F467416

General Info

Members Datasets Scaffolds Average Seq Length
595 196 594 139

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_11175841|Ga0070676_111758411
Length 160
Sequence MLSGRKFKIKAMKLHELRPAKGATHKEKRIGRGDGSGHGGTSTKGTKGGQSRAGYKRKMAHEGGQMPIQRRIPKRGFNNPHRVEYKVFNLGQIEQLIEKYGIKEFSLENLYINGLISQTDKVKILGTGELKAKLPFKVNAVSGKAKSSIEAAGGTVEIVK

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
195 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
196 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.84
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 0.17
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1010688 3300001904 Bacteria 1498
2 JGI24751J29686_10001776 3300002459 Bacteria 4425
3 JGI25406J46586_10042774 3300003203 Bacteria 1582
4 Ga0065712_10022657 3300005290 Bacteria 1860
5 Ga0070658_10036030 3300005327 Bacteria 3987
6 Ga0070658_10065507 3300005327 Bacteria 2965
7 Ga0070658_10106103 3300005327 Bacteria 2324
8 Ga0070658_10718573 3300005327 Bacteria 867
9 Ga0070658_10922207 3300005327 Bacteria 759
10 Ga0070676_10023353 3300005328 Bacteria 3475
11 Ga0070676_11175841 3300005328 Bacteria 582
12 Ga0070683_100001488 3300005329 Bacteria 18077
13 Ga0070683_100127769 3300005329 Bacteria 2404
14 Ga0070683_101744832 3300005329 Unclassified 599
15 Ga0070683_102335864 3300005329 Bacteria 513
16 Ga0070690_101081047 3300005330 Bacteria 635
17 Ga0070670_100163815 3300005331 Bacteria 1927
18 Ga0070670_100291389 3300005331 Bacteria 1426
19 Ga0070670_100431559 3300005331 Unclassified 1166
20 Ga0070670_100494965 3300005331 Bacteria 1086
21 Ga0068869_100008365 3300005334 Bacteria 6667
22 Ga0068869_100035596 3300005334 Bacteria 3529
23 Ga0068869_100054977 3300005334 Bacteria 2900
24 Ga0068869_100157409 3300005334 Bacteria 1766
25 Ga0068869_100177718 3300005334 Bacteria 1667
26 Ga0068869_100339561 3300005334 Bacteria 1222
27 Ga0070666_10000736 3300005335 Bacteria 19845
28 Ga0070666_10032986 3300005335 Bacteria 3424
29 Ga0070666_10083897 3300005335 Bacteria 2180
30 Ga0070666_10328375 3300005335 Bacteria 1092
31 Ga0070680_100009085 3300005336 Bacteria 7620
32 Ga0070680_100096257 3300005336 Bacteria 2454
33 Ga0070680_100101334 3300005336 Bacteria 2390
34 Ga0070680_100144538 3300005336 Bacteria 1995
35 Ga0070680_100387829 3300005336 Unclassified 1190
36 Ga0070680_100404158 3300005336 Bacteria 1164
37 Ga0070680_101683585 3300005336 Bacteria 550
38 Ga0070682_100011807 3300005337 Bacteria 4997
39 Ga0068868_100013181 3300005338 Bacteria 6055
40 Ga0068868_100023189 3300005338 Bacteria 4695
41 Ga0068868_100025438 3300005338 Bacteria 4503
42 Ga0068868_100060164 3300005338 Bacteria 3006
43 Ga0068868_100198485 3300005338 Bacteria 1671
44 Ga0068868_100785936 3300005338 Bacteria 858
45 Ga0070660_100003216 3300005339 Bacteria 11222
46 Ga0070660_100059749 3300005339 Bacteria 2957
47 Ga0070660_100117026 3300005339 Bacteria 2125
48 Ga0070660_100420761 3300005339 Bacteria 1106
49 Ga0070660_101298124 3300005339 Bacteria 618
50 Ga0070689_100054673 3300005340 Bacteria 3091
51 Ga0070689_100236080 3300005340 Bacteria 1505
52 Ga0070689_100876698 3300005340 Bacteria 793
53 Ga0070661_100439137 3300005344 Bacteria 1037
54 Ga0070661_100913168 3300005344 Bacteria 725
55 Ga0070692_10116032 3300005345 Bacteria 1487
56 Ga0070668_100011116 3300005347 Bacteria 6701
57 Ga0070668_100187526 3300005347 Bacteria 1692
58 Ga0070669_100008677 3300005353 Bacteria 7251
59 Ga0070669_100289649 3300005353 Bacteria 1314
60 Ga0070669_100582595 3300005353 Bacteria 936
61 Ga0070675_100022698 3300005354 Bacteria 5014
62 Ga0070675_100053437 3300005354 Bacteria 3322
63 Ga0070675_100875310 3300005354 Bacteria 823
64 Ga0070671_100029574 3300005355 Bacteria 4517
65 Ga0070671_100033495 3300005355 Bacteria 4250
66 Ga0070671_100085773 3300005355 Bacteria 2634
67 Ga0070671_100164955 3300005355 Bacteria 1873
68 Ga0070671_100187756 3300005355 Bacteria 1751
69 Ga0070671_101163660 3300005355 Unclassified 678
70 Ga0070674_100002220 3300005356 Bacteria 10679
71 Ga0070674_100029993 3300005356 Bacteria 3591
72 Ga0070674_100116266 3300005356 Bacteria 1973
73 Ga0070673_100011200 3300005364 Bacteria 6115
74 Ga0070673_100019294 3300005364 Bacteria 4894
75 Ga0070673_100042352 3300005364 Bacteria 3510
76 Ga0070673_100042547 3300005364 Bacteria 3503
77 Ga0070673_100292222 3300005364 Bacteria 1432
78 Ga0070673_100537099 3300005364 Bacteria 1061
79 Ga0070688_100037058 3300005365 Bacteria 2970
80 Ga0070659_100031231 3300005366 Bacteria 4125
81 Ga0070659_100051119 3300005366 Bacteria 3248
82 Ga0070659_100125379 3300005366 Bacteria 2083
83 Ga0070667_100003905 3300005367 Bacteria 12660
84 Ga0070667_100048466 3300005367 Bacteria 3576
85 Ga0070667_100063899 3300005367 Bacteria 3121
86 Ga0070701_10065993 3300005438 Bacteria 1922
87 Ga0070700_100142630 3300005441 Bacteria 1630
88 Ga0070663_100028743 3300005455 Bacteria 3789
89 Ga0070663_100799477 3300005455 Bacteria 809
90 Ga0070678_100003711 3300005456 Bacteria 8544
91 Ga0070678_100168499 3300005456 Bacteria 1781
92 Ga0070681_10042072 3300005458 Bacteria 4579
93 Ga0070681_10104396 3300005458 Bacteria 2776
94 Ga0070681_10472662 3300005458 Bacteria 1166
95 Ga0068867_100044375 3300005459 Bacteria 3257
96 Ga0068867_100044758 3300005459 Bacteria 3243
97 Ga0068867_100099678 3300005459 Bacteria 2217
98 Ga0068867_100422685 3300005459 Bacteria 1129
99 Ga0068867_100688132 3300005459 Unclassified 901
100 Ga0070685_10030414 3300005466 Bacteria 3009
101 Ga0070685_10136076 3300005466 Bacteria 1542
102 Ga0070679_100000558 3300005530 Bacteria 31616
103 Ga0070679_100001469 3300005530 Bacteria 20899
104 Ga0070679_100070030 3300005530 Bacteria 3499
105 Ga0070679_100107730 3300005530 Bacteria 2772
106 Ga0070679_100701892 3300005530 Bacteria 954
107 Ga0070679_101044340 3300005530 Bacteria 761
108 Ga0070679_101290412 3300005530 Bacteria 676
109 Ga0070679_101745677 3300005530 Bacteria 570
110 Ga0070684_100003339 3300005535 Bacteria 12014
111 Ga0070684_100231351 3300005535 Bacteria 1688
112 Ga0068853_100146766 3300005539 Bacteria 2120
113 Ga0068853_100229702 3300005539 Bacteria 1697
114 Ga0068853_100740829 3300005539 Bacteria 939
115 Ga0070672_100038692 3300005543 Bacteria 3647
116 Ga0070672_100048293 3300005543 Bacteria 3307
117 Ga0070672_100086246 3300005543 Bacteria 2524
118 Ga0070672_100207355 3300005543 Bacteria 1641
119 Ga0070672_100842449 3300005543 Bacteria 808
120 Ga0070665_100018617 3300005548 Bacteria 6960
121 Ga0068855_100000943 3300005563 Bacteria 36241
122 Ga0068855_100002973 3300005563 Bacteria 20715
123 Ga0068855_100035596 3300005563 Bacteria 5930
124 Ga0068855_100403081 3300005563 Bacteria 1498
125 Ga0070664_100153345 3300005564 Bacteria 2035
126 Ga0070664_100283335 3300005564 Bacteria 1495
127 Ga0070664_100450224 3300005564 Bacteria 1182
128 Ga0070664_100534396 3300005564 Bacteria 1083
129 Ga0070664_100768303 3300005564 Bacteria 900
130 Ga0070664_101017718 3300005564 Bacteria 779
131 Ga0068857_100387337 3300005577 Bacteria 1299
132 Ga0068857_100440119 3300005577 Bacteria 1218
133 Ga0068857_100462840 3300005577 Bacteria 1187
134 Ga0068857_100984590 3300005577 Bacteria 811
135 Ga0068857_101923381 3300005577 Bacteria 580
136 Ga0068854_100021100 3300005578 Bacteria 4417
137 Ga0068854_100042884 3300005578 Bacteria 3204
138 Ga0068854_100098801 3300005578 Bacteria 2185
139 Ga0068854_101597070 3300005578 Bacteria 594
140 Ga0068854_102283452 3300005578 Bacteria 501
141 Ga0068856_100009626 3300005614 Bacteria 9382
142 Ga0068856_100031449 3300005614 Bacteria 5192
143 Ga0068856_101275660 3300005614 Bacteria 750
144 Ga0068852_100001428 3300005616 Bacteria 16112
145 Ga0068852_100361430 3300005616 Bacteria 1420
146 Ga0068852_100591715 3300005616 Bacteria 1113
147 Ga0068852_101103602 3300005616 Bacteria 814
148 Ga0068859_100000037 3300005617 Bacteria 165480
149 Ga0068859_100020784 3300005617 Bacteria 6589
150 Ga0068859_100082000 3300005617 Bacteria 3268
151 Ga0068859_100255383 3300005617 Bacteria 1843
152 Ga0068859_100875607 3300005617 Bacteria 984
153 Ga0068864_100018148 3300005618 Bacteria 5872
154 Ga0068864_100038806 3300005618 Bacteria 4068
155 Ga0068864_100061735 3300005618 Bacteria 3246
156 Ga0068864_100211296 3300005618 Bacteria 1787
157 Ga0068864_101382949 3300005618 Bacteria 705
158 Ga0068866_10032382 3300005718 Bacteria 2527
159 Ga0068861_100280713 3300005719 Bacteria 1434
160 Ga0068861_100427823 3300005719 Bacteria 1181
161 Ga0068861_101593293 3300005719 Bacteria 643
162 Ga0068851_10025363 3300005834 Bacteria 2908
163 Ga0068851_10220815 3300005834 Bacteria 1065
164 Ga0068870_10006960 3300005840 Bacteria 5016
165 Ga0068870_10274307 3300005840 Bacteria 1055
166 Ga0068863_100004306 3300005841 Bacteria 14020
167 Ga0068863_100031353 3300005841 Bacteria 5073
168 Ga0068858_100043398 3300005842 Bacteria 4169
169 Ga0068858_100808008 3300005842 Unclassified 915
170 Ga0068858_101048491 3300005842 Bacteria 800
171 Ga0068860_100006743 3300005843 Bacteria 11515
172 Ga0068860_100007830 3300005843 Bacteria 10668
173 Ga0068860_100008499 3300005843 Bacteria 10228
174 Ga0068860_100085954 3300005843 Bacteria 2993
175 Ga0068860_100523164 3300005843 Bacteria 1186
176 Ga0068860_102650531 3300005843 Bacteria 520
177 Ga0068862_100204985 3300005844 Bacteria 1779
178 Ga0068862_100280486 3300005844 Bacteria 1527
179 Ga0068862_100316824 3300005844 Bacteria 1439
180 Ga0081539_10004959 3300005985 Bacteria 14110
181 Ga0081539_10173775 3300005985 Bacteria 1016
182 Ga0075366_10067340 3300006195 Bacteria 2131
183 Ga0075366_10101253 3300006195 Bacteria 1729
184 Ga0097621_100055205 3300006237 Bacteria 3243
185 Ga0097621_100072846 3300006237 Bacteria 2843
186 Ga0097621_100132551 3300006237 Bacteria 2122
187 Ga0097621_100387507 3300006237 Bacteria 1249
188 Ga0097621_100930637 3300006237 Bacteria 811
189 Ga0075370_10067259 3300006353 Bacteria 2045
190 Ga0068871_100120416 3300006358 Bacteria 2216
191 Ga0068871_100236251 3300006358 Bacteria 1588
192 Ga0068871_100259973 3300006358 Bacteria 1514
193 Ga0068871_100277859 3300006358 Bacteria 1464
194 Ga0068871_100300626 3300006358 Bacteria 1409
195 Ga0068871_100633682 3300006358 Bacteria 975
196 Ga0068871_100659807 3300006358 Bacteria 956
197 Ga0068871_101682470 3300006358 Viruses 602
198 Ga0068865_100048462 3300006881 Bacteria 2923
199 Ga0068865_100174810 3300006881 Bacteria 1649
200 Ga0068865_100419467 3300006881 Bacteria 1100
201 Ga0068865_100708593 3300006881 Unclassified 861
202 Ga0097620_100000037 3300006931 Bacteria 165480
203 Ga0097620_100020785 3300006931 Bacteria 6589
204 Ga0097620_100081998 3300006931 Bacteria 3268
205 Ga0097620_100255368 3300006931 Bacteria 1843
206 Ga0097620_100875599 3300006931 Bacteria 984
207 Ga0105240_10050909 3300009093 Bacteria 5216
208 Ga0105240_10143798 3300009093 Bacteria 2848
209 Ga0105245_10844215 3300009098 Unclassified 956
210 Ga0105245_11142442 3300009098 Bacteria 826
211 Ga0105241_10004422 3300009174 Bacteria 10394
212 Ga0105241_10029296 3300009174 Bacteria 4107
213 Ga0105241_11491238 3300009174 Bacteria 650
214 Ga0105242_10013197 3300009176 Bacteria 6378
215 Ga0105242_10155933 3300009176 Bacteria 1995
216 Ga0105242_11264901 3300009176 Bacteria 760
217 Ga0105248_10653434 3300009177 Bacteria 1186
218 Ga0105248_12623225 3300009177 Unclassified 574
219 Ga0105237_10001799 3300009545 Bacteria 27692
220 Ga0105237_10026344 3300009545 Bacteria 5942
221 Ga0105237_10030357 3300009545 Bacteria 5490
222 Ga0105249_10025373 3300009553 Bacteria 5335
223 Ga0105249_10034435 3300009553 Bacteria 4590
224 Ga0105249_10042127 3300009553 Bacteria 4151
225 Ga0105249_10439509 3300009553 Bacteria 1341
226 Ga0105239_10041952 3300010375 Bacteria 5013
227 Ga0105239_10369170 3300010375 Bacteria 1622
228 Ga0105239_12370618 3300010375 Viruses 618
229 Ga0105246_10064093 3300011119 Bacteria 2566
230 Ga0157373_10005189 3300013100 Bacteria 9789
231 Ga0157373_10009541 3300013100 Bacteria 7164
232 Ga0157373_10017909 3300013100 Bacteria 5157
233 Ga0157373_10023280 3300013100 Bacteria 4492
234 Ga0157373_10047361 3300013100 Bacteria 3067
235 Ga0157373_10085170 3300013100 Bacteria 2228
236 Ga0157373_10153384 3300013100 Unclassified 1620
237 Ga0157373_10224010 3300013100 Bacteria 1327
238 Ga0157373_10831495 3300013100 Bacteria 682
239 Ga0157371_10001816 3300013102 Bacteria 21541
240 Ga0157371_10004257 3300013102 Bacteria 12588
241 Ga0157371_10004272 3300013102 Bacteria 12548
242 Ga0157371_10005830 3300013102 Bacteria 10306
243 Ga0157371_10010677 3300013102 Bacteria 7131
244 Ga0157371_10017891 3300013102 Bacteria 5255
245 Ga0157371_10026837 3300013102 Bacteria 4182
246 Ga0157371_10030995 3300013102 Bacteria 3853
247 Ga0157371_10031760 3300013102 Bacteria 3803
248 Ga0157371_10049377 3300013102 Bacteria 2989
249 Ga0157371_10124977 3300013102 Bacteria 1829
250 Ga0157371_10175412 3300013102 Bacteria 1532
251 Ga0157371_10262549 3300013102 Bacteria 1245
252 Ga0157371_10494158 3300013102 Bacteria 903
253 Ga0157371_10698908 3300013102 Bacteria 759
254 Ga0157371_11519671 3300013102 Bacteria 523
255 Ga0157370_10000926 3300013104 Bacteria 37246
256 Ga0157370_10006378 3300013104 Bacteria 13019
257 Ga0157370_10016943 3300013104 Bacteria 7366
258 Ga0157370_10131840 3300013104 Bacteria 2331
259 Ga0157370_10160962 3300013104 Bacteria 2088
260 Ga0157370_10164444 3300013104 Bacteria 2064
261 Ga0157370_10231471 3300013104 Unclassified 1710
262 Ga0157370_10427934 3300013104 Unclassified 1217
263 Ga0157370_10567109 3300013104 Bacteria 1040
264 Ga0157370_10611584 3300013104 Bacteria 997
265 Ga0157370_11216350 3300013104 Unclassified 680
266 Ga0157370_12007741 3300013104 Unclassified 519
267 Ga0157369_10015072 3300013105 Bacteria 8726
268 Ga0157369_10026567 3300013105 Bacteria 6421
269 Ga0157369_10193555 3300013105 Bacteria 2136
270 Ga0157369_10582804 3300013105 Bacteria 1155
271 Ga0157369_10700930 3300013105 Bacteria 1043
272 Ga0157369_11582624 3300013105 Bacteria 666
273 Ga0157369_11639453 3300013105 Bacteria 654
274 Ga0157374_10039891 3300013296 Bacteria 4323
275 Ga0157374_10194867 3300013296 Bacteria 1983
276 Ga0157374_10206606 3300013296 Bacteria 1925
277 Ga0157374_10585402 3300013296 Bacteria 1125
278 Ga0157374_10937409 3300013296 Bacteria 884
279 Ga0157378_10023958 3300013297 Bacteria 5369
280 Ga0157378_10033932 3300013297 Bacteria 4514
281 Ga0157378_10038223 3300013297 Bacteria 4253
282 Ga0157378_10086747 3300013297 Bacteria 2838
283 Ga0157378_10096011 3300013297 Bacteria 2701
284 Ga0157378_10292354 3300013297 Bacteria 1574
285 Ga0157378_10382444 3300013297 Bacteria 1383
286 Ga0157378_11519532 3300013297 Bacteria 714
287 Ga0157378_11952845 3300013297 Bacteria 636
288 Ga0163162_10019180 3300013306 Bacteria 6706
289 Ga0163162_10022131 3300013306 Bacteria 6265
290 Ga0163162_10341452 3300013306 Bacteria 1630
291 Ga0163162_10596737 3300013306 Unclassified 1231
292 Ga0157372_10005863 3300013307 Bacteria 13076
293 Ga0157372_10009847 3300013307 Bacteria 10166
294 Ga0157372_10023315 3300013307 Bacteria 6708
295 Ga0157372_10027520 3300013307 Bacteria 6194
296 Ga0157372_10051775 3300013307 Bacteria 4570
297 Ga0157372_10052039 3300013307 Bacteria 4558
298 Ga0157372_10065955 3300013307 Bacteria 4067
299 Ga0157372_10068543 3300013307 Bacteria 3988
300 Ga0157372_10118553 3300013307 Bacteria 3037
301 Ga0157372_10164874 3300013307 Bacteria 2562
302 Ga0157372_10336168 3300013307 Bacteria 1759
303 Ga0157372_10451564 3300013307 Bacteria 1498
304 Ga0157372_10486880 3300013307 Bacteria 1438
305 Ga0157372_10584589 3300013307 Bacteria 1302
306 Ga0157372_10678496 3300013307 Unclassified 1199
307 Ga0157375_10074649 3300013308 Bacteria 3413
308 Ga0157375_10134759 3300013308 Bacteria 2592
309 Ga0163163_10003543 3300014325 Bacteria 13261
310 Ga0163163_10018795 3300014325 Bacteria 6479
311 Ga0163163_10310019 3300014325 Bacteria 1631
312 Ga0163163_10391301 3300014325 Bacteria 1448
313 Ga0163163_10453410 3300014325 Bacteria 1343
314 Ga0157377_10316233 3300014745 Bacteria 1036
315 Ga0157377_10388005 3300014745 Bacteria 948
316 Ga0157377_11675889 3300014745 Bacteria 512
317 Ga0157379_10475571 3300014968 Bacteria 1156
318 Ga0157379_11795781 3300014968 Unclassified 602
319 Ga0157376_10082841 3300014969 Bacteria 2758
320 Ga0157376_10367670 3300014969 Bacteria 1381
321 Ga0207697_10008991 3300025315 Bacteria 4335
322 Ga0207656_10077533 3300025321 Bacteria 1488
323 Ga0207656_10105848 3300025321 Bacteria 1294
324 Ga0207682_10005663 3300025893 Bacteria 5074
325 Ga0207642_10016411 3300025899 Bacteria 2788
326 Ga0207642_10098027 3300025899 Bacteria 1465
327 Ga0207688_10023208 3300025901 Bacteria 3396
328 Ga0207680_10000549 3300025903 Bacteria 17807
329 Ga0207680_10392694 3300025903 Bacteria 980
330 Ga0207680_10496191 3300025903 Bacteria 869
331 Ga0207647_10000110 3300025904 Bacteria 62980
332 Ga0207647_10150888 3300025904 Bacteria 1358
333 Ga0207647_10160929 3300025904 Bacteria 1309
334 Ga0207645_10003925 3300025907 Bacteria 11107
335 Ga0207643_10008110 3300025908 Bacteria 5636
336 Ga0207643_10241523 3300025908 Unclassified 1110
337 Ga0207643_10798953 3300025908 Unclassified 611
338 Ga0207705_10003791 3300025909 Bacteria 11514
339 Ga0207705_10011169 3300025909 Bacteria 6510
340 Ga0207705_10012277 3300025909 Bacteria 6189
341 Ga0207705_10297302 3300025909 Bacteria 1238
342 Ga0207705_10529120 3300025909 Bacteria 916
343 Ga0207654_10002504 3300025911 Bacteria 9335
344 Ga0207654_10133228 3300025911 Bacteria 1575
345 Ga0207654_11167499 3300025911 Bacteria 561
346 Ga0207707_10061555 3300025912 Bacteria 3266
347 Ga0207707_10156430 3300025912 Bacteria 1994
348 Ga0207707_10243095 3300025912 Bacteria 1564
349 Ga0207695_10004647 3300025913 Bacteria 18602
350 Ga0207695_11220577 3300025913 Bacteria 632
351 Ga0207671_10001737 3300025914 Bacteria 24547
352 Ga0207671_10065906 3300025914 Bacteria 2694
353 Ga0207660_10031422 3300025917 Bacteria 3657
354 Ga0207660_10056813 3300025917 Bacteria 2801
355 Ga0207660_10070778 3300025917 Bacteria 2536
356 Ga0207660_10156767 3300025917 Unclassified 1753
357 Ga0207660_10179730 3300025917 Bacteria 1642
358 Ga0207660_10528296 3300025917 Bacteria 959
359 Ga0207660_11042035 3300025917 Bacteria 667
360 Ga0207657_10021530 3300025919 Bacteria 6063
361 Ga0207657_10085929 3300025919 Bacteria 2634
362 Ga0207657_10121424 3300025919 Bacteria 2150
363 Ga0207657_10121429 3300025919 Bacteria 2150
364 Ga0207657_10137673 3300025919 Bacteria 1997
365 Ga0207657_10211750 3300025919 Bacteria 1555
366 Ga0207657_10381875 3300025919 Bacteria 1109
367 Ga0207657_10642082 3300025919 Bacteria 827
368 Ga0207652_10000064 3300025921 Bacteria 111997
369 Ga0207652_10000387 3300025921 Bacteria 45946
370 Ga0207652_10025804 3300025921 Bacteria 4889
371 Ga0207652_10028714 3300025921 Bacteria 4644
372 Ga0207681_10050401 3300025923 Bacteria 2817
373 Ga0207681_10250411 3300025923 Bacteria 1383
374 Ga0207681_11148520 3300025923 Bacteria 652
375 Ga0207650_10045585 3300025925 Bacteria 3226
376 Ga0207650_10104967 3300025925 Bacteria 2180
377 Ga0207650_10144645 3300025925 Bacteria 1872
378 Ga0207650_10229042 3300025925 Bacteria 1498
379 Ga0207650_10320960 3300025925 Unclassified 1268
380 Ga0207650_10778631 3300025925 Unclassified 810
381 Ga0207659_10027831 3300025926 Bacteria 3833
382 Ga0207659_10082344 3300025926 Bacteria 2382
383 Ga0207687_10638427 3300025927 Viruses 900
384 Ga0207644_10012719 3300025931 Bacteria 5596
385 Ga0207644_10139359 3300025931 Bacteria 1866
386 Ga0207644_10218968 3300025931 Bacteria 1508
387 Ga0207644_10494007 3300025931 Bacteria 1009
388 Ga0207644_10934281 3300025931 Bacteria 727
389 Ga0207690_10018477 3300025932 Bacteria 4275
390 Ga0207690_10038464 3300025932 Bacteria 3114
391 Ga0207690_10153779 3300025932 Bacteria 1708
392 Ga0207690_10306551 3300025932 Bacteria 1244
393 Ga0207706_10325315 3300025933 Bacteria 1338
394 Ga0207709_10276791 3300025935 Bacteria 1238
395 Ga0207670_10072264 3300025936 Bacteria 2388
396 Ga0207670_10608599 3300025936 Bacteria 898
397 Ga0207669_10063854 3300025937 Bacteria 2275
398 Ga0207669_10190533 3300025937 Bacteria 1479
399 Ga0207669_10435071 3300025937 Bacteria 1036
400 Ga0207704_10051784 3300025938 Bacteria 2485
401 Ga0207704_10742067 3300025938 Bacteria 816
402 Ga0207691_10002741 3300025940 Bacteria 17182
403 Ga0207691_10021049 3300025940 Bacteria 6162
404 Ga0207691_10098747 3300025940 Bacteria 2608
405 Ga0207691_10263733 3300025940 Bacteria 1485
406 Ga0207689_10006806 3300025942 Bacteria 10058
407 Ga0207689_10007410 3300025942 Bacteria 9621
408 Ga0207689_10008752 3300025942 Bacteria 8802
409 Ga0207689_10016323 3300025942 Bacteria 6289
410 Ga0207689_10200458 3300025942 Bacteria 1647
411 Ga0207661_10080675 3300025944 Bacteria 2685
412 Ga0207661_10169624 3300025944 Bacteria 1899
413 Ga0207661_11130424 3300025944 Bacteria 721
414 Ga0207661_11296362 3300025944 Bacteria 669
415 Ga0207661_11506522 3300025944 Unclassified 616
416 Ga0207679_10324798 3300025945 Bacteria 1334
417 Ga0207679_10366507 3300025945 Bacteria 1260
418 Ga0207679_10551638 3300025945 Bacteria 1034
419 Ga0207667_10001484 3300025949 Bacteria 29439
420 Ga0207667_10005923 3300025949 Bacteria 14885
421 Ga0207667_10013969 3300025949 Bacteria 9172
422 Ga0207667_10403618 3300025949 Bacteria 1391
423 Ga0207667_10864688 3300025949 Bacteria 898
424 Ga0207651_10022746 3300025960 Bacteria 3841
425 Ga0207651_10031501 3300025960 Bacteria 3391
426 Ga0207651_10915923 3300025960 Bacteria 781
427 Ga0207651_11208489 3300025960 Bacteria 679
428 Ga0207712_10067935 3300025961 Bacteria 2552
429 Ga0207712_10344327 3300025961 Bacteria 1237
430 Ga0207712_10999122 3300025961 Unclassified 742
431 Ga0207668_10058350 3300025972 Bacteria 2697
432 Ga0207668_10067335 3300025972 Bacteria 2542
433 Ga0207668_10108918 3300025972 Bacteria 2074
434 Ga0207668_10208272 3300025972 Bacteria 1562
435 Ga0207668_11263294 3300025972 Unclassified 664
436 Ga0207640_10354440 3300025981 Bacteria 1180
437 Ga0207640_10624296 3300025981 Bacteria 915
438 Ga0207658_10042980 3300025986 Bacteria 3282
439 Ga0207658_10248437 3300025986 Bacteria 1510
440 Ga0207658_11497822 3300025986 Bacteria 617
441 Ga0207677_10015189 3300026023 Bacteria 4519
442 Ga0207677_10045605 3300026023 Bacteria 2928
443 Ga0207677_10123787 3300026023 Bacteria 1950
444 Ga0207677_10529694 3300026023 Bacteria 1023
445 Ga0207677_10603298 3300026023 Unclassified 963
446 Ga0207703_10178190 3300026035 Bacteria 1874
447 Ga0207639_10112784 3300026041 Bacteria 2219
448 Ga0207639_10194184 3300026041 Bacteria 1736
449 Ga0207678_10056701 3300026067 Bacteria 3372
450 Ga0207708_10051137 3300026075 Bacteria 3145
451 Ga0207702_10209088 3300026078 Bacteria 1813
452 Ga0207641_10000121 3300026088 Bacteria 114943
453 Ga0207641_10022397 3300026088 Bacteria 5201
454 Ga0207648_10002625 3300026089 Bacteria 19241
455 Ga0207648_10122134 3300026089 Bacteria 2290
456 Ga0207648_10131543 3300026089 Bacteria 2203
457 Ga0207648_10705553 3300026089 Unclassified 935
458 Ga0207676_10011505 3300026095 Bacteria 6328
459 Ga0207676_10055443 3300026095 Bacteria 3111
460 Ga0207676_10258165 3300026095 Bacteria 1572
461 Ga0207676_10393194 3300026095 Bacteria 1294
462 Ga0207676_10400647 3300026095 Bacteria 1282
463 Ga0207676_11129825 3300026095 Bacteria 775
464 Ga0207674_10119591 3300026116 Bacteria 2603
465 Ga0207674_10201881 3300026116 Bacteria 1938
466 Ga0207674_10210240 3300026116 Bacteria 1895
467 Ga0207674_10215348 3300026116 Bacteria 1869
468 Ga0207674_10255372 3300026116 Bacteria 1700
469 Ga0207674_10313303 3300026116 Bacteria 1518
470 Ga0207674_11755215 3300026116 Bacteria 588
471 Ga0207675_100142074 3300026118 Bacteria 2281
472 Ga0207675_100791857 3300026118 Bacteria 961
473 Ga0207683_10017329 3300026121 Bacteria 6139
474 Ga0207683_10027854 3300026121 Bacteria 4883
475 Ga0207683_10562224 3300026121 Bacteria 1055
476 Ga0207698_10001488 3300026142 Bacteria 13640
477 Ga0207698_10019868 3300026142 Bacteria 4611
478 Ga0207698_10588973 3300026142 Bacteria 1095
479 Ga0207698_10653413 3300026142 Bacteria 1042
480 Ga0207698_10664879 3300026142 Bacteria 1033
481 Ga0207698_10734326 3300026142 Bacteria 985
482 Ga0207698_10746369 3300026142 Bacteria 977
483 Ga0207698_10873486 3300026142 Bacteria 905
484 Ga0207698_11175885 3300026142 Unclassified 781
485 Ga0209995_1091575 3300027471 Bacteria 523
486 Ga0209999_1017301 3300027543 Bacteria 1315
487 Ga0268266_10010826 3300028379 Bacteria 7945
488 Ga0268266_10238704 3300028379 Bacteria 1677
489 Ga0268265_10248801 3300028380 Bacteria 1573
490 Ga0268265_10364467 3300028380 Bacteria 1324
491 Ga0268265_10658726 3300028380 Bacteria 1007
492 Ga0268264_10009265 3300028381 Bacteria 8152
493 Ga0268264_10022499 3300028381 Bacteria 5146
494 Ga0268264_10085743 3300028381 Bacteria 2704
495 Ga0268264_10555698 3300028381 Bacteria 1126
496 Ga0268264_11818977 3300028381 Bacteria 619
497 Ga0307509_10180326 3300031507 Bacteria 1978
498 Ga0307509_10187790 3300031507 Bacteria 1922
499 Ga0307508_10432466 3300031616 Bacteria 908
500 Ga0307409_100942581 3300031995 Bacteria 879
501 Ga0307415_100225011 3300032126 Bacteria 1507
502 Ga0307415_101050652 3300032126 Bacteria 760
503 Ga0373937_0636576 3300036401 Bacteria 1012
504 Ga0395899_0011094 3300037312 Bacteria 6901
505 Ga0395899_0022301 3300037312 Bacteria 4802
506 Ga0395899_0050016 3300037312 Bacteria 3104
507 Ga0395899_0075427 3300037312 Bacteria 2462
508 Ga0395899_0238136 3300037312 Bacteria 1253
509 Ga0395900_0006742 3300037418 Bacteria 11915
510 Ga0395900_0019424 3300037418 Bacteria 6928
511 Ga0395900_0063083 3300037418 Bacteria 3809
512 Ga0395900_0099960 3300037418 Bacteria 2979
513 Ga0395900_0155317 3300037418 Bacteria 2337
514 Ga0395900_0159138 3300037418 Bacteria 2304
515 Ga0395900_0210174 3300037418 Bacteria 1965
516 Ga0395900_0308705 3300037418 Bacteria 1565
517 Ga0395900_0573138 3300037418 Bacteria 1071
518 Ga0395900_0781491 3300037418 Bacteria 884
519 Ga0395900_1656166 3300037418 Unclassified 551
520 Ga0395898_0003249 3300037466 Bacteria 18266
521 Ga0395898_0018047 3300037466 Bacteria 7198
522 Ga0395898_0032202 3300037466 Bacteria 5232
523 Ga0395898_0044959 3300037466 Bacteria 4341
524 Ga0395898_0156418 3300037466 Bacteria 2180
525 Ga0395898_1121746 3300037466 Bacteria 719
526 Ga0395905_0002823 3300037471 Bacteria 19037
527 Ga0395905_0018728 3300037471 Bacteria 6567
528 Ga0395905_0178401 3300037471 Bacteria 1994
529 Ga0395905_0480294 3300037471 Bacteria 1142
530 Ga0395905_1189483 3300037471 Unclassified 666
531 Ga0395901_0001115 3300038443 Bacteria 28520
532 Ga0395901_0019788 3300038443 Bacteria 6884
533 Ga0395901_0072630 3300038443 Bacteria 3587
534 Ga0395901_0100428 3300038443 Bacteria 3035
535 Ga0395901_0179794 3300038443 Bacteria 2218
536 Ga0436365_0463798 3300039437 Bacteria 791
537 Ga0451807_1341348 3300041486 Bacteria 786
538 Ga0451853_3700620 3300041512 Unclassified 576
539 Ga0439441_020187 3300042001 Bacteria 1219
540 Ga0439445_0090417 3300042004 Bacteria 862
541 Ga0439449_0003312 3300042007 Bacteria 6287
542 Ga0439449_0121011 3300042007 Bacteria 972
543 Ga0439462_0059131 3300042015 Bacteria 1036
544 Ga0439464_0148119 3300042439 Bacteria 733
545 Ga0466972_0301098 3300044658 Bacteria 749
546 Ga0453683_0150206 3300044673 Bacteria 1472
547 Ga0453684_0356680 3300044712 Bacteria 1647
548 Ga0466970_0322854 3300044765 Bacteria 873
549 Ga0466970_0409841 3300044765 Bacteria 774
550 Ga0466970_0975596 3300044765 Bacteria 500
551 Ga0466959_0347124 3300045049 Bacteria 1012
552 Ga0466967_0652299 3300045976 Bacteria 1041
553 Ga0495638_0043942 3300046460 Bacteria 2817
554 Ga0495596_0309030 3300046500 Bacteria 615
555 Ga0495625_0468028 3300046660 Unclassified 776
556 Ga0495674_0205023 3300047319 Unclassified 1635
557 Ga0495672_0016334 3300047320 Bacteria 5006
558 Ga0501305_026658 3300049161 Bacteria 883
559 Ga0501323_052966 3300049539 Bacteria 619
560 Ga0501335_001284 3300049551 Bacteria 1902
561 Ga0501335_005288 3300049551 Bacteria 1149
562 Ga0501031_0029533 3300049568 Bacteria 3576
563 Ga0501032_0369855 3300049569 Bacteria 922
564 Ga0501033_0532843 3300049570 Bacteria 810
565 Ga0501033_0543865 3300049570 Bacteria 800
566 Ga0501034_0056521 3300049571 Bacteria 3948
567 Ga0501034_0108703 3300049571 Bacteria 2764
568 Ga0501034_0474628 3300049571 Bacteria 1166
569 Ga0501036_0404563 3300049572 Unclassified 1138
570 Ga0501037_0075415 3300049573 Bacteria 2449
571 Ga0501038_0005905 3300049574 Bacteria 11315
572 Ga0501039_0020673 3300049575 Bacteria 5044
573 Ga0501043_0309165 3300049579 Bacteria 1206
574 Ga0501043_0653184 3300049579 Bacteria 772
575 Ga0501046_0048615 3300049580 Bacteria 3358
576 Ga0501070_0097388 3300049586 Bacteria 2433
577 Ga0501257_009663 3300049686 Bacteria 2181
578 Ga0501225_0166390 3300049705 Bacteria 681
579 Ga0501035_0021560 3300049822 Bacteria 5924
580 Ga0501035_0045504 3300049822 Bacteria 3949
581 Ga0501035_0060198 3300049822 Bacteria 3381
582 Ga0501044_0096887 3300049823 Bacteria 2971
583 Ga0501044_0279506 3300049823 Bacteria 1603
584 Ga0501044_0442599 3300049823 Bacteria 1207
585 nmdc:mga0k408_121610_c1 3300050493 Bacteria 1546
586 nmdc:mga0k408_402144_c1 3300050493 Bacteria 815
587 nmdc:mga07m45_248929_c1 3300050496 Bacteria 1034
588 nmdc:mga07m45_80707_c1 3300050496 Bacteria 1857
589 nmdc:mga0rr50_1215258_c1 3300050513 Unclassified 640
590 Ga0500641_0128012 3300053096 Bacteria 1095
591 Ga0500568_0000439 3300053139 Bacteria 31243
592 Ga0500588_0000910 3300053146 Bacteria 5216
593 Ga0500604_0150685 3300053151 Bacteria 789
594 Ga0587090_140782 3300059510 Bacteria 539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0150206 Ga0453683_0150206_96_587 122
2 3300049823 Ga0501044_0096887 Ga0501044_0096887_1178_1657 122
3 3300005459 Ga0068867_100422685 Ga0068867_1004226852 128
4 3300005719 Ga0068861_100280713 Ga0068861_1002807132 128
5 3300006881 Ga0068865_100174810 Ga0068865_1001748102 128
6 3300009176 Ga0105242_10155933 Ga0105242_101559332 128
7 3300013100 Ga0157373_10153384 Ga0157373_101533841 128
8 3300003203 JGI25406J46586_10042774 JGI25406J46586_100427744 129
9 3300005336 Ga0070680_100096257 Ga0070680_1000962572 129
10 3300005336 Ga0070680_101683585 Ga0070680_1016835851 129
11 3300005339 Ga0070660_100117026 Ga0070660_1001170263 129
12 3300005340 Ga0070689_100876698 Ga0070689_1008766982 129
13 3300005353 Ga0070669_100582595 Ga0070669_1005825951 129
14 3300005455 Ga0070663_100799477 Ga0070663_1007994772 129
15 3300005459 Ga0068867_100099678 Ga0068867_1000996782 129
16 3300005530 Ga0070679_101290412 Ga0070679_1012904121 129
17 3300005530 Ga0070679_101745677 Ga0070679_1017456771 129
18 3300005563 Ga0068855_100035596 Ga0068855_1000355962 129
19 3300005577 Ga0068857_101923381 Ga0068857_1019233811 129
20 3300005617 Ga0068859_100020784 Ga0068859_10002078410 129
21 3300005843 Ga0068860_100008499 Ga0068860_1000084995 129
22 3300005844 Ga0068862_100204985 Ga0068862_1002049852 129
23 3300005985 Ga0081539_10004959 Ga0081539_1000495911 129
24 3300006931 Ga0097620_100020785 Ga0097620_10002078510 129
25 3300013100 Ga0157373_10009541 Ga0157373_1000954113 129
26 3300013100 Ga0157373_10224010 Ga0157373_102240101 129
27 3300013102 Ga0157371_10030995 Ga0157371_100309957 129
28 3300013102 Ga0157371_11519671 Ga0157371_115196711 129
29 3300013104 Ga0157370_11216350 Ga0157370_112163501 129
30 3300013296 Ga0157374_10937409 Ga0157374_109374091 129
31 3300013306 Ga0163162_10341452 Ga0163162_103414522 129
32 3300013307 Ga0157372_10009847 Ga0157372_100098473 129
33 3300014325 Ga0163163_10391301 Ga0163163_103913012 129
34 3300025917 Ga0207660_11042035 Ga0207660_110420351 129
35 3300025919 Ga0207657_10211750 Ga0207657_102117503 129
36 3300025923 Ga0207681_11148520 Ga0207681_111485201 129
37 3300025932 Ga0207690_10038464 Ga0207690_100384644 129
38 3300025949 Ga0207667_10013969 Ga0207667_1001396917 129
39 3300025986 Ga0207658_11497822 Ga0207658_114978221 129
40 3300026095 Ga0207676_10258165 Ga0207676_102581653 129
41 3300026116 Ga0207674_10313303 Ga0207674_103133033 129
42 3300028380 Ga0268265_10658726 Ga0268265_106587261 129
43 3300028381 Ga0268264_10022499 Ga0268264_100224995 129
44 3300037418 Ga0395900_0781491 Ga0395900_0781491_38_484 129
45 3300037418 Ga0395900_1656166 Ga0395900_1656166_30_476 129
46 3300037471 Ga0395905_1189483 Ga0395905_1189483_190_636 129
47 3300045976 Ga0466967_0652299 Ga0466967_0652299_451_897 129
48 3300049570 Ga0501033_0532843 Ga0501033_0532843_48_497 129
49 3300049571 Ga0501034_0108703 Ga0501034_0108703_992_1441 129
50 3300049586 Ga0501070_0097388 Ga0501070_0097388_123_572 129
51 3300049822 Ga0501035_0060198 Ga0501035_0060198_2746_3195 129
52 3300005327 Ga0070658_10106103 Ga0070658_101061035 130
53 3300005327 Ga0070658_10922207 Ga0070658_109222072 130
54 3300005330 Ga0070690_101081047 Ga0070690_1010810471 130
55 3300005334 Ga0068869_100054977 Ga0068869_1000549773 130
56 3300005334 Ga0068869_100339561 Ga0068869_1003395612 130
57 3300005335 Ga0070666_10000736 Ga0070666_100007363 130
58 3300005336 Ga0070680_100404158 Ga0070680_1004041582 130
59 3300005337 Ga0070682_100011807 Ga0070682_1000118076 130
60 3300005338 Ga0068868_100025438 Ga0068868_1000254382 130
61 3300005338 Ga0068868_100198485 Ga0068868_1001984853 130
62 3300005340 Ga0070689_100054673 Ga0070689_1000546733 130
63 3300005344 Ga0070661_100439137 Ga0070661_1004391372 130
64 3300005355 Ga0070671_100029574 Ga0070671_1000295743 130
65 3300005355 Ga0070671_100085773 Ga0070671_1000857732 130
66 3300005364 Ga0070673_100042352 Ga0070673_1000423525 130
67 3300005364 Ga0070673_100042547 Ga0070673_1000425474 130
68 3300005367 Ga0070667_100003905 Ga0070667_1000039056 130
69 3300005367 Ga0070667_100063899 Ga0070667_1000638995 130
70 3300005458 Ga0070681_10472662 Ga0070681_104726623 130
71 3300005466 Ga0070685_10030414 Ga0070685_100304146 130
72 3300005530 Ga0070679_100001469 Ga0070679_10000146916 130
73 3300005539 Ga0068853_100229702 Ga0068853_1002297022 130
74 3300005543 Ga0070672_100842449 Ga0070672_1008424492 130
75 3300005563 Ga0068855_100403081 Ga0068855_1004030813 130
76 3300005564 Ga0070664_100534396 Ga0070664_1005343962 130
77 3300005577 Ga0068857_100984590 Ga0068857_1009845902 130
78 3300005578 Ga0068854_100098801 Ga0068854_1000988012 130
79 3300005578 Ga0068854_101597070 Ga0068854_1015970701 130
80 3300005616 Ga0068852_100001428 Ga0068852_10000142814 130
81 3300005616 Ga0068852_101103602 Ga0068852_1011036022 130
82 3300005617 Ga0068859_100000037 Ga0068859_100000037119 130
83 3300005617 Ga0068859_100255383 Ga0068859_1002553831 130
84 3300005617 Ga0068859_100875607 Ga0068859_1008756072 130
85 3300005618 Ga0068864_100018148 Ga0068864_1000181481 130
86 3300005618 Ga0068864_100038806 Ga0068864_1000388062 130
87 3300005618 Ga0068864_100061735 Ga0068864_1000617355 130
88 3300005719 Ga0068861_100427823 Ga0068861_1004278232 130
89 3300005834 Ga0068851_10025363 Ga0068851_100253632 130
90 3300005841 Ga0068863_100004306 Ga0068863_1000043065 130
91 3300005841 Ga0068863_100031353 Ga0068863_1000313539 130
92 3300005842 Ga0068858_100043398 Ga0068858_1000433985 130
93 3300005842 Ga0068858_100808008 Ga0068858_1008080082 130
94 3300005843 Ga0068860_100006743 Ga0068860_10000674312 130
95 3300005843 Ga0068860_100085954 Ga0068860_1000859543 130
96 3300006237 Ga0097621_100072846 Ga0097621_1000728462 130
97 3300006237 Ga0097621_100132551 Ga0097621_1001325512 130
98 3300006237 Ga0097621_100930637 Ga0097621_1009306372 130
99 3300006358 Ga0068871_100300626 Ga0068871_1003006262 130
100 3300006358 Ga0068871_100659807 Ga0068871_1006598072 130
101 3300006358 Ga0068871_101682470 Ga0068871_1016824702 130
102 3300006881 Ga0068865_100708593 Ga0068865_1007085931 130
103 3300006931 Ga0097620_100000037 Ga0097620_100000037119 130
104 3300006931 Ga0097620_100255368 Ga0097620_1002553684 130
105 3300006931 Ga0097620_100875599 Ga0097620_1008755991 130
106 3300009098 Ga0105245_10844215 Ga0105245_108442151 130
107 3300009174 Ga0105241_10004422 Ga0105241_1000442214 130
108 3300009174 Ga0105241_11491238 Ga0105241_114912381 130
109 3300009176 Ga0105242_11264901 Ga0105242_112649011 130
110 3300009177 Ga0105248_10653434 Ga0105248_106534342 130
111 3300009177 Ga0105248_12623225 Ga0105248_126232252 130
112 3300009545 Ga0105237_10001799 Ga0105237_1000179931 130
113 3300009553 Ga0105249_10025373 Ga0105249_100253737 130
114 3300010375 Ga0105239_12370618 Ga0105239_123706181 130
115 3300013104 Ga0157370_10006378 Ga0157370_100063782 130
116 3300013104 Ga0157370_10567109 Ga0157370_105671092 130
117 3300013105 Ga0157369_10700930 Ga0157369_107009302 130
118 3300013296 Ga0157374_10039891 Ga0157374_100398914 130
119 3300013296 Ga0157374_10585402 Ga0157374_105854021 130
120 3300013297 Ga0157378_10023958 Ga0157378_1002395811 130
121 3300013297 Ga0157378_10033932 Ga0157378_100339323 130
122 3300013297 Ga0157378_10292354 Ga0157378_102923542 130
123 3300013297 Ga0157378_10382444 Ga0157378_103824441 130
124 3300013297 Ga0157378_11519532 Ga0157378_115195321 130
125 3300013297 Ga0157378_11952845 Ga0157378_119528451 130
126 3300013306 Ga0163162_10022131 Ga0163162_100221312 130
127 3300013306 Ga0163162_10596737 Ga0163162_105967371 130
128 3300013307 Ga0157372_10118553 Ga0157372_101185532 130
129 3300013308 Ga0157375_10074649 Ga0157375_100746494 130
130 3300013308 Ga0157375_10134759 Ga0157375_101347594 130
131 3300014325 Ga0163163_10003543 Ga0163163_1000354314 130
132 3300014325 Ga0163163_10453410 Ga0163163_104534103 130
133 3300014968 Ga0157379_11795781 Ga0157379_117957811 130
134 3300014969 Ga0157376_10082841 Ga0157376_100828412 130
135 3300025321 Ga0207656_10077533 Ga0207656_100775331 130
136 3300025321 Ga0207656_10105848 Ga0207656_101058482 130
137 3300025903 Ga0207680_10000549 Ga0207680_1000054910 130
138 3300025909 Ga0207705_10003791 Ga0207705_100037914 130
139 3300025909 Ga0207705_10012277 Ga0207705_100122777 130
140 3300025911 Ga0207654_10002504 Ga0207654_100025045 130
141 3300025911 Ga0207654_11167499 Ga0207654_111674991 130
142 3300025912 Ga0207707_10156430 Ga0207707_101564302 130
143 3300025914 Ga0207671_10001737 Ga0207671_1000173722 130
144 3300025917 Ga0207660_10070778 Ga0207660_100707784 130
145 3300025921 Ga0207652_10028714 Ga0207652_100287144 130
146 3300025925 Ga0207650_10144645 Ga0207650_101446454 130
147 3300025925 Ga0207650_10778631 Ga0207650_107786311 130
148 3300025927 Ga0207687_10638427 Ga0207687_106384272 130
149 3300025931 Ga0207644_10012719 Ga0207644_1001271910 130
150 3300025931 Ga0207644_10218968 Ga0207644_102189682 130
151 3300025933 Ga0207706_10325315 Ga0207706_103253152 130
152 3300025935 Ga0207709_10276791 Ga0207709_102767911 130
153 3300025936 Ga0207670_10072264 Ga0207670_100722643 130
154 3300025938 Ga0207704_10742067 Ga0207704_107420671 130
155 3300025942 Ga0207689_10016323 Ga0207689_100163234 130
156 3300025944 Ga0207661_11130424 Ga0207661_111304242 130
157 3300025949 Ga0207667_10864688 Ga0207667_108646881 130
158 3300025960 Ga0207651_10031501 Ga0207651_100315013 130
159 3300025961 Ga0207712_10067935 Ga0207712_100679352 130
160 3300025972 Ga0207668_10208272 Ga0207668_102082722 130
161 3300025972 Ga0207668_11263294 Ga0207668_112632941 130
162 3300025986 Ga0207658_10042980 Ga0207658_100429806 130
163 3300025986 Ga0207658_10248437 Ga0207658_102484372 130
164 3300026023 Ga0207677_10015189 Ga0207677_100151894 130
165 3300026041 Ga0207639_10194184 Ga0207639_101941843 130
166 3300026088 Ga0207641_10000121 Ga0207641_1000012167 130
167 3300026088 Ga0207641_10022397 Ga0207641_100223979 130
168 3300026095 Ga0207676_10055443 Ga0207676_100554434 130
169 3300026095 Ga0207676_10400647 Ga0207676_104006472 130
170 3300026142 Ga0207698_10001488 Ga0207698_100014883 130
171 3300026142 Ga0207698_10019868 Ga0207698_100198685 130
172 3300026142 Ga0207698_10734326 Ga0207698_107343261 130
173 3300026142 Ga0207698_10873486 Ga0207698_108734862 130
174 3300028381 Ga0268264_10009265 Ga0268264_100092655 130
175 3300028381 Ga0268264_10085743 Ga0268264_100857435 130
176 3300031507 Ga0307509_10180326 Ga0307509_101803261 130
177 3300005327 Ga0070658_10065507 Ga0070658_100655074 131
178 3300005327 Ga0070658_10718573 Ga0070658_107185732 131
179 3300005329 Ga0070683_100127769 Ga0070683_1001277693 131
180 3300005336 Ga0070680_100009085 Ga0070680_1000090858 131
181 3300005336 Ga0070680_100144538 Ga0070680_1001445381 131
182 3300005338 Ga0068868_100785936 Ga0068868_1007859362 131
183 3300005339 Ga0070660_101298124 Ga0070660_1012981241 131
184 3300005455 Ga0070663_100028743 Ga0070663_1000287433 131
185 3300005458 Ga0070681_10042072 Ga0070681_100420723 131
186 3300005458 Ga0070681_10104396 Ga0070681_101043966 131
187 3300005530 Ga0070679_100070030 Ga0070679_1000700304 131
188 3300005530 Ga0070679_100701892 Ga0070679_1007018922 131
189 3300005539 Ga0068853_100146766 Ga0068853_1001467662 131
190 3300005563 Ga0068855_100002973 Ga0068855_10000297327 131
191 3300005564 Ga0070664_100768303 Ga0070664_1007683032 131
192 3300005578 Ga0068854_100042884 Ga0068854_1000428846 131
193 3300005614 Ga0068856_100009626 Ga0068856_1000096267 131
194 3300005614 Ga0068856_100031449 Ga0068856_1000314494 131
195 3300006195 Ga0075366_10101253 Ga0075366_101012532 131
196 3300006353 Ga0075370_10067259 Ga0075370_100672595 131
197 3300009093 Ga0105240_10050909 Ga0105240_100509094 131
198 3300009545 Ga0105237_10030357 Ga0105237_100303576 131
199 3300010375 Ga0105239_10041952 Ga0105239_100419524 131
200 3300013100 Ga0157373_10005189 Ga0157373_1000518914 131
201 3300013100 Ga0157373_10017909 Ga0157373_1001790910 131
202 3300013102 Ga0157371_10004272 Ga0157371_1000427217 131
203 3300013102 Ga0157371_10005830 Ga0157371_100058304 131
204 3300013102 Ga0157371_10017891 Ga0157371_100178913 131
205 3300013102 Ga0157371_10031760 Ga0157371_100317605 131
206 3300013102 Ga0157371_10124977 Ga0157371_101249773 131
207 3300013104 Ga0157370_10131840 Ga0157370_101318402 131
208 3300013104 Ga0157370_10164444 Ga0157370_101644442 131
209 3300013105 Ga0157369_10026567 Ga0157369_100265674 131
210 3300013105 Ga0157369_10193555 Ga0157369_101935551 131
211 3300013296 Ga0157374_10206606 Ga0157374_102066063 131
212 3300013306 Ga0163162_10019180 Ga0163162_100191808 131
213 3300013307 Ga0157372_10027520 Ga0157372_100275209 131
214 3300013307 Ga0157372_10051775 Ga0157372_100517751 131
215 3300013307 Ga0157372_10052039 Ga0157372_100520394 131
216 3300013307 Ga0157372_10164874 Ga0157372_101648743 131
217 3300025904 Ga0207647_10150888 Ga0207647_101508883 131
218 3300025909 Ga0207705_10011169 Ga0207705_1001116914 131
219 3300025909 Ga0207705_10529120 Ga0207705_105291201 131
220 3300025912 Ga0207707_10061555 Ga0207707_100615554 131
221 3300025913 Ga0207695_10004647 Ga0207695_100046478 131
222 3300025914 Ga0207671_10065906 Ga0207671_100659066 131
223 3300025917 Ga0207660_10031422 Ga0207660_100314222 131
224 3300025917 Ga0207660_10179730 Ga0207660_101797303 131
225 3300025919 Ga0207657_10085929 Ga0207657_100859291 131
226 3300025919 Ga0207657_10642082 Ga0207657_106420821 131
227 3300025921 Ga0207652_10000387 Ga0207652_1000038750 131
228 3300025925 Ga0207650_10045585 Ga0207650_100455856 131
229 3300025944 Ga0207661_10169624 Ga0207661_101696242 131
230 3300025949 Ga0207667_10001484 Ga0207667_1000148424 131
231 3300025981 Ga0207640_10354440 Ga0207640_103544403 131
232 3300026023 Ga0207677_10529694 Ga0207677_105296941 131
233 3300026067 Ga0207678_10056701 Ga0207678_100567014 131
234 3300026078 Ga0207702_10209088 Ga0207702_102090884 131
235 3300026142 Ga0207698_10746369 Ga0207698_107463692 131
236 3300037312 Ga0395899_0011094 Ga0395899_0011094_3472_3921 131
237 3300037312 Ga0395899_0075427 Ga0395899_0075427_1632_2081 131
238 3300037312 Ga0395899_0238136 Ga0395899_0238136_212_661 131
239 3300037418 Ga0395900_0063083 Ga0395900_0063083_1079_1528 131
240 3300037418 Ga0395900_0099960 Ga0395900_0099960_582_1031 131
241 3300037418 Ga0395900_0155317 Ga0395900_0155317_1407_1856 131
242 3300037418 Ga0395900_0159138 Ga0395900_0159138_446_895 131
243 3300037418 Ga0395900_0573138 Ga0395900_0573138_611_1060 131
244 3300037466 Ga0395898_0018047 Ga0395898_0018047_1246_1695 131
245 3300037466 Ga0395898_0032202 Ga0395898_0032202_2737_3186 131
246 3300037466 Ga0395898_0156418 Ga0395898_0156418_324_773 131
247 3300037471 Ga0395905_0018728 Ga0395905_0018728_4851_5300 131
248 3300037471 Ga0395905_0178401 Ga0395905_0178401_156_605 131
249 3300038443 Ga0395901_0072630 Ga0395901_0072630_191_640 131
250 3300038443 Ga0395901_0100428 Ga0395901_0100428_2130_2579 131
251 3300038443 Ga0395901_0179794 Ga0395901_0179794_1079_1528 131
252 3300042007 Ga0439449_0003312 Ga0439449_0003312_5244_5693 131
253 3300042007 Ga0439449_0121011 Ga0439449_0121011_114_563 131
254 3300042015 Ga0439462_0059131 Ga0439462_0059131_48_497 131
255 3300046460 Ga0495638_0043942 Ga0495638_0043942_2075_2524 131
256 3300046500 Ga0495596_0309030 Ga0495596_0309030_26_475 131
257 3300049161 Ga0501305_026658 Ga0501305_026658_396_872 131
258 3300049539 Ga0501323_052966 Ga0501323_052966_16_465 131
259 3300049551 Ga0501335_001284 Ga0501335_001284_79_528 131
260 3300049551 Ga0501335_005288 Ga0501335_005288_475_924 131
261 3300049686 Ga0501257_009663 Ga0501257_009663_594_1085 131
262 3300049705 Ga0501225_0166390 Ga0501225_0166390_201_650 131
263 3300050493 nmdc:mga0k408_402144_c1 nmdc:mga0k408_402144_c1_162_611 131
264 3300050496 nmdc:mga07m45_80707_c1 nmdc:mga07m45_80707_c1_350_799 131
265 3300053146 Ga0500588_0000910 Ga0500588_0000910_2259_2708 131
266 3300053151 Ga0500604_0150685 Ga0500604_0150685_171_620 131
267 3300005327 Ga0070658_10036030 Ga0070658_100360302 132
268 3300005336 Ga0070680_100101334 Ga0070680_1001013341 132
269 3300005339 Ga0070660_100003216 Ga0070660_1000032162 132
270 3300005339 Ga0070660_100059749 Ga0070660_1000597494 132
271 3300005339 Ga0070660_100420761 Ga0070660_1004207613 132
272 3300005345 Ga0070692_10116032 Ga0070692_101160323 132
273 3300005366 Ga0070659_100051119 Ga0070659_1000511194 132
274 3300005366 Ga0070659_100125379 Ga0070659_1001253792 132
275 3300005530 Ga0070679_100000558 Ga0070679_10000055832 132
276 3300005530 Ga0070679_100107730 Ga0070679_1001077304 132
277 3300005530 Ga0070679_101044340 Ga0070679_1010443401 132
278 3300005563 Ga0068855_100000943 Ga0068855_10000094326 132
279 3300005577 Ga0068857_100440119 Ga0068857_1004401192 132
280 3300005577 Ga0068857_100462840 Ga0068857_1004628402 132
281 3300009093 Ga0105240_10143798 Ga0105240_101437982 132
282 3300010375 Ga0105239_10369170 Ga0105239_103691703 132
283 3300013100 Ga0157373_10047361 Ga0157373_100473612 132
284 3300013100 Ga0157373_10085170 Ga0157373_100851705 132
285 3300013102 Ga0157371_10001816 Ga0157371_1000181614 132
286 3300013102 Ga0157371_10004257 Ga0157371_100042578 132
287 3300013102 Ga0157371_10010677 Ga0157371_100106771 132
288 3300013102 Ga0157371_10494158 Ga0157371_104941581 132
289 3300013102 Ga0157371_10698908 Ga0157371_106989081 132
290 3300013104 Ga0157370_10000926 Ga0157370_1000092621 132
291 3300013104 Ga0157370_10016943 Ga0157370_100169432 132
292 3300013104 Ga0157370_10160962 Ga0157370_101609622 132
293 3300013104 Ga0157370_10231471 Ga0157370_102314711 132
294 3300013104 Ga0157370_10427934 Ga0157370_104279342 132
295 3300013104 Ga0157370_12007741 Ga0157370_120077411 132
296 3300013105 Ga0157369_10015072 Ga0157369_1001507218 132
297 3300013105 Ga0157369_11582624 Ga0157369_115826242 132
298 3300013307 Ga0157372_10023315 Ga0157372_100233154 132
299 3300013307 Ga0157372_10451564 Ga0157372_104515642 132
300 3300013307 Ga0157372_10678496 Ga0157372_106784961 132
301 3300025909 Ga0207705_10297302 Ga0207705_102973022 132
302 3300025912 Ga0207707_10243095 Ga0207707_102430952 132
303 3300025913 Ga0207695_11220577 Ga0207695_112205771 132
304 3300025917 Ga0207660_10056813 Ga0207660_100568135 132
305 3300025917 Ga0207660_10156767 Ga0207660_101567672 132
306 3300025917 Ga0207660_10528296 Ga0207660_105282962 132
307 3300025919 Ga0207657_10021530 Ga0207657_1002153012 132
308 3300025919 Ga0207657_10121424 Ga0207657_101214242 132
309 3300025919 Ga0207657_10121429 Ga0207657_101214292 132
310 3300025919 Ga0207657_10381875 Ga0207657_103818751 132
311 3300025921 Ga0207652_10000064 Ga0207652_1000006482 132
312 3300025921 Ga0207652_10025804 Ga0207652_100258048 132
313 3300025932 Ga0207690_10153779 Ga0207690_101537793 132
314 3300025932 Ga0207690_10306551 Ga0207690_103065512 132
315 3300025949 Ga0207667_10005923 Ga0207667_100059235 132
316 3300025949 Ga0207667_10403618 Ga0207667_104036182 132
317 3300026116 Ga0207674_10210240 Ga0207674_102102402 132
318 3300026116 Ga0207674_10215348 Ga0207674_102153482 132
319 3300031507 Ga0307509_10187790 Ga0307509_101877905 132
320 3300031616 Ga0307508_10432466 Ga0307508_104324662 132
321 3300037312 Ga0395899_0022301 Ga0395899_0022301_3480_3929 132
322 3300037312 Ga0395899_0050016 Ga0395899_0050016_1869_2318 132
323 3300037418 Ga0395900_0006742 Ga0395900_0006742_8789_9238 132
324 3300037418 Ga0395900_0019424 Ga0395900_0019424_2303_2752 132
325 3300037418 Ga0395900_0308705 Ga0395900_0308705_618_1067 132
326 3300037466 Ga0395898_0003249 Ga0395898_0003249_6934_7383 132
327 3300037466 Ga0395898_0044959 Ga0395898_0044959_1022_1471 132
328 3300037466 Ga0395898_1121746 Ga0395898_1121746_64_513 132
329 3300038443 Ga0395901_0001115 Ga0395901_0001115_6208_6657 132
330 3300038443 Ga0395901_0019788 Ga0395901_0019788_6402_6851 132
331 3300049570 Ga0501033_0543865 Ga0501033_0543865_101_550 132
332 3300049571 Ga0501034_0056521 Ga0501034_0056521_1871_2320 132
333 3300049822 Ga0501035_0021560 Ga0501035_0021560_1872_2321 132
334 3300049823 Ga0501044_0442599 Ga0501044_0442599_552_1001 132
335 3300005844 Ga0068862_100316824 Ga0068862_1003168243 133
336 3300014745 Ga0157377_11675889 Ga0157377_116758891 133
337 3300028380 Ga0268265_10364467 Ga0268265_103644673 133
338 3300041512 Ga0451853_3700620 Ga0451853_3700620_161_565 134
339 3300009545 Ga0105237_10026344 Ga0105237_1002634411 136
340 3300013307 Ga0157372_10584589 Ga0157372_105845893 136
341 3300005364 Ga0070673_100011200 Ga0070673_10001120010 137
342 3300005459 Ga0068867_100044375 Ga0068867_1000443754 137
343 3300005543 Ga0070672_100038692 Ga0070672_1000386925 137
344 3300025893 Ga0207682_10005663 Ga0207682_100056633 137
345 3300025908 Ga0207643_10798953 Ga0207643_107989531 137
346 3300025940 Ga0207691_10002741 Ga0207691_100027417 137
347 3300026089 Ga0207648_10131543 Ga0207648_101315432 137
348 3300044765 Ga0466970_0975596 Ga0466970_0975596_14_448 144
349 iso_pu_bacteria 2818991444 2819590260 145
350 3300005334 Ga0068869_100157409 Ga0068869_1001574092 148
351 3300006195 Ga0075366_10067340 Ga0075366_100673404 148
352 3300025942 Ga0207689_10006806 Ga0207689_1000680612 148
353 3300025961 Ga0207712_10999122 Ga0207712_109991221 148
354 3300050493 nmdc:mga0k408_121610_c1 nmdc:mga0k408_121610_c1_741_1187 148
355 3300050496 nmdc:mga07m45_248929_c1 nmdc:mga07m45_248929_c1_229_675 148
356 3300001904 JGI24736J21556_1010688 JGI24736J21556_10106883 149
357 3300002459 JGI24751J29686_10001776 JGI24751J29686_100017766 149
358 3300005290 Ga0065712_10022657 Ga0065712_100226573 149
359 3300005328 Ga0070676_10023353 Ga0070676_100233533 149
360 3300005328 Ga0070676_11175841 Ga0070676_111758411 149
361 3300005329 Ga0070683_100001488 Ga0070683_10000148819 149
362 3300005329 Ga0070683_101744832 Ga0070683_1017448321 149
363 3300005329 Ga0070683_102335864 Ga0070683_1023358641 149
364 3300005331 Ga0070670_100163815 Ga0070670_1001638153 149
365 3300005331 Ga0070670_100291389 Ga0070670_1002913892 149
366 3300005331 Ga0070670_100431559 Ga0070670_1004315591 149
367 3300005331 Ga0070670_100494965 Ga0070670_1004949651 149
368 3300005334 Ga0068869_100008365 Ga0068869_1000083652 149
369 3300005334 Ga0068869_100035596 Ga0068869_1000355962 149
370 3300005334 Ga0068869_100177718 Ga0068869_1001777182 149
371 3300005335 Ga0070666_10032986 Ga0070666_100329862 149
372 3300005335 Ga0070666_10083897 Ga0070666_100838972 149
373 3300005335 Ga0070666_10328375 Ga0070666_103283752 149
374 3300005336 Ga0070680_100387829 Ga0070680_1003878292 149
375 3300005338 Ga0068868_100013181 Ga0068868_1000131812 149
376 3300005338 Ga0068868_100023189 Ga0068868_1000231895 149
377 3300005338 Ga0068868_100060164 Ga0068868_1000601645 149
378 3300005340 Ga0070689_100236080 Ga0070689_1002360801 149
379 3300005344 Ga0070661_100913168 Ga0070661_1009131681 149
380 3300005347 Ga0070668_100011116 Ga0070668_1000111164 149
381 3300005347 Ga0070668_100187526 Ga0070668_1001875263 149
382 3300005353 Ga0070669_100008677 Ga0070669_10000867714 149
383 3300005353 Ga0070669_100289649 Ga0070669_1002896492 149
384 3300005354 Ga0070675_100022698 Ga0070675_1000226985 149
385 3300005354 Ga0070675_100053437 Ga0070675_1000534373 149
386 3300005354 Ga0070675_100875310 Ga0070675_1008753102 149
387 3300005355 Ga0070671_100033495 Ga0070671_1000334953 149
388 3300005355 Ga0070671_100164955 Ga0070671_1001649552 149
389 3300005355 Ga0070671_100187756 Ga0070671_1001877563 149
390 3300005355 Ga0070671_101163660 Ga0070671_1011636601 149
391 3300005356 Ga0070674_100002220 Ga0070674_10000222015 149
392 3300005356 Ga0070674_100029993 Ga0070674_1000299934 149
393 3300005356 Ga0070674_100116266 Ga0070674_1001162663 149
394 3300005364 Ga0070673_100019294 Ga0070673_1000192943 149
395 3300005364 Ga0070673_100292222 Ga0070673_1002922222 149
396 3300005364 Ga0070673_100537099 Ga0070673_1005370992 149
397 3300005365 Ga0070688_100037058 Ga0070688_1000370585 149
398 3300005366 Ga0070659_100031231 Ga0070659_1000312311 149
399 3300005367 Ga0070667_100048466 Ga0070667_1000484662 149
400 3300005438 Ga0070701_10065993 Ga0070701_100659932 149
401 3300005441 Ga0070700_100142630 Ga0070700_1001426301 149
402 3300005456 Ga0070678_100003711 Ga0070678_1000037113 149
403 3300005456 Ga0070678_100168499 Ga0070678_1001684993 149
404 3300005459 Ga0068867_100044758 Ga0068867_1000447582 149
405 3300005459 Ga0068867_100688132 Ga0068867_1006881321 149
406 3300005466 Ga0070685_10136076 Ga0070685_101360761 149
407 3300005535 Ga0070684_100003339 Ga0070684_10000333916 149
408 3300005535 Ga0070684_100231351 Ga0070684_1002313512 149
409 3300005539 Ga0068853_100740829 Ga0068853_1007408292 149
410 3300005543 Ga0070672_100048293 Ga0070672_1000482935 149
411 3300005543 Ga0070672_100086246 Ga0070672_1000862462 149
412 3300005543 Ga0070672_100207355 Ga0070672_1002073553 149
413 3300005548 Ga0070665_100018617 Ga0070665_1000186179 149
414 3300005564 Ga0070664_100153345 Ga0070664_1001533452 149
415 3300005564 Ga0070664_100283335 Ga0070664_1002833352 149
416 3300005564 Ga0070664_100450224 Ga0070664_1004502242 149
417 3300005564 Ga0070664_101017718 Ga0070664_1010177181 149
418 3300005577 Ga0068857_100387337 Ga0068857_1003873373 149
419 3300005578 Ga0068854_100021100 Ga0068854_1000211007 149
420 3300005578 Ga0068854_102283452 Ga0068854_1022834521 149
421 3300005614 Ga0068856_101275660 Ga0068856_1012756601 149
422 3300005616 Ga0068852_100361430 Ga0068852_1003614302 149
423 3300005616 Ga0068852_100591715 Ga0068852_1005917151 149
424 3300005617 Ga0068859_100082000 Ga0068859_1000820003 149
425 3300005618 Ga0068864_100211296 Ga0068864_1002112962 149
426 3300005618 Ga0068864_101382949 Ga0068864_1013829491 149
427 3300005718 Ga0068866_10032382 Ga0068866_100323823 149
428 3300005719 Ga0068861_101593293 Ga0068861_1015932931 149
429 3300005834 Ga0068851_10220815 Ga0068851_102208151 149
430 3300005840 Ga0068870_10006960 Ga0068870_100069605 149
431 3300005840 Ga0068870_10274307 Ga0068870_102743073 149
432 3300005842 Ga0068858_101048491 Ga0068858_1010484911 149
433 3300005843 Ga0068860_100007830 Ga0068860_10000783018 149
434 3300005843 Ga0068860_100523164 Ga0068860_1005231643 149
435 3300005843 Ga0068860_102650531 Ga0068860_1026505311 149
436 3300005844 Ga0068862_100280486 Ga0068862_1002804863 149
437 3300005985 Ga0081539_10173775 Ga0081539_101737752 149
438 3300006237 Ga0097621_100055205 Ga0097621_1000552052 149
439 3300006237 Ga0097621_100387507 Ga0097621_1003875073 149
440 3300006358 Ga0068871_100120416 Ga0068871_1001204163 149
441 3300006358 Ga0068871_100236251 Ga0068871_1002362513 149
442 3300006358 Ga0068871_100259973 Ga0068871_1002599732 149
443 3300006358 Ga0068871_100277859 Ga0068871_1002778592 149
444 3300006358 Ga0068871_100633682 Ga0068871_1006336822 149
445 3300006881 Ga0068865_100048462 Ga0068865_1000484622 149
446 3300006881 Ga0068865_100419467 Ga0068865_1004194673 149
447 3300006931 Ga0097620_100081998 Ga0097620_1000819983 149
448 3300009098 Ga0105245_11142442 Ga0105245_111424421 149
449 3300009174 Ga0105241_10029296 Ga0105241_100292963 149
450 3300009176 Ga0105242_10013197 Ga0105242_1001319711 149
451 3300009553 Ga0105249_10034435 Ga0105249_100344356 149
452 3300009553 Ga0105249_10042127 Ga0105249_100421274 149
453 3300009553 Ga0105249_10439509 Ga0105249_104395091 149
454 3300011119 Ga0105246_10064093 Ga0105246_100640933 149
455 3300013100 Ga0157373_10023280 Ga0157373_100232804 149
456 3300013100 Ga0157373_10831495 Ga0157373_108314951 149
457 3300013102 Ga0157371_10026837 Ga0157371_100268378 149
458 3300013102 Ga0157371_10049377 Ga0157371_100493771 149
459 3300013102 Ga0157371_10175412 Ga0157371_101754123 149
460 3300013102 Ga0157371_10262549 Ga0157371_102625492 149
461 3300013104 Ga0157370_10611584 Ga0157370_106115841 149
462 3300013105 Ga0157369_10582804 Ga0157369_105828042 149
463 3300013105 Ga0157369_11639453 Ga0157369_116394531 149
464 3300013296 Ga0157374_10194867 Ga0157374_101948672 149
465 3300013297 Ga0157378_10038223 Ga0157378_100382235 149
466 3300013297 Ga0157378_10086747 Ga0157378_100867474 149
467 3300013297 Ga0157378_10096011 Ga0157378_100960115 149
468 3300013307 Ga0157372_10005863 Ga0157372_100058637 149
469 3300013307 Ga0157372_10065955 Ga0157372_100659552 149
470 3300013307 Ga0157372_10068543 Ga0157372_100685432 149
471 3300013307 Ga0157372_10336168 Ga0157372_103361682 149
472 3300013307 Ga0157372_10486880 Ga0157372_104868802 149
473 3300014325 Ga0163163_10018795 Ga0163163_100187952 149
474 3300014325 Ga0163163_10310019 Ga0163163_103100191 149
475 3300014745 Ga0157377_10316233 Ga0157377_103162331 149
476 3300014745 Ga0157377_10388005 Ga0157377_103880052 149
477 3300014968 Ga0157379_10475571 Ga0157379_104755713 149
478 3300014969 Ga0157376_10367670 Ga0157376_103676702 149
479 3300025315 Ga0207697_10008991 Ga0207697_100089916 149
480 3300025899 Ga0207642_10016411 Ga0207642_100164115 149
481 3300025899 Ga0207642_10098027 Ga0207642_100980272 149
482 3300025901 Ga0207688_10023208 Ga0207688_100232082 149
483 3300025903 Ga0207680_10392694 Ga0207680_103926942 149
484 3300025903 Ga0207680_10496191 Ga0207680_104961912 149
485 3300025904 Ga0207647_10000110 Ga0207647_1000011065 149
486 3300025904 Ga0207647_10160929 Ga0207647_101609292 149
487 3300025907 Ga0207645_10003925 Ga0207645_100039257 149
488 3300025908 Ga0207643_10008110 Ga0207643_100081105 149
489 3300025908 Ga0207643_10241523 Ga0207643_102415231 149
490 3300025911 Ga0207654_10133228 Ga0207654_101332282 149
491 3300025919 Ga0207657_10137673 Ga0207657_101376732 149
492 3300025923 Ga0207681_10050401 Ga0207681_100504012 149
493 3300025923 Ga0207681_10250411 Ga0207681_102504112 149
494 3300025925 Ga0207650_10104967 Ga0207650_101049672 149
495 3300025925 Ga0207650_10229042 Ga0207650_102290422 149
496 3300025925 Ga0207650_10320960 Ga0207650_103209603 149
497 3300025926 Ga0207659_10027831 Ga0207659_100278318 149
498 3300025926 Ga0207659_10082344 Ga0207659_100823443 149
499 3300025931 Ga0207644_10139359 Ga0207644_101393592 149
500 3300025931 Ga0207644_10494007 Ga0207644_104940071 149
501 3300025931 Ga0207644_10934281 Ga0207644_109342812 149
502 3300025932 Ga0207690_10018477 Ga0207690_100184774 149
503 3300025936 Ga0207670_10608599 Ga0207670_106085992 149
504 3300025937 Ga0207669_10063854 Ga0207669_100638542 149
505 3300025937 Ga0207669_10190533 Ga0207669_101905332 149
506 3300025937 Ga0207669_10435071 Ga0207669_104350713 149
507 3300025938 Ga0207704_10051784 Ga0207704_100517844 149
508 3300025940 Ga0207691_10021049 Ga0207691_100210498 149
509 3300025940 Ga0207691_10098747 Ga0207691_100987475 149
510 3300025940 Ga0207691_10263733 Ga0207691_102637332 149
511 3300025942 Ga0207689_10007410 Ga0207689_100074105 149
512 3300025942 Ga0207689_10008752 Ga0207689_100087525 149
513 3300025942 Ga0207689_10200458 Ga0207689_102004582 149
514 3300025944 Ga0207661_10080675 Ga0207661_100806752 149
515 3300025944 Ga0207661_11296362 Ga0207661_112963621 149
516 3300025944 Ga0207661_11506522 Ga0207661_115065222 149
517 3300025945 Ga0207679_10324798 Ga0207679_103247983 149
518 3300025945 Ga0207679_10366507 Ga0207679_103665072 149
519 3300025945 Ga0207679_10551638 Ga0207679_105516382 149
520 3300025960 Ga0207651_10022746 Ga0207651_100227464 149
521 3300025960 Ga0207651_10915923 Ga0207651_109159232 149
522 3300025960 Ga0207651_11208489 Ga0207651_112084892 149
523 3300025961 Ga0207712_10344327 Ga0207712_103443273 149
524 3300025972 Ga0207668_10058350 Ga0207668_100583502 149
525 3300025972 Ga0207668_10067335 Ga0207668_100673354 149
526 3300025972 Ga0207668_10108918 Ga0207668_101089181 149
527 3300025981 Ga0207640_10624296 Ga0207640_106242962 149
528 3300026023 Ga0207677_10045605 Ga0207677_100456052 149
529 3300026023 Ga0207677_10123787 Ga0207677_101237873 149
530 3300026023 Ga0207677_10603298 Ga0207677_106032982 149
531 3300026035 Ga0207703_10178190 Ga0207703_101781903 149
532 3300026041 Ga0207639_10112784 Ga0207639_101127844 149
533 3300026075 Ga0207708_10051137 Ga0207708_100511373 149
534 3300026089 Ga0207648_10002625 Ga0207648_1000262513 149
535 3300026089 Ga0207648_10122134 Ga0207648_101221345 149
536 3300026089 Ga0207648_10705553 Ga0207648_107055533 149
537 3300026095 Ga0207676_10011505 Ga0207676_100115052 149
538 3300026095 Ga0207676_10393194 Ga0207676_103931942 149
539 3300026095 Ga0207676_11129825 Ga0207676_111298251 149
540 3300026116 Ga0207674_10119591 Ga0207674_101195912 149
541 3300026116 Ga0207674_10201881 Ga0207674_102018812 149
542 3300026116 Ga0207674_10255372 Ga0207674_102553722 149
543 3300026116 Ga0207674_11755215 Ga0207674_117552151 149
544 3300026118 Ga0207675_100142074 Ga0207675_1001420742 149
545 3300026118 Ga0207675_100791857 Ga0207675_1007918571 149
546 3300026121 Ga0207683_10017329 Ga0207683_100173294 149
547 3300026121 Ga0207683_10027854 Ga0207683_100278545 149
548 3300026121 Ga0207683_10562224 Ga0207683_105622241 149
549 3300026142 Ga0207698_10588973 Ga0207698_105889732 149
550 3300026142 Ga0207698_10653413 Ga0207698_106534132 149
551 3300026142 Ga0207698_10664879 Ga0207698_106648792 149
552 3300026142 Ga0207698_11175885 Ga0207698_111758851 149
553 3300027471 Ga0209995_1091575 Ga0209995_10915751 149
554 3300027543 Ga0209999_1017301 Ga0209999_10173011 149
555 3300028379 Ga0268266_10010826 Ga0268266_1001082610 149
556 3300028379 Ga0268266_10238704 Ga0268266_102387041 149
557 3300028380 Ga0268265_10248801 Ga0268265_102488011 149
558 3300028381 Ga0268264_10555698 Ga0268264_105556981 149
559 3300028381 Ga0268264_11818977 Ga0268264_118189771 149
560 3300031995 Ga0307409_100942581 Ga0307409_1009425811 149
561 3300032126 Ga0307415_100225011 Ga0307415_1002250112 149
562 3300032126 Ga0307415_101050652 Ga0307415_1010506522 149
563 3300036401 Ga0373937_0636576 Ga0373937_0636576_43_492 149
564 3300037418 Ga0395900_0210174 Ga0395900_0210174_959_1408 149
565 3300037471 Ga0395905_0002823 Ga0395905_0002823_10107_10556 149
566 3300037471 Ga0395905_0480294 Ga0395905_0480294_553_1002 149
567 3300039437 Ga0436365_0463798 Ga0436365_0463798_68_517 149
568 3300041486 Ga0451807_1341348 Ga0451807_1341348_29_478 149
569 3300042001 Ga0439441_020187 Ga0439441_020187_486_935 149
570 3300042004 Ga0439445_0090417 Ga0439445_0090417_317_766 149
571 3300042439 Ga0439464_0148119 Ga0439464_0148119_151_600 149
572 3300044658 Ga0466972_0301098 Ga0466972_0301098_168_617 149
573 3300044712 Ga0453684_0356680 Ga0453684_0356680_1165_1614 149
574 3300044765 Ga0466970_0322854 Ga0466970_0322854_191_640 149
575 3300044765 Ga0466970_0409841 Ga0466970_0409841_137_586 149
576 3300045049 Ga0466959_0347124 Ga0466959_0347124_321_770 149
577 3300046660 Ga0495625_0468028 Ga0495625_0468028_137_586 149
578 3300047319 Ga0495674_0205023 Ga0495674_0205023_87_536 149
579 3300047320 Ga0495672_0016334 Ga0495672_0016334_1320_1769 149
580 3300049568 Ga0501031_0029533 Ga0501031_0029533_2393_2842 149
581 3300049569 Ga0501032_0369855 Ga0501032_0369855_126_575 149
582 3300049571 Ga0501034_0474628 Ga0501034_0474628_140_589 149
583 3300049572 Ga0501036_0404563 Ga0501036_0404563_281_730 149
584 3300049573 Ga0501037_0075415 Ga0501037_0075415_579_1028 149
585 3300049574 Ga0501038_0005905 Ga0501038_0005905_10785_11234 149
586 3300049575 Ga0501039_0020673 Ga0501039_0020673_858_1307 149
587 3300049579 Ga0501043_0309165 Ga0501043_0309165_308_757 149
588 3300049579 Ga0501043_0653184 Ga0501043_0653184_214_663 149
589 3300049580 Ga0501046_0048615 Ga0501046_0048615_2132_2581 149
590 3300049822 Ga0501035_0045504 Ga0501035_0045504_460_909 149
591 3300049823 Ga0501044_0279506 Ga0501044_0279506_192_641 149
592 3300050513 nmdc:mga0rr50_1215258_c1 nmdc:mga0rr50_1215258_c1_139_588 149
593 3300053096 Ga0500641_0128012 Ga0500641_0128012_31_480 149
594 3300053139 Ga0500568_0000439 Ga0500568_0000439_15913_16362 149
595 3300059510 Ga0587090_140782 Ga0587090_140782_52_501 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

38

157

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.9007 124 147
6zu5-assembly1.cif.gz_LQ0 structure of the paranosema locustae ribosome in complex with lso2 0.8302 75 148
7qiz-assembly1.cif.gz_S specific features and methylation sites of a plant 80s ribosome 0.8244 75 147
8b2l-assembly1.cif.gz_G3 cryo-em structure of the plant 80s ribosome 0.8217 75 147
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.821 74 145
ID Description Score Start End Superfamily
1p90A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Dinitrogenase iron-molybdenum cofactor biosynthesis domain 0.9007 124 147 3.30.420.130
af_Q8ILG7_161_247_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8872 68 149 3.100.10.10
af_Q54PP3_103_187_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8862 71 148 3.100.10.10
af_A0A0G2K9B4_85_176_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8773 71 148 3.100.10.10
1jj2N00 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8712 74 145 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A4V1UEJ6-F1-model_v4 50S ribosomal protein L15 0.9486 93 148 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0NA90-F1-model_v4 50S ribosomal protein L15 0.9444 88 148 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-C1JI57-F1-model_v4 50S ribosomal protein L15 0.9407 93 149 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D6CM43-F1-model_v4 50S ribosomal protein L15 0.9387 82 148 GO:0003735
GO:0006412
GO:0022625
AF-A0A2W0BP79-F1-model_v4 50S ribosomal protein L15 0.9338 93 148 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
75.13 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map