F467334

General Info

Members Datasets Scaffolds Average Seq Length
594 219 1189 189

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10222571|Ga0157372_102225712
Length 213
Sequence MLGKKFLPPSLGYYFSILVLKEDCSLKAEHNQIALLQGLARQDKKAIETIYKENFNLILSLVLNNNGSTEDAKDIFQEAMIVLYQKVQSGTFELNCQLKTFVYSVCRRLWLKRLLHQNRYSLYENHDDFVLVDEDVEDHEQRNAEFSMMEKAMNNLGEPCKSLLEAFYMQKKGMQEIAASFGYTNADNAKTQKYKCLVRLKKLFFSQYKNGSQ

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
204 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
205 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
206 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
207 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 2914759650 Rhizosphaericola mali Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 1.35
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10222571 3300013307 Bacteria 2187
2 JGI24751J29686_10041051 3300002459 Bacteria 957
3 rootH1_10112543 3300003316 Bacteria 1213
4 rootH1_10112543 3300003323 Bacteria 2965
5 rootL2_10082698 3300003322 Bacteria 1705
6 rootH1_10138409 3300003323 Bacteria 1781
7 Ga0065714_10077584 3300005288 Bacteria 2675
8 Ga0065714_10152560 3300005288 Bacteria 1097
9 Ga0065712_10027511 3300005290 Bacteria 1531
10 Ga0070658_10000363 3300005327 Bacteria 39460
11 Ga0070658_10046551 3300005327 Bacteria 3510
12 Ga0070658_10146183 3300005327 Unclassified 1977
13 Ga0070658_10209292 3300005327 Bacteria 1647
14 Ga0070658_10589357 3300005327 Bacteria 963
15 Ga0070676_10001811 3300005328 Bacteria 10867
16 Ga0070676_10091583 3300005328 Bacteria 1863
17 Ga0070676_10250255 3300005328 Bacteria 1182
18 Ga0070683_100010926 3300005329 Bacteria 7820
19 Ga0070690_100090295 3300005330 Bacteria 2017
20 Ga0070690_100373159 3300005330 Bacteria 1041
21 Ga0070670_100038396 3300005331 Bacteria 4118
22 Ga0070670_100134955 3300005331 Bacteria 2132
23 Ga0070670_100182935 3300005331 Bacteria 1820
24 Ga0070670_100238107 3300005331 Bacteria 1584
25 Ga0070677_10014063 3300005333 Bacteria 2810
26 Ga0070677_10080579 3300005333 Bacteria 1392
27 Ga0068869_100093472 3300005334 Unclassified 2266
28 Ga0068869_100104702 3300005334 Unclassified 2145
29 Ga0068869_100263084 3300005334 Bacteria 1381
30 Ga0068869_100548721 3300005334 Unclassified 971
31 Ga0070666_10000028 3300005335 Bacteria 144796
32 Ga0070666_10001887 3300005335 Bacteria 12756
33 Ga0070666_10008440 3300005335 Bacteria 6397
34 Ga0070666_10308191 3300005335 Bacteria 1128
35 Ga0070680_100003132 3300005336 Bacteria 12287
36 Ga0070682_100002083 3300005337 Bacteria 11127
37 Ga0068868_100019877 3300005338 Bacteria 5038
38 Ga0068868_100027683 3300005338 Unclassified 4325
39 Ga0068868_100076832 3300005338 Bacteria 2670
40 Ga0068868_100098963 3300005338 Bacteria 2358
41 Ga0068868_100129287 3300005338 Bacteria 2066
42 Ga0068868_100308203 3300005338 Bacteria 1346
43 Ga0070660_100252948 3300005339 Bacteria 1437
44 Ga0070689_100159420 3300005340 Bacteria 1823
45 Ga0070689_100235393 3300005340 Bacteria 1507
46 Ga0070691_10011758 3300005341 Bacteria 4004
47 Ga0070687_100022351 3300005343 Bacteria 2989
48 Ga0070661_100049918 3300005344 Bacteria 3063
49 Ga0070661_100403792 3300005344 Bacteria 1081
50 Ga0070661_100590334 3300005344 Bacteria 897
51 Ga0070668_100000308 3300005347 Bacteria 32201
52 Ga0070668_100046743 3300005347 Bacteria 3325
53 Ga0070668_100423467 3300005347 Bacteria 1140
54 Ga0070669_100083069 3300005353 Bacteria 2388
55 Ga0070669_100171089 3300005353 Bacteria 1694
56 Ga0070675_100027552 3300005354 Unclassified 4566
57 Ga0070675_100063503 3300005354 Bacteria 3053
58 Ga0070675_100102118 3300005354 Bacteria 2416
59 Ga0070675_100158666 3300005354 Bacteria 1944
60 Ga0070675_100250709 3300005354 Bacteria 1549
61 Ga0070675_100252349 3300005354 Unclassified 1544
62 Ga0070675_100629158 3300005354 Bacteria 974
63 Ga0070671_100031738 3300005355 Bacteria 4366
64 Ga0070671_100352747 3300005355 Bacteria 1256
65 Ga0070674_100003085 3300005356 Bacteria 9270
66 Ga0070674_100034998 3300005356 Bacteria 3360
67 Ga0070674_100053301 3300005356 Bacteria 2792
68 Ga0070674_100064253 3300005356 Bacteria 2571
69 Ga0070674_100530523 3300005356 Bacteria 985
70 Ga0070673_100018725 3300005364 Bacteria 4955
71 Ga0070673_100019866 3300005364 Bacteria 4832
72 Ga0070673_100032891 3300005364 Bacteria 3910
73 Ga0070673_100164626 3300005364 Bacteria 1888
74 Ga0070673_100278045 3300005364 Bacteria 1467
75 Ga0070673_100923398 3300005364 Bacteria 810
76 Ga0070659_100030941 3300005366 Bacteria 4143
77 Ga0070659_100237155 3300005366 Bacteria 1508
78 Ga0070659_100927960 3300005366 Bacteria 762
79 Ga0070667_100000583 3300005367 Bacteria 36093
80 Ga0070667_100090537 3300005367 Bacteria 2630
81 Ga0070667_100149180 3300005367 Bacteria 2053
82 Ga0070667_100150402 3300005367 Bacteria 2045
83 Ga0070667_100313619 3300005367 Unclassified 1414
84 Ga0070667_100942647 3300005367 Bacteria 804
85 Ga0070701_10048622 3300005438 Bacteria 2190
86 Ga0070701_10080905 3300005438 Bacteria 1758
87 Ga0070700_100071294 3300005441 Bacteria 2218
88 Ga0070663_100232469 3300005455 Bacteria 1452
89 Ga0070663_101005205 3300005455 Bacteria 725
90 Ga0070678_100008598 3300005456 Bacteria 6121
91 Ga0070678_100097084 3300005456 Bacteria 2275
92 Ga0070678_100311025 3300005456 Bacteria 1342
93 Ga0070678_100404322 3300005456 Bacteria 1187
94 Ga0070678_100554419 3300005456 Bacteria 1021
95 Ga0070662_100019674 3300005457 Bacteria 4587
96 Ga0070681_10120514 3300005458 Bacteria 2558
97 Ga0070681_10206926 3300005458 Bacteria 1879
98 Ga0068867_100039971 3300005459 Bacteria 3421
99 Ga0068867_100043582 3300005459 Bacteria 3285
100 Ga0068867_100078022 3300005459 Unclassified 2490
101 Ga0068867_100087264 3300005459 Bacteria 2362
102 Ga0068867_100317783 3300005459 Bacteria 1289
103 Ga0068867_100362108 3300005459 Unclassified 1213
104 Ga0068867_100421375 3300005459 Bacteria 1131
105 Ga0068867_100486510 3300005459 Bacteria 1058
106 Ga0070679_100004819 3300005530 Bacteria 12444
107 Ga0070679_100102208 3300005530 Bacteria 2852
108 Ga0070679_100375749 3300005530 Bacteria 1368
109 Ga0070684_100019764 3300005535 Bacteria 5576
110 Ga0070684_100254633 3300005535 Bacteria 1605
111 Ga0068853_100154137 3300005539 Bacteria 2069
112 Ga0068853_100233488 3300005539 Bacteria 1683
113 Ga0068853_100734124 3300005539 Unclassified 943
114 Ga0068853_101243014 3300005539 Bacteria 719
115 Ga0070672_100018931 3300005543 Bacteria 4988
116 Ga0070672_100092605 3300005543 Bacteria 2440
117 Ga0070672_100167559 3300005543 Bacteria 1825
118 Ga0070672_100190092 3300005543 Unclassified 1714
119 Ga0070672_100301689 3300005543 Bacteria 1358
120 Ga0070672_100345693 3300005543 Bacteria 1267
121 Ga0070672_100560451 3300005543 Bacteria 993
122 Ga0070672_100598046 3300005543 Bacteria 960
123 Ga0070693_100023071 3300005547 Bacteria 3320
124 Ga0070693_100146172 3300005547 Bacteria 1493
125 Ga0070665_100004255 3300005548 Bacteria 15056
126 Ga0070665_100021077 3300005548 Bacteria 6553
127 Ga0068855_100263666 3300005563 Bacteria 1918
128 Ga0068855_100281076 3300005563 Unclassified 1848
129 Ga0068855_100419551 3300005563 Bacteria 1464
130 Ga0068855_101348281 3300005563 Bacteria 737
131 Ga0070664_100009055 3300005564 Bacteria 8077
132 Ga0070664_100342543 3300005564 Bacteria 1358
133 Ga0070664_100642011 3300005564 Unclassified 986
134 Ga0068857_100012210 3300005577 Bacteria 7472
135 Ga0068857_100386014 3300005577 Bacteria 1301
136 Ga0068857_100644048 3300005577 Bacteria 1004
137 Ga0068854_100013418 3300005578 Bacteria 5378
138 Ga0068854_100034355 3300005578 Bacteria 3541
139 Ga0068854_100127696 3300005578 Bacteria 1938
140 Ga0068856_100023362 3300005614 Bacteria 6011
141 Ga0068852_100001126 3300005616 Bacteria 17673
142 Ga0068852_100005400 3300005616 Bacteria 9140
143 Ga0068852_100105527 3300005616 Bacteria 2553
144 Ga0068852_100120884 3300005616 Bacteria 2397
145 Ga0068852_100126447 3300005616 Bacteria 2348
146 Ga0068852_100385281 3300005616 Bacteria 1376
147 Ga0068852_100426681 3300005616 Unclassified 1309
148 Ga0068859_100000012 3300005617 Bacteria 300376
149 Ga0068859_100008213 3300005617 Bacteria 10591
150 Ga0068859_100020133 3300005617 Bacteria 6699
151 Ga0068859_100040958 3300005617 Bacteria 4653
152 Ga0068859_100503220 3300005617 Bacteria 1307
153 Ga0068859_100558398 3300005617 Bacteria 1239
154 Ga0068864_100007973 3300005618 Bacteria 8728
155 Ga0068864_100037342 3300005618 Bacteria 4145
156 Ga0068864_100050257 3300005618 Bacteria 3588
157 Ga0068864_100097271 3300005618 Bacteria 2606
158 Ga0068864_100230210 3300005618 Bacteria 1714
159 Ga0068864_101126537 3300005618 Bacteria 782
160 Ga0068866_10088208 3300005718 Bacteria 1683
161 Ga0068866_10131448 3300005718 Bacteria 1424
162 Ga0068866_10162542 3300005718 Bacteria 1303
163 Ga0068861_100112376 3300005719 Bacteria 2184
164 Ga0068861_100235107 3300005719 Bacteria 1556
165 Ga0068861_100933688 3300005719 Bacteria 824
166 Ga0068851_10000989 3300005834 Bacteria 12306
167 Ga0068851_10070690 3300005834 Bacteria 1805
168 Ga0068870_10046749 3300005840 Bacteria 2272
169 Ga0068863_100001439 3300005841 Bacteria 23604
170 Ga0068863_100009422 3300005841 Bacteria 9532
171 Ga0068858_100010710 3300005842 Bacteria 8676
172 Ga0068858_100134812 3300005842 Bacteria 2317
173 Ga0068858_100257870 3300005842 Bacteria 1657
174 Ga0068860_100000662 3300005843 Bacteria 39938
175 Ga0068860_100012479 3300005843 Bacteria 8368
176 Ga0068860_100020187 3300005843 Bacteria 6457
177 Ga0068860_100059768 3300005843 Bacteria 3623
178 Ga0068860_100298642 3300005843 Bacteria 1577
179 Ga0068862_100106518 3300005844 Bacteria 2458
180 Ga0068862_100141711 3300005844 Bacteria 2134
181 Ga0068862_100462931 3300005844 Bacteria 1197
182 Ga0068862_100608316 3300005844 Bacteria 1050
183 Ga0097621_100005734 3300006237 Bacteria 8764
184 Ga0097621_100008118 3300006237 Bacteria 7546
185 Ga0097621_100020920 3300006237 Bacteria 5049
186 Ga0097621_100056489 3300006237 Bacteria 3207
187 Ga0097621_100444182 3300006237 Unclassified 1167
188 Ga0097621_100601981 3300006237 Bacteria 1005
189 Ga0097621_100691634 3300006237 Bacteria 938
190 Ga0097621_100970285 3300006237 Bacteria 794
191 Ga0068871_100001400 3300006358 Bacteria 16139
192 Ga0068871_100011462 3300006358 Bacteria 6503
193 Ga0068871_100056823 3300006358 Bacteria 3183
194 Ga0068871_100116749 3300006358 Bacteria 2250
195 Ga0068871_100157438 3300006358 Bacteria 1941
196 Ga0068871_100772499 3300006358 Bacteria 884
197 Ga0068865_100115618 3300006881 Bacteria 1986
198 Ga0068865_100136673 3300006881 Bacteria 1843
199 Ga0068865_100182420 3300006881 Bacteria 1617
200 Ga0097620_100000012 3300006931 Bacteria 300376
201 Ga0097620_100008213 3300006931 Bacteria 10591
202 Ga0097620_100020133 3300006931 Bacteria 6699
203 Ga0097620_100040960 3300006931 Bacteria 4653
204 Ga0097620_100503220 3300006931 Bacteria 1307
205 Ga0097620_100558468 3300006931 Bacteria 1239
206 Ga0105240_10014812 3300009093 Bacteria 10628
207 Ga0105240_10057216 3300009093 Bacteria 4874
208 Ga0111539_10182971 3300009094 Bacteria 2447
209 Ga0111539_10233586 3300009094 Bacteria 2141
210 Ga0105245_10191796 3300009098 Bacteria 1958
211 Ga0105247_10018261 3300009101 Bacteria 4208
212 Ga0105247_10029312 3300009101 Bacteria 3334
213 Ga0105247_10078580 3300009101 Bacteria 2076
214 Ga0105243_10150648 3300009148 Bacteria 1995
215 Ga0105241_10000619 3300009174 Bacteria 26737
216 Ga0105241_10005432 3300009174 Bacteria 9426
217 Ga0105241_10121196 3300009174 Bacteria 2106
218 Ga0105242_10022278 3300009176 Bacteria 4980
219 Ga0105242_10057126 3300009176 Bacteria 3194
220 Ga0105242_10138408 3300009176 Unclassified 2110
221 Ga0105242_10975618 3300009176 Unclassified 853
222 Ga0105242_11108161 3300009176 Unclassified 806
223 Ga0105248_10126506 3300009177 Bacteria 2882
224 Ga0105248_10174484 3300009177 Bacteria 2423
225 Ga0105237_10007560 3300009545 Bacteria 11876
226 Ga0105237_10018768 3300009545 Bacteria 7151
227 Ga0105237_10333801 3300009545 Bacteria 1520
228 Ga0105237_10554977 3300009545 Unclassified 1155
229 Ga0105238_10021505 3300009551 Bacteria 6570
230 Ga0105238_10214383 3300009551 Bacteria 1902
231 Ga0105249_10000336 3300009553 Bacteria 47472
232 Ga0105249_10029128 3300009553 Bacteria 4986
233 Ga0105249_10061806 3300009553 Bacteria 3437
234 Ga0105249_10062091 3300009553 Bacteria 3430
235 Ga0105249_10102224 3300009553 Bacteria 2697
236 Ga0105239_10062059 3300010375 Bacteria 4103
237 Ga0105239_10206645 3300010375 Bacteria 2200
238 Ga0105239_10296258 3300010375 Bacteria 1821
239 Ga0105246_10020025 3300011119 Bacteria 4288
240 Ga0105246_10039499 3300011119 Bacteria 3180
241 Ga0105246_10277672 3300011119 Bacteria 1342
242 Ga0105246_10286332 3300011119 Bacteria 1324
243 Ga0105246_10354976 3300011119 Unclassified 1203
244 Ga0157373_10037959 3300013100 Bacteria 3451
245 Ga0157373_10090531 3300013100 Bacteria 2155
246 Ga0157371_10012374 3300013102 Bacteria 6525
247 Ga0157371_10051484 3300013102 Bacteria 2926
248 Ga0157371_10072668 3300013102 Bacteria 2435
249 Ga0157371_10196500 3300013102 Bacteria 1445
250 Ga0157371_10740303 3300013102 Bacteria 738
251 Ga0157370_10004121 3300013104 Bacteria 16850
252 Ga0157370_10026357 3300013104 Bacteria 5740
253 Ga0157370_10089103 3300013104 Bacteria 2898
254 Ga0157370_10220798 3300013104 Bacteria 1755
255 Ga0157370_10396511 3300013104 Bacteria 1271
256 Ga0157369_10048509 3300013105 Bacteria 4607
257 Ga0157369_10135694 3300013105 Bacteria 2605
258 Ga0157369_10512193 3300013105 Bacteria 1241
259 Ga0157369_10684364 3300013105 Bacteria 1057
260 Ga0157369_10943329 3300013105 Bacteria 884
261 Ga0157374_10000484 3300013296 Bacteria 36020
262 Ga0157374_10099849 3300013296 Unclassified 2781
263 Ga0157374_10128823 3300013296 Bacteria 2448
264 Ga0157374_10206274 3300013296 Unclassified 1926
265 Ga0157374_10424700 3300013296 Bacteria 1328
266 Ga0157374_10714840 3300013296 Bacteria 1015
267 Ga0157378_10020742 3300013297 Bacteria 5779
268 Ga0157378_10031238 3300013297 Bacteria 4704
269 Ga0157378_10033991 3300013297 Bacteria 4509
270 Ga0157378_10080139 3300013297 Bacteria 2949
271 Ga0157378_10083364 3300013297 Bacteria 2893
272 Ga0157378_10171754 3300013297 Bacteria 2033
273 Ga0157378_10337903 3300013297 Unclassified 1468
274 Ga0157378_10449081 3300013297 Bacteria 1279
275 Ga0157378_11809796 3300013297 Bacteria 659
276 Ga0163162_10000282 3300013306 Bacteria 46472
277 Ga0163162_10000484 3300013306 Bacteria 36942
278 Ga0163162_10007655 3300013306 Bacteria 10521
279 Ga0163162_10058595 3300013306 Bacteria 3881
280 Ga0163162_10161847 3300013306 Bacteria 2360
281 Ga0163162_10323625 3300013306 Bacteria 1674
282 Ga0157372_10000596 3300013307 Bacteria 39416
283 Ga0157372_10024348 3300013307 Bacteria 6574
284 Ga0157372_10038806 3300013307 Bacteria 5256
285 Ga0157372_10052623 3300013307 Bacteria 4535
286 Ga0157372_10072603 3300013307 Bacteria 3878
287 Ga0157372_10103431 3300013307 Bacteria 3254
288 Ga0157372_10176121 3300013307 Bacteria 2475
289 Ga0157372_10322950 3300013307 Bacteria 1797
290 Ga0157372_10355726 3300013307 Bacteria 1706
291 Ga0157372_10605603 3300013307 Bacteria 1277
292 Ga0157375_10000619 3300013308 Bacteria 31534
293 Ga0157375_10088690 3300013308 Bacteria 3148
294 Ga0157375_10101916 3300013308 Bacteria 2955
295 Ga0157375_10355986 3300013308 Bacteria 1630
296 Ga0157375_10360844 3300013308 Unclassified 1619
297 Ga0157375_10493546 3300013308 Unclassified 1389
298 Ga0157375_10509416 3300013308 Unclassified 1367
299 Ga0157375_10915380 3300013308 Bacteria 1020
300 Ga0157375_11049832 3300013308 Bacteria 952
301 Ga0163163_10000499 3300014325 Bacteria 35349
302 Ga0163163_10051839 3300014325 Bacteria 4046
303 Ga0163163_10140981 3300014325 Unclassified 2453
304 Ga0163163_10347815 3300014325 Bacteria 1538
305 Ga0163163_10437907 3300014325 Bacteria 1367
306 Ga0163163_10968359 3300014325 Bacteria 914
307 Ga0157380_10087245 3300014326 Bacteria 2565
308 Ga0157380_10174656 3300014326 Bacteria 1881
309 Ga0157380_10236164 3300014326 Bacteria 1645
310 Ga0157380_10280977 3300014326 Bacteria 1523
311 Ga0157377_10010450 3300014745 Bacteria 4592
312 Ga0157377_10015114 3300014745 Bacteria 3940
313 Ga0157379_10002615 3300014968 Bacteria 15134
314 Ga0157379_10065528 3300014968 Bacteria 3247
315 Ga0157379_10309201 3300014968 Bacteria 1441
316 Ga0157379_10513058 3300014968 Bacteria 1112
317 Ga0157379_10682951 3300014968 Unclassified 963
318 Ga0157379_10892114 3300014968 Unclassified 843
319 Ga0157376_10002613 3300014969 Bacteria 12245
320 Ga0157376_10015531 3300014969 Bacteria 5755
321 Ga0157376_10054485 3300014969 Bacteria 3334
322 Ga0157376_10263180 3300014969 Bacteria 1617
323 Ga0157376_10651026 3300014969 Bacteria 1054
324 Ga0157376_11116447 3300014969 Bacteria 815
325 Ga0163161_10065548 3300017792 Bacteria 2650
326 Ga0163161_10586079 3300017792 Bacteria 918
327 Ga0213876_10006643 3300021384 Bacteria 6312
328 Ga0207656_10009015 3300025321 Bacteria 3698
329 Ga0207656_10026069 3300025321 Bacteria 2379
330 Ga0207682_10099061 3300025893 Bacteria 1272
331 Ga0207682_10214719 3300025893 Bacteria 888
332 Ga0207642_10038599 3300025899 Bacteria 2068
333 Ga0207642_10171178 3300025899 Bacteria 1175
334 Ga0207710_10014408 3300025900 Bacteria 3334
335 Ga0207710_10048737 3300025900 Bacteria 1896
336 Ga0207688_10080773 3300025901 Bacteria 1856
337 Ga0207680_10003326 3300025903 Bacteria 7574
338 Ga0207680_10011145 3300025903 Bacteria 4530
339 Ga0207680_10172899 3300025903 Bacteria 1456
340 Ga0207680_10183839 3300025903 Bacteria 1415
341 Ga0207647_10022452 3300025904 Bacteria 4190
342 Ga0207647_10316810 3300025904 Bacteria 886
343 Ga0207685_10420741 3300025905 Bacteria 689
344 Ga0207645_10000354 3300025907 Bacteria 38157
345 Ga0207645_10001476 3300025907 Bacteria 19223
346 Ga0207645_10129940 3300025907 Bacteria 1639
347 Ga0207643_10008661 3300025908 Bacteria 5457
348 Ga0207643_10061729 3300025908 Bacteria 2141
349 Ga0207643_10212564 3300025908 Bacteria 1181
350 Ga0207705_10075479 3300025909 Bacteria 2448
351 Ga0207705_10092875 3300025909 Bacteria 2212
352 Ga0207705_10477355 3300025909 Unclassified 968
353 Ga0207705_10623410 3300025909 Bacteria 839
354 Ga0207654_10037839 3300025911 Bacteria 2703
355 Ga0207654_10302298 3300025911 Unclassified 1088
356 Ga0207707_10001470 3300025912 Bacteria 21804
357 Ga0207707_10519998 3300025912 Bacteria 1013
358 Ga0207707_11054158 3300025912 Bacteria 665
359 Ga0207695_10130130 3300025913 Bacteria 2475
360 Ga0207695_10156191 3300025913 Bacteria 2216
361 Ga0207671_10005924 3300025914 Bacteria 11082
362 Ga0207671_10021860 3300025914 Bacteria 4847
363 Ga0207671_10128164 3300025914 Unclassified 1946
364 Ga0207671_10187298 3300025914 Bacteria 1612
365 Ga0207671_10597410 3300025914 Bacteria 879
366 Ga0207660_10004295 3300025917 Bacteria 9298
367 Ga0207660_10155632 3300025917 Bacteria 1759
368 Ga0207657_10374092 3300025919 Bacteria 1122
369 Ga0207652_10001229 3300025921 Bacteria 22941
370 Ga0207652_10194889 3300025921 Bacteria 1822
371 Ga0207652_10377345 3300025921 Bacteria 1280
372 Ga0207681_10087309 3300025923 Bacteria 2219
373 Ga0207694_10340921 3300025924 Bacteria 1239
374 Ga0207694_10584342 3300025924 Bacteria 939
375 Ga0207650_10098198 3300025925 Unclassified 2249
376 Ga0207650_10172232 3300025925 Bacteria 1721
377 Ga0207650_10294304 3300025925 Bacteria 1324
378 Ga0207650_10375028 3300025925 Bacteria 1174
379 Ga0207650_10540802 3300025925 Bacteria 976
380 Ga0207659_10076256 3300025926 Bacteria 2464
381 Ga0207659_10144717 3300025926 Bacteria 1849
382 Ga0207659_10196484 3300025926 Bacteria 1608
383 Ga0207687_10213272 3300025927 Bacteria 1516
384 Ga0207644_10021217 3300025931 Bacteria 4422
385 Ga0207644_10163321 3300025931 Bacteria 1733
386 Ga0207644_10442923 3300025931 Bacteria 1066
387 Ga0207690_10277756 3300025932 Bacteria 1304
388 Ga0207706_10008650 3300025933 Bacteria 9379
389 Ga0207686_10146504 3300025934 Bacteria 1638
390 Ga0207686_10152151 3300025934 Unclassified 1612
391 Ga0207686_10185296 3300025934 Bacteria 1479
392 Ga0207670_10054145 3300025936 Bacteria 2706
393 Ga0207670_10225184 3300025936 Bacteria 1438
394 Ga0207669_10027832 3300025937 Bacteria 3101
395 Ga0207669_10074897 3300025937 Bacteria 2143
396 Ga0207669_10107267 3300025937 Bacteria 1862
397 Ga0207704_10128582 3300025938 Bacteria 1749
398 Ga0207704_10180803 3300025938 Bacteria 1524
399 Ga0207704_10424847 3300025938 Bacteria 1054
400 Ga0207691_10000549 3300025940 Bacteria 37607
401 Ga0207691_10003925 3300025940 Bacteria 14448
402 Ga0207691_10008243 3300025940 Bacteria 10005
403 Ga0207691_10062570 3300025940 Bacteria 3376
404 Ga0207691_10168864 3300025940 Bacteria 1916
405 Ga0207691_10284845 3300025940 Bacteria 1421
406 Ga0207691_10322579 3300025940 Bacteria 1324
407 Ga0207689_10006527 3300025942 Bacteria 10294
408 Ga0207689_10010556 3300025942 Bacteria 7952
409 Ga0207689_10029044 3300025942 Bacteria 4622
410 Ga0207689_10100411 3300025942 Unclassified 2377
411 Ga0207689_10113713 3300025942 Bacteria 2225
412 Ga0207689_10171444 3300025942 Bacteria 1789
413 Ga0207689_10261387 3300025942 Bacteria 1432
414 Ga0207661_10023411 3300025944 Unclassified 4666
415 Ga0207661_10179494 3300025944 Bacteria 1848
416 Ga0207667_10000791 3300025949 Bacteria 41085
417 Ga0207667_10034038 3300025949 Bacteria 5474
418 Ga0207667_10085518 3300025949 Bacteria 3265
419 Ga0207667_11175584 3300025949 Bacteria 748
420 Ga0207651_10002449 3300025960 Bacteria 8879
421 Ga0207651_10033010 3300025960 Bacteria 3333
422 Ga0207651_10214146 3300025960 Bacteria 1553
423 Ga0207651_10878801 3300025960 Bacteria 797
424 Ga0207712_10011962 3300025961 Bacteria 5537
425 Ga0207712_10031978 3300025961 Bacteria 3548
426 Ga0207712_10044454 3300025961 Bacteria 3070
427 Ga0207712_10057803 3300025961 Bacteria 2738
428 Ga0207668_10006689 3300025972 Bacteria 6818
429 Ga0207668_10194510 3300025972 Bacteria 1610
430 Ga0207668_10221566 3300025972 Bacteria 1519
431 Ga0207668_10389454 3300025972 Bacteria 1175
432 Ga0207640_10169663 3300025981 Bacteria 1625
433 Ga0207640_10578061 3300025981 Bacteria 948
434 Ga0207658_10000942 3300025986 Bacteria 24008
435 Ga0207658_10098651 3300025986 Bacteria 2283
436 Ga0207658_10207877 3300025986 Bacteria 1638
437 Ga0207658_10229074 3300025986 Bacteria 1567
438 Ga0207658_10239493 3300025986 Unclassified 1536
439 Ga0207658_10565817 3300025986 Unclassified 1018
440 Ga0207677_10045163 3300026023 Bacteria 2941
441 Ga0207677_10145135 3300026023 Unclassified 1823
442 Ga0207677_10166742 3300026023 Bacteria 1717
443 Ga0207703_10004584 3300026035 Bacteria 11320
444 Ga0207639_10010606 3300026041 Bacteria 6382
445 Ga0207639_10027582 3300026041 Bacteria 4139
446 Ga0207639_10122649 3300026041 Bacteria 2138
447 Ga0207639_10695407 3300026041 Bacteria 943
448 Ga0207678_10391143 3300026067 Bacteria 1203
449 Ga0207708_10060858 3300026075 Unclassified 2882
450 Ga0207702_10079433 3300026078 Bacteria 2844
451 Ga0207641_10000152 3300026088 Bacteria 98311
452 Ga0207641_10000890 3300026088 Bacteria 31183
453 Ga0207648_10000404 3300026089 Bacteria 48036
454 Ga0207648_10003362 3300026089 Bacteria 16804
455 Ga0207648_10115166 3300026089 Bacteria 2362
456 Ga0207648_10186900 3300026089 Bacteria 1835
457 Ga0207648_10230790 3300026089 Bacteria 1646
458 Ga0207648_10308113 3300026089 Bacteria 1421
459 Ga0207648_10439337 3300026089 Bacteria 1187
460 Ga0207648_10455637 3300026089 Bacteria 1165
461 Ga0207648_10539187 3300026089 Bacteria 1071
462 Ga0207676_10042904 3300026095 Bacteria 3479
463 Ga0207676_10236985 3300026095 Bacteria 1634
464 Ga0207676_10897403 3300026095 Bacteria 869
465 Ga0207676_11415675 3300026095 Bacteria 691
466 Ga0207674_10009204 3300026116 Bacteria 11321
467 Ga0207674_10432807 3300026116 Bacteria 1271
468 Ga0207674_10477431 3300026116 Bacteria 1205
469 Ga0207675_100020207 3300026118 Bacteria 6209
470 Ga0207675_100723198 3300026118 Bacteria 1005
471 Ga0207683_10003746 3300026121 Bacteria 13185
472 Ga0207683_10040120 3300026121 Bacteria 4084
473 Ga0207683_10067053 3300026121 Bacteria 3166
474 Ga0207683_10182961 3300026121 Bacteria 1901
475 Ga0207683_10377551 3300026121 Bacteria 1303
476 Ga0207683_11501209 3300026121 Bacteria 622
477 Ga0207698_10003836 3300026142 Bacteria 9100
478 Ga0207698_10087325 3300026142 Bacteria 2540
479 Ga0207698_10098618 3300026142 Bacteria 2415
480 Ga0207698_10104466 3300026142 Bacteria 2357
481 Ga0207698_10162213 3300026142 Bacteria 1957
482 Ga0207698_10232841 3300026142 Bacteria 1673
483 Ga0207698_10350657 3300026142 Bacteria 1394
484 Ga0207698_10401007 3300026142 Bacteria 1311
485 Ga0207698_10498512 3300026142 Bacteria 1185
486 Ga0207698_10614990 3300026142 Bacteria 1072
487 Ga0209995_1009678 3300027471 Bacteria 1560
488 Ga0268266_10007703 3300028379 Bacteria 9667
489 Ga0268266_10076144 3300028379 Bacteria 2915
490 Ga0268265_10423095 3300028380 Bacteria 1237
491 Ga0268265_10584418 3300028380 Bacteria 1065
492 Ga0268265_10667607 3300028380 Bacteria 1001
493 Ga0268264_10001550 3300028381 Bacteria 21303
494 Ga0268264_10010550 3300028381 Bacteria 7639
495 Ga0268264_10041033 3300028381 Bacteria 3825
496 Ga0268264_10076800 3300028381 Bacteria 2843
497 Ga0268264_10208866 3300028381 Bacteria 1791
498 Ga0268264_10483284 3300028381 Bacteria 1205
499 Ga0268264_10647148 3300028381 Bacteria 1046
500 Ga0307515_10000039 3300028794 Bacteria 323229
501 Ga0307513_10441146 3300031456 Unclassified 1028
502 Ga0307509_10603903 3300031507 Bacteria 769
503 Ga0307508_10047063 3300031616 Bacteria 3849
504 Ga0307518_10251738 3300031838 Bacteria 1122
505 Ga0307412_10350424 3300031911 Bacteria 1185
506 Ga0307414_10007005 3300032004 Bacteria 6317
507 Ga0307414_10019633 3300032004 Bacteria 4193
508 Ga0307414_10118794 3300032004 Bacteria 2028
509 Ga0307414_10488896 3300032004 Bacteria 1087
510 Ga0307414_10672115 3300032004 Bacteria 935
511 Ga0307411_10010848 3300032005 Bacteria 4882
512 Ga0373952_0193313 3300035092 Unclassified 593
513 Ga0373954_0286051 3300035118 Bacteria 813
514 Ga0373924_0092945 3300035410 Bacteria 1292
515 Ga0373925_0079016 3300037068 Bacteria 2499
516 Ga0395900_0035004 3300037418 Bacteria 5172
517 Ga0395905_0002545 3300037471 Bacteria 20113
518 Ga0395905_0380770 3300037471 Bacteria 1305
519 Ga0395905_0505025 3300037471 Unclassified 1109
520 Ga0436365_0419715 3300039437 Bacteria 18456
521 Ga0436365_0474417 3300039437 Bacteria 2535
522 Ga0436365_1727989 3300039437 Bacteria 1344
523 Ga0451802_0618106 3300041460 Bacteria 840
524 Ga0453683_0067106 3300044673 Bacteria 2242
525 Ga0453684_0148075 3300044712 Bacteria 2793
526 Ga0453684_0701338 3300044712 Unclassified 1100
527 Ga0451576_0326267 3300045051 Bacteria 1607
528 Ga0495629_0083186 3300046459 Bacteria 2234
529 Ga0495653_0500181 3300046463 Bacteria 758
530 Ga0495650_0019577 3300046471 Bacteria 3326
531 Ga0495580_0019206 3300046472 Bacteria 5079
532 Ga0495628_0584334 3300046516 Bacteria 799
533 Ga0495630_0066723 3300046517 Bacteria 2705
534 Ga0495665_0684410 3300046531 Bacteria 509
535 Ga0495621_0181519 3300046539 Bacteria 840
536 Ga0495667_0425671 3300046559 Bacteria 835
537 Ga0495668_0001941 3300046616 Bacteria 18402
538 Ga0495668_0015090 3300046616 Bacteria 4518
539 Ga0495623_0228937 3300046679 Bacteria 1055
540 Ga0495647_0053209 3300046681 Bacteria 1578
541 Ga0495658_0001256 3300046683 Bacteria 13328
542 Ga0495670_0043051 3300046691 Bacteria 2253
543 Ga0495600_0229701 3300046809 Bacteria 1185
544 Ga0495674_0183626 3300047319 Bacteria 1741
545 Ga0495674_0433924 3300047319 Bacteria 1057
546 Ga0496104_0235500 3300048907 Bacteria 1743
547 Ga0496105_0185793 3300048908 Bacteria 1701
548 Ga0496108_0243608 3300048911 Bacteria 1564
549 Ga0496108_0344138 3300048911 Bacteria 1301
550 Ga0496109_0286169 3300048912 Bacteria 1553
551 Ga0496110_0530214 3300048913 Bacteria 1071
552 Ga0496114_0460299 3300048917 Bacteria 1126
553 Ga0501297_025245 3300049520 Bacteria 764
554 Ga0501031_0003126 3300049568 Bacteria 10612
555 Ga0501033_0202129 3300049570 Bacteria 1419
556 Ga0501034_0074565 3300049571 Bacteria 3400
557 Ga0501034_0090963 3300049571 Bacteria 3049
558 Ga0501034_0450756 3300049571 Bacteria 1204
559 Ga0501034_1627935 3300049571 Bacteria 518
560 Ga0501036_0018517 3300049572 Bacteria 5837
561 Ga0501036_0116388 3300049572 Bacteria 2258
562 Ga0501036_0312806 3300049572 Bacteria 1313
563 Ga0501037_0015976 3300049573 Bacteria 5525
564 Ga0501037_0104122 3300049573 Unclassified 2046
565 Ga0501038_0006153 3300049574 Bacteria 11107
566 Ga0501038_0099082 3300049574 Bacteria 2430
567 Ga0501039_0144881 3300049575 Bacteria 1867
568 Ga0501039_0569209 3300049575 Bacteria 889
569 Ga0501043_0107470 3300049579 Bacteria 2191
570 Ga0501043_0130775 3300049579 Bacteria 1967
571 Ga0501047_0100391 3300049581 Bacteria 2773
572 Ga0501047_0145022 3300049581 Bacteria 2252
573 Ga0501047_0265609 3300049581 Bacteria 1563
574 Ga0501068_0653821 3300049584 Bacteria 686
575 Ga0501202_053901 3300049652 Bacteria 896
576 Ga0501217_007421 3300049661 Bacteria 2351
577 Ga0501239_041127 3300049672 Bacteria 640
578 Ga0501250_001089 3300049680 Unclassified 2116
579 Ga0501259_007764 3300049688 Bacteria 1719
580 Ga0501263_042699 3300049760 Bacteria 670
581 Ga0501268_004258 3300049765 Bacteria 2009
582 Ga0501035_0049021 3300049822 Bacteria 3786
583 Ga0501044_0008339 3300049823 Bacteria 11357
584 Ga0501044_0348541 3300049823 Bacteria 1401
585 nmdc:mga08y16_119970_c1 3300050511 Bacteria 2737
586 Ga0495619_0029104 3300053085 Bacteria 3567
587 Ga0500646_0001738 3300053090 Bacteria 5724
588 Ga0500583_0009104 3300053092 Bacteria 3609
589 Ga0500583_0050790 3300053092 Bacteria 1925
590 Ga0500559_0085723 3300053136 Bacteria 1437
591 Ga0500588_0027848 3300053146 Bacteria 1597
592 Ga0500604_0025888 3300053151 Bacteria 1688
593 Ga0500622_0047158 3300053156 Bacteria 2226
594 Ga0500636_0055220 3300053177 Bacteria 2328
595 2914761940 2914759650 Bacteria 4701441
596 Ga0157372_10222571
597 JGI24751J29686_10041051
598 rootH1_10112543
599 rootL2_10082698
600 rootH1_10138409
601 Ga0065714_10077584
602 Ga0065714_10152560
603 Ga0065712_10027511
604 Ga0070658_10000363
605 Ga0070658_10046551
606 Ga0070658_10146183
607 Ga0070658_10209292
608 Ga0070658_10589357
609 Ga0070676_10001811
610 Ga0070676_10091583
611 Ga0070676_10250255
612 Ga0070683_100010926
613 Ga0070690_100090295
614 Ga0070690_100373159
615 Ga0070670_100038396
616 Ga0070670_100134955
617 Ga0070670_100182935
618 Ga0070670_100238107
619 Ga0070677_10014063
620 Ga0070677_10080579
621 Ga0068869_100093472
622 Ga0068869_100104702
623 Ga0068869_100263084
624 Ga0068869_100548721
625 Ga0070666_10000028
626 Ga0070666_10001887
627 Ga0070666_10008440
628 Ga0070666_10308191
629 Ga0070680_100003132
630 Ga0070682_100002083
631 Ga0068868_100019877
632 Ga0068868_100027683
633 Ga0068868_100076832
634 Ga0068868_100098963
635 Ga0068868_100129287
636 Ga0068868_100308203
637 Ga0070660_100252948
638 Ga0070689_100159420
639 Ga0070689_100235393
640 Ga0070691_10011758
641 Ga0070687_100022351
642 Ga0070661_100049918
643 Ga0070661_100403792
644 Ga0070661_100590334
645 Ga0070668_100000308
646 Ga0070668_100046743
647 Ga0070668_100423467
648 Ga0070669_100083069
649 Ga0070669_100171089
650 Ga0070675_100027552
651 Ga0070675_100063503
652 Ga0070675_100102118
653 Ga0070675_100158666
654 Ga0070675_100250709
655 Ga0070675_100252349
656 Ga0070675_100629158
657 Ga0070671_100031738
658 Ga0070671_100352747
659 Ga0070674_100003085
660 Ga0070674_100034998
661 Ga0070674_100053301
662 Ga0070674_100064253
663 Ga0070674_100530523
664 Ga0070673_100018725
665 Ga0070673_100019866
666 Ga0070673_100032891
667 Ga0070673_100164626
668 Ga0070673_100278045
669 Ga0070673_100923398
670 Ga0070659_100030941
671 Ga0070659_100237155
672 Ga0070659_100927960
673 Ga0070667_100000583
674 Ga0070667_100090537
675 Ga0070667_100149180
676 Ga0070667_100150402
677 Ga0070667_100313619
678 Ga0070667_100942647
679 Ga0070701_10048622
680 Ga0070701_10080905
681 Ga0070700_100071294
682 Ga0070663_100232469
683 Ga0070663_101005205
684 Ga0070678_100008598
685 Ga0070678_100097084
686 Ga0070678_100311025
687 Ga0070678_100404322
688 Ga0070678_100554419
689 Ga0070662_100019674
690 Ga0070681_10120514
691 Ga0070681_10206926
692 Ga0068867_100039971
693 Ga0068867_100043582
694 Ga0068867_100078022
695 Ga0068867_100087264
696 Ga0068867_100317783
697 Ga0068867_100362108
698 Ga0068867_100421375
699 Ga0068867_100486510
700 Ga0070679_100004819
701 Ga0070679_100102208
702 Ga0070679_100375749
703 Ga0070684_100019764
704 Ga0070684_100254633
705 Ga0068853_100154137
706 Ga0068853_100233488
707 Ga0068853_100734124
708 Ga0068853_101243014
709 Ga0070672_100018931
710 Ga0070672_100092605
711 Ga0070672_100167559
712 Ga0070672_100190092
713 Ga0070672_100301689
714 Ga0070672_100345693
715 Ga0070672_100560451
716 Ga0070672_100598046
717 Ga0070693_100023071
718 Ga0070693_100146172
719 Ga0070665_100004255
720 Ga0070665_100021077
721 Ga0068855_100263666
722 Ga0068855_100281076
723 Ga0068855_100419551
724 Ga0068855_101348281
725 Ga0070664_100009055
726 Ga0070664_100342543
727 Ga0070664_100642011
728 Ga0068857_100012210
729 Ga0068857_100386014
730 Ga0068857_100644048
731 Ga0068854_100013418
732 Ga0068854_100034355
733 Ga0068854_100127696
734 Ga0068856_100023362
735 Ga0068852_100001126
736 Ga0068852_100005400
737 Ga0068852_100105527
738 Ga0068852_100120884
739 Ga0068852_100126447
740 Ga0068852_100385281
741 Ga0068852_100426681
742 Ga0068859_100000012
743 Ga0068859_100008213
744 Ga0068859_100020133
745 Ga0068859_100040958
746 Ga0068859_100503220
747 Ga0068859_100558398
748 Ga0068864_100007973
749 Ga0068864_100037342
750 Ga0068864_100050257
751 Ga0068864_100097271
752 Ga0068864_100230210
753 Ga0068864_101126537
754 Ga0068866_10088208
755 Ga0068866_10131448
756 Ga0068866_10162542
757 Ga0068861_100112376
758 Ga0068861_100235107
759 Ga0068861_100933688
760 Ga0068851_10000989
761 Ga0068851_10070690
762 Ga0068870_10046749
763 Ga0068863_100001439
764 Ga0068863_100009422
765 Ga0068858_100010710
766 Ga0068858_100134812
767 Ga0068858_100257870
768 Ga0068860_100000662
769 Ga0068860_100012479
770 Ga0068860_100020187
771 Ga0068860_100059768
772 Ga0068860_100298642
773 Ga0068862_100106518
774 Ga0068862_100141711
775 Ga0068862_100462931
776 Ga0068862_100608316
777 Ga0097621_100005734
778 Ga0097621_100008118
779 Ga0097621_100020920
780 Ga0097621_100056489
781 Ga0097621_100444182
782 Ga0097621_100601981
783 Ga0097621_100691634
784 Ga0097621_100970285
785 Ga0068871_100001400
786 Ga0068871_100011462
787 Ga0068871_100056823
788 Ga0068871_100116749
789 Ga0068871_100157438
790 Ga0068871_100772499
791 Ga0068865_100115618
792 Ga0068865_100136673
793 Ga0068865_100182420
794 Ga0097620_100000012
795 Ga0097620_100008213
796 Ga0097620_100020133
797 Ga0097620_100040960
798 Ga0097620_100503220
799 Ga0097620_100558468
800 Ga0105240_10014812
801 Ga0105240_10057216
802 Ga0111539_10182971
803 Ga0111539_10233586
804 Ga0105245_10191796
805 Ga0105247_10018261
806 Ga0105247_10029312
807 Ga0105247_10078580
808 Ga0105243_10150648
809 Ga0105241_10000619
810 Ga0105241_10005432
811 Ga0105241_10121196
812 Ga0105242_10022278
813 Ga0105242_10057126
814 Ga0105242_10138408
815 Ga0105242_10975618
816 Ga0105242_11108161
817 Ga0105248_10126506
818 Ga0105248_10174484
819 Ga0105237_10007560
820 Ga0105237_10018768
821 Ga0105237_10333801
822 Ga0105237_10554977
823 Ga0105238_10021505
824 Ga0105238_10214383
825 Ga0105249_10000336
826 Ga0105249_10029128
827 Ga0105249_10061806
828 Ga0105249_10062091
829 Ga0105249_10102224
830 Ga0105239_10062059
831 Ga0105239_10206645
832 Ga0105239_10296258
833 Ga0105246_10020025
834 Ga0105246_10039499
835 Ga0105246_10277672
836 Ga0105246_10286332
837 Ga0105246_10354976
838 Ga0157373_10037959
839 Ga0157373_10090531
840 Ga0157371_10012374
841 Ga0157371_10051484
842 Ga0157371_10072668
843 Ga0157371_10196500
844 Ga0157371_10740303
845 Ga0157370_10004121
846 Ga0157370_10026357
847 Ga0157370_10089103
848 Ga0157370_10220798
849 Ga0157370_10396511
850 Ga0157369_10048509
851 Ga0157369_10135694
852 Ga0157369_10512193
853 Ga0157369_10684364
854 Ga0157369_10943329
855 Ga0157374_10000484
856 Ga0157374_10099849
857 Ga0157374_10128823
858 Ga0157374_10206274
859 Ga0157374_10424700
860 Ga0157374_10714840
861 Ga0157378_10020742
862 Ga0157378_10031238
863 Ga0157378_10033991
864 Ga0157378_10080139
865 Ga0157378_10083364
866 Ga0157378_10171754
867 Ga0157378_10337903
868 Ga0157378_10449081
869 Ga0157378_11809796
870 Ga0163162_10000282
871 Ga0163162_10000484
872 Ga0163162_10007655
873 Ga0163162_10058595
874 Ga0163162_10161847
875 Ga0163162_10323625
876 Ga0157372_10000596
877 Ga0157372_10024348
878 Ga0157372_10038806
879 Ga0157372_10052623
880 Ga0157372_10072603
881 Ga0157372_10103431
882 Ga0157372_10176121
883 Ga0157372_10322950
884 Ga0157372_10355726
885 Ga0157372_10605603
886 Ga0157375_10000619
887 Ga0157375_10088690
888 Ga0157375_10101916
889 Ga0157375_10355986
890 Ga0157375_10360844
891 Ga0157375_10493546
892 Ga0157375_10509416
893 Ga0157375_10915380
894 Ga0157375_11049832
895 Ga0163163_10000499
896 Ga0163163_10051839
897 Ga0163163_10140981
898 Ga0163163_10347815
899 Ga0163163_10437907
900 Ga0163163_10968359
901 Ga0157380_10087245
902 Ga0157380_10174656
903 Ga0157380_10236164
904 Ga0157380_10280977
905 Ga0157377_10010450
906 Ga0157377_10015114
907 Ga0157379_10002615
908 Ga0157379_10065528
909 Ga0157379_10309201
910 Ga0157379_10513058
911 Ga0157379_10682951
912 Ga0157379_10892114
913 Ga0157376_10002613
914 Ga0157376_10015531
915 Ga0157376_10054485
916 Ga0157376_10263180
917 Ga0157376_10651026
918 Ga0157376_11116447
919 Ga0163161_10065548
920 Ga0163161_10586079
921 Ga0213876_10006643
922 Ga0207656_10009015
923 Ga0207656_10026069
924 Ga0207682_10099061
925 Ga0207682_10214719
926 Ga0207642_10038599
927 Ga0207642_10171178
928 Ga0207710_10014408
929 Ga0207710_10048737
930 Ga0207688_10080773
931 Ga0207680_10003326
932 Ga0207680_10011145
933 Ga0207680_10172899
934 Ga0207680_10183839
935 Ga0207647_10022452
936 Ga0207647_10316810
937 Ga0207685_10420741
938 Ga0207645_10000354
939 Ga0207645_10001476
940 Ga0207645_10129940
941 Ga0207643_10008661
942 Ga0207643_10061729
943 Ga0207643_10212564
944 Ga0207705_10075479
945 Ga0207705_10092875
946 Ga0207705_10477355
947 Ga0207705_10623410
948 Ga0207654_10037839
949 Ga0207654_10302298
950 Ga0207707_10001470
951 Ga0207707_10519998
952 Ga0207707_11054158
953 Ga0207695_10130130
954 Ga0207695_10156191
955 Ga0207671_10005924
956 Ga0207671_10021860
957 Ga0207671_10128164
958 Ga0207671_10187298
959 Ga0207671_10597410
960 Ga0207660_10004295
961 Ga0207660_10155632
962 Ga0207657_10374092
963 Ga0207652_10001229
964 Ga0207652_10194889
965 Ga0207652_10377345
966 Ga0207681_10087309
967 Ga0207694_10340921
968 Ga0207694_10584342
969 Ga0207650_10098198
970 Ga0207650_10172232
971 Ga0207650_10294304
972 Ga0207650_10375028
973 Ga0207650_10540802
974 Ga0207659_10076256
975 Ga0207659_10144717
976 Ga0207659_10196484
977 Ga0207687_10213272
978 Ga0207644_10021217
979 Ga0207644_10163321
980 Ga0207644_10442923
981 Ga0207690_10277756
982 Ga0207706_10008650
983 Ga0207686_10146504
984 Ga0207686_10152151
985 Ga0207686_10185296
986 Ga0207670_10054145
987 Ga0207670_10225184
988 Ga0207669_10027832
989 Ga0207669_10074897
990 Ga0207669_10107267
991 Ga0207704_10128582
992 Ga0207704_10180803
993 Ga0207704_10424847
994 Ga0207691_10000549
995 Ga0207691_10003925
996 Ga0207691_10008243
997 Ga0207691_10062570
998 Ga0207691_10168864
999 Ga0207691_10284845
1000 Ga0207691_10322579
1001 Ga0207689_10006527
1002 Ga0207689_10010556
1003 Ga0207689_10029044
1004 Ga0207689_10100411
1005 Ga0207689_10113713
1006 Ga0207689_10171444
1007 Ga0207689_10261387
1008 Ga0207661_10023411
1009 Ga0207661_10179494
1010 Ga0207667_10000791
1011 Ga0207667_10034038
1012 Ga0207667_10085518
1013 Ga0207667_11175584
1014 Ga0207651_10002449
1015 Ga0207651_10033010
1016 Ga0207651_10214146
1017 Ga0207651_10878801
1018 Ga0207712_10011962
1019 Ga0207712_10031978
1020 Ga0207712_10044454
1021 Ga0207712_10057803
1022 Ga0207668_10006689
1023 Ga0207668_10194510
1024 Ga0207668_10221566
1025 Ga0207668_10389454
1026 Ga0207640_10169663
1027 Ga0207640_10578061
1028 Ga0207658_10000942
1029 Ga0207658_10098651
1030 Ga0207658_10207877
1031 Ga0207658_10229074
1032 Ga0207658_10239493
1033 Ga0207658_10565817
1034 Ga0207677_10045163
1035 Ga0207677_10145135
1036 Ga0207677_10166742
1037 Ga0207703_10004584
1038 Ga0207639_10010606
1039 Ga0207639_10027582
1040 Ga0207639_10122649
1041 Ga0207639_10695407
1042 Ga0207678_10391143
1043 Ga0207708_10060858
1044 Ga0207702_10079433
1045 Ga0207641_10000152
1046 Ga0207641_10000890
1047 Ga0207648_10000404
1048 Ga0207648_10003362
1049 Ga0207648_10115166
1050 Ga0207648_10186900
1051 Ga0207648_10230790
1052 Ga0207648_10308113
1053 Ga0207648_10439337
1054 Ga0207648_10455637
1055 Ga0207648_10539187
1056 Ga0207676_10042904
1057 Ga0207676_10236985
1058 Ga0207676_10897403
1059 Ga0207676_11415675
1060 Ga0207674_10009204
1061 Ga0207674_10432807
1062 Ga0207674_10477431
1063 Ga0207675_100020207
1064 Ga0207675_100723198
1065 Ga0207683_10003746
1066 Ga0207683_10040120
1067 Ga0207683_10067053
1068 Ga0207683_10182961
1069 Ga0207683_10377551
1070 Ga0207683_11501209
1071 Ga0207698_10003836
1072 Ga0207698_10087325
1073 Ga0207698_10098618
1074 Ga0207698_10104466
1075 Ga0207698_10162213
1076 Ga0207698_10232841
1077 Ga0207698_10350657
1078 Ga0207698_10401007
1079 Ga0207698_10498512
1080 Ga0207698_10614990
1081 Ga0209995_1009678
1082 Ga0268266_10007703
1083 Ga0268266_10076144
1084 Ga0268265_10423095
1085 Ga0268265_10584418
1086 Ga0268265_10667607
1087 Ga0268264_10001550
1088 Ga0268264_10010550
1089 Ga0268264_10041033
1090 Ga0268264_10076800
1091 Ga0268264_10208866
1092 Ga0268264_10483284
1093 Ga0268264_10647148
1094 Ga0307515_10000039
1095 Ga0307513_10441146
1096 Ga0307509_10603903
1097 Ga0307508_10047063
1098 Ga0307518_10251738
1099 Ga0307412_10350424
1100 Ga0307414_10007005
1101 Ga0307414_10019633
1102 Ga0307414_10118794
1103 Ga0307414_10488896
1104 Ga0307414_10672115
1105 Ga0307411_10010848
1106 Ga0373952_0193313
1107 Ga0373954_0286051
1108 Ga0373924_0092945
1109 Ga0373925_0079016
1110 Ga0395900_0035004
1111 Ga0395905_0002545
1112 Ga0395905_0380770
1113 Ga0395905_0505025
1114 Ga0436365_0419715
1115 Ga0436365_0474417
1116 Ga0436365_1727989
1117 Ga0451802_0618106
1118 Ga0453683_0067106
1119 Ga0453684_0148075
1120 Ga0453684_0701338
1121 Ga0451576_0326267
1122 Ga0495629_0083186
1123 Ga0495653_0500181
1124 Ga0495650_0019577
1125 Ga0495580_0019206
1126 Ga0495628_0584334
1127 Ga0495630_0066723
1128 Ga0495665_0684410
1129 Ga0495621_0181519
1130 Ga0495667_0425671
1131 Ga0495668_0001941
1132 Ga0495668_0015090
1133 Ga0495623_0228937
1134 Ga0495647_0053209
1135 Ga0495658_0001256
1136 Ga0495670_0043051
1137 Ga0495600_0229701
1138 Ga0495674_0183626
1139 Ga0495674_0433924
1140 Ga0496104_0235500
1141 Ga0496105_0185793
1142 Ga0496108_0243608
1143 Ga0496108_0344138
1144 Ga0496109_0286169
1145 Ga0496110_0530214
1146 Ga0496114_0460299
1147 Ga0501297_025245
1148 Ga0501031_0003126
1149 Ga0501033_0202129
1150 Ga0501034_0074565
1151 Ga0501034_0090963
1152 Ga0501034_0450756
1153 Ga0501034_1627935
1154 Ga0501036_0018517
1155 Ga0501036_0116388
1156 Ga0501036_0312806
1157 Ga0501037_0015976
1158 Ga0501037_0104122
1159 Ga0501038_0006153
1160 Ga0501038_0099082
1161 Ga0501039_0144881
1162 Ga0501039_0569209
1163 Ga0501043_0107470
1164 Ga0501043_0130775
1165 Ga0501047_0100391
1166 Ga0501047_0145022
1167 Ga0501047_0265609
1168 Ga0501068_0653821
1169 Ga0501202_053901
1170 Ga0501217_007421
1171 Ga0501239_041127
1172 Ga0501250_001089
1173 Ga0501259_007764
1174 Ga0501263_042699
1175 Ga0501268_004258
1176 Ga0501035_0049021
1177 Ga0501044_0008339
1178 Ga0501044_0348541
1179 nmdc:mga08y16_119970_c1
1180 Ga0495619_0029104
1181 Ga0500646_0001738
1182 Ga0500583_0009104
1183 Ga0500583_0050790
1184 Ga0500559_0085723
1185 Ga0500588_0027848
1186 Ga0500604_0025888
1187 Ga0500622_0047158
1188 Ga0500636_0055220
1189 2914761940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

50

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9067 114 182
3hug-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9048 113 182
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.886 114 182
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8564 124 175
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.854 121 175
ID Description Score Start End Superfamily
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 122 182 1.10.10.10
3hugI00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9168 116 182 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 116 181 1.10.10.10
3hugC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9048 113 182 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8991 114 181 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A520H863-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9955 5 93 GO:0006352
GO:0016987
AF-A0A519VM48-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9507 3 85 GO:0006352
GO:0016987
AF-A0A7T9KKJ4-F1-model_v4 deleted 0.9319 7 102
AF-A0A3C0IM79-F1-model_v4 RNA polymerase subunit sigma-70 0.9053 98 184
AF-A0A7T9KKJ4-F1-model_v4 deleted 0.9048 7 102

Map