_0353171_116_1030 304
505 3300042006 Ga0439432_027729 Ga0439432_027729_32_973 304
506 3300042010 Ga0439452_000002 Ga0439452_000002_241370_242308 304
507 3300042010 Ga0439452_002528 Ga0439452_002528_5734_6648 304
508 3300044669 Ga0466981_0000013 Ga0466981_0000013_88285_89199 304
509 3300046458 Ga0495591_000294 Ga0495591_000294_36232_37170 304
510 3300046460 Ga0495638_0007143 Ga0495638_0007143_130_1071 304
511 3300046471 Ga0495650_0000047 Ga0495650_0000047_57578_58492 304
512 3300046515 Ga0495620_0017851 Ga0495620_0017851_1618_2559 304
513 3300046530 Ga0495654_0025329 Ga0495654_0025329_802_1716 304
514 3300046694 Ga0495649_0006292 Ga0495649_0006292_1715_2656 304
515 3300046694 Ga0495649_0007204 Ga0495649_0007204_4856_5797 304
516 3300047446 Ga0495679_001387 Ga0495679_001387_5823_6764 304
517 3300047469 Ga0495673_0000071 Ga0495673_0000071_188229_189143 304
518 3300048907 Ga0496104_0000212 Ga0496104_0000212_9805_10719 304
519 3300048919 Ga0496116_0008956 Ga0496116_0008956_733_1647 304
520 3300048919 Ga0496116_0094903 Ga0496116_0094903_772_1710 304
521 3300048920 Ga0496117_0015866 Ga0496117_0015866_4740_5654 304
522 3300048920 Ga0496117_0028793 Ga0496117_0028793_327_1241 304
523 3300048920 Ga0496117_0034473 Ga0496117_0034473_1156_2094 304
524 3300048921 Ga0496118_0030028 Ga0496118_0030028_2899_3813 304
525 3300048921 Ga0496118_0048594 Ga0496118_0048594_1181_2119 304
526 3300048921 Ga0496118_0064079 Ga0496118_0064079_1052_1966 304
527 3300048922 Ga0496119_0009094 Ga0496119_0009094_733_1647 304
528 3300048923 Ga0496120_0003856 Ga0496120_0003856_242_1156 304
529 3300048923 Ga0496120_0007219 Ga0496120_0007219_4118_5056 304
530 3300048923 Ga0496120_0025306 Ga0496120_0025306_1569_2507 304
531 3300048923 Ga0496120_0139123 Ga0496120_0139123_309_1223 304
532 3300048924 Ga0496121_0014381 Ga0496121_0014381_7120_8034 304
533 3300048924 Ga0496121_0014797 Ga0496121_0014797_369_1283 304
534 3300048924 Ga0496121_0015535 Ga0496121_0015535_6683_7597 304
535 3300048924 Ga0496121_0030731 Ga0496121_0030731_2802_3740 304
536 3300048924 Ga0496121_0092980 Ga0496121_0092980_338_1252 304
537 3300048925 Ga0496122_0000003 Ga0496122_0000003_492584_493522 304
538 3300048925 Ga0496122_0001758 Ga0496122_0001758_19806_20720 304
539 3300048925 Ga0496122_0008975 Ga0496122_0008975_2581_3519 304
540 3300048925 Ga0496122_0019515 Ga0496122_0019515_5188_6126 304
541 3300048925 Ga0496122_0022640 Ga0496122_0022640_3930_4844 304
542 3300048925 Ga0496122_0026269 Ga0496122_0026269_142_1080 304
543 3300048926 Ga0496123_0000012 Ga0496123_0000012_247767_248705 304
544 3300048926 Ga0496123_0001176 Ga0496123_0001176_9165_10079 304
545 3300048926 Ga0496123_0007059 Ga0496123_0007059_2712_3650 304
546 3300048926 Ga0496123_0008944 Ga0496123_0008944_2013_2951 304
547 3300048926 Ga0496123_0013718 Ga0496123_0013718_5473_6387 304
548 3300048926 Ga0496123_0052416 Ga0496123_0052416_1379_2317 304
549 3300048926 Ga0496123_0057447 Ga0496123_0057447_368_1306 304
550 3300048927 Ga0496124_0001085 Ga0496124_0001085_2651_3592 304
551 3300048927 Ga0496124_0009187 Ga0496124_0009187_7054_7968 304
552 3300048927 Ga0496124_0029037 Ga0496124_0029037_3288_4202 304
553 3300048927 Ga0496124_0058592 Ga0496124_0058592_943_1881 304
554 3300048927 Ga0496124_0061003 Ga0496124_0061003_498_1436 304
555 3300048928 Ga0496125_0000296 Ga0496125_0000296_900_1838 304
556 3300048928 Ga0496125_0018411 Ga0496125_0018411_1276_2214 304
557 3300048928 Ga0496125_0177661 Ga0496125_0177661_50_964 304
558 3300048929 Ga0496126_0032462 Ga0496126_0032462_2755_3693 304
559 3300048929 Ga0496126_0204324 Ga0496126_0204324_636_1574 304
560 3300048929 Ga0496126_0292835 Ga0496126_0292835_63_977 304
561 3300048929 Ga0496126_0315378 Ga0496126_0315378_361_1275 304
562 3300050491 nmdc:mga00v17_22048_c1 nmdc:mga00v17_22048_c1_2429_3343 304
563 3300050491 nmdc:mga00v17_9293_c1 nmdc:mga00v17_9293_c1_1404_2342 304
564 3300050493 nmdc:mga0k408_37628_c1 nmdc:mga0k408_37628_c1_135_1049 304
565 iso_pu_bacteria 2600255256 2601535011 304
566 iso_pu_bacteria 2600255257 2601539360 304
567 iso_pu_bacteria 2600255310 2601757710 304
568 iso_pu_bacteria 2600255311 2601764068 304
569 iso_pu_bacteria 2602042046 2603636878 304
570 iso_pu_bacteria 2602042047 2603645368 304
571 iso_pu_bacteria 2602042066 2603699342 304
572 iso_pu_bacteria 2602042067 2603705371 304
573 iso_pu_bacteria 2609459761 2609909654 304
574 iso_pu_bacteria 2681812866 2681996220 304
575 iso_pu_bacteria 2681812869 2682006444 304
576 iso_pu_bacteria 2775506706 2775541305 304
577 iso_pu_bacteria 2791355275 2793404739 304
578 iso_pu_bacteria 2811995292 2813727888 304
579 iso_pu_bacteria 2814123068 2814695431 304
580 iso_pu_bacteria 2821118458 2821121042 304
581 iso_pu_bacteria 2844425489 2844428367 304
582 iso_pu_bacteria 2884086401 2884087874 304
583 iso_pu_bacteria 2923634449 2923635891 304
584 iso_pu_bacteria 2927833300 2927837611 304
585 iso_pu_bacteria 2937539931 2937542444 304
586 iso_pu_bacteria 2939568625 2939570038 304
587 iso_pu_bacteria 2939573065 2939575363 304
588 iso_pu_bacteria 2939607340 2939608678 304
589 iso_pu_bacteria 2939642701 2939642943 304
590 iso_pu_bacteria 2945874760 2945876842 304
591 iso_pu_bacteria 8018221730 8018224691 304
592 iso_pu_bacteria 8018405270 8018409239 304
593 iso_pu_bacteria 8055087960 8055092169 304
594 iso_pu_bacteria 8055092621 8055095495 304
595 iso_pu_bacteria 8055097453 8055100205 304
596 iso_pu_bacteria 8057304971 8057306771 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

40

99

0.98

PF03466

LysR_substrate

LysR substrate binding domain

122

313

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3onm-assembly1.cif.gz_A effector binding domain of lysr-type transcription factor rovm from y. pseudotuberculosis 0.9838 91 278
7yhj-assembly2.cif.gz_B effector binding domain of lysr-type transcription factor lrha from e. coli 0.9814 91 281
7yhj-assembly2.cif.gz_D-2 effector binding domain of lysr-type transcription factor lrha from e. coli 0.9786 91 282
7yhj-assembly1.cif.gz_C effector binding domain of lysr-type transcription factor lrha from e. coli 0.9785 91 283
7yhj-assembly2.cif.gz_B effector binding domain of lysr-type transcription factor lrha from e. coli 0.9764 91 281
ID Description Score Start End Superfamily
3onmB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.992 161 252 3.40.190.10
af_P77309_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9907 3 80 1.10.10.10
af_P36771_5_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9864 2 83 1.10.10.10
af_Q57748_4_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.984 4 85 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.979 2 80 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6I5XAC4-F1-model_v4 LysR family transcriptional regulator 0.9926 3 85 GO:0000976
GO:0003700
AF-A0A6N3U979-F1-model_v4 deleted 0.9829 3 76
AF-A0A6N3GJQ8-F1-model_v4 HTH-type transcriptional regulator CynR 0.9825 3 85 GO:0003677
GO:0003700
GO:0032993
AF-Q7UTS6-F1-model_v4 Probable transcription regulator, HTH_1 family 0.9719 3 85 GO:0003677
GO:0003700
AF-A0A833KNX1-F1-model_v4 deleted 0.9678 3 75

Feature Viewer

pLDDT pTM Quality
85.38 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map