F467304

General Info

Members Datasets Scaffolds Average Seq Length
594 260 1188 113

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100132304|Ga0070707_1001323043
Length 111
Sequence MNIFLLADSPQPGGLFSGGSGMIFFMGAIILVFWLFFIRPQSKKKFIEDIQKGTKVVTIAGIHGTVNRVNEDGTINLEVSPGSYIKMEKASISMEMTNAINKPVTSTSDKK

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
174 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
244 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
248 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
251 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
258 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.17
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 2.36
Rhizosphere 91.08
Stem 0
Stem Tuber 0
Unclassified 16.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100132304 3300005468 Bacteria 2426
2 ARcpr5yngRDRAFT_c009477 3300000043 Bacteria 832
3 JGI24740J21852_10023673 3300001979 Bacteria 2094
4 JGI24751J29686_10000860 3300002459 Bacteria 6999
5 rootH2_10040915 3300003320 Bacteria 17003
6 rootL2_10127592 3300003322 Bacteria 1853
7 rootH1_10153594 3300003323 Bacteria 2083
8 rootH1_10262828 3300003323 Bacteria 3172
9 rootH1_10324577 3300003323 Unclassified 1915
10 Ga0065712_10228577 3300005290 Bacteria 1018
11 Ga0070658_10127863 3300005327 Bacteria 2116
12 Ga0070658_11276367 3300005327 Unclassified 638
13 Ga0070676_10009776 3300005328 Bacteria 5189
14 Ga0070676_10564951 3300005328 Bacteria 816
15 Ga0070683_100014200 3300005329 Bacteria 6959
16 Ga0070683_100084512 3300005329 Bacteria 2974
17 Ga0070683_100088439 3300005329 Bacteria 2906
18 Ga0070683_100165526 3300005329 Bacteria 2098
19 Ga0070683_100200933 3300005329 Unclassified 1893
20 Ga0070690_100108731 3300005330 Unclassified 1847
21 Ga0070670_100036117 3300005331 Bacteria 4253
22 Ga0070670_100050382 3300005331 Unclassified 3578
23 Ga0070670_100096804 3300005331 Bacteria 2539
24 Ga0070670_100130288 3300005331 Bacteria 2172
25 Ga0070670_100152213 3300005331 Bacteria 2002
26 Ga0070670_100387808 3300005331 Bacteria 1231
27 Ga0070670_100769215 3300005331 Bacteria 868
28 Ga0070677_10427150 3300005333 Bacteria 704
29 Ga0068869_100019682 3300005334 Bacteria 4618
30 Ga0068869_100047971 3300005334 Bacteria 3086
31 Ga0068869_100087052 3300005334 Unclassified 2343
32 Ga0068869_100097262 3300005334 Bacteria 2222
33 Ga0068869_100509383 3300005334 Bacteria 1006
34 Ga0070666_10047701 3300005335 Bacteria 2876
35 Ga0070666_10099503 3300005335 Unclassified 2003
36 Ga0070666_10706883 3300005335 Bacteria 739
37 Ga0070666_11379950 3300005335 Bacteria 526
38 Ga0070680_100118515 3300005336 Bacteria 2208
39 Ga0070682_101033454 3300005337 Bacteria 684
40 Ga0070682_101068122 3300005337 Bacteria 674
41 Ga0068868_100029175 3300005338 Unclassified 4224
42 Ga0068868_100043804 3300005338 Bacteria 3496
43 Ga0068868_100048383 3300005338 Bacteria 3335
44 Ga0068868_100391942 3300005338 Bacteria 1197
45 Ga0070660_100978689 3300005339 Bacteria 715
46 Ga0070689_100178021 3300005340 Bacteria 1726
47 Ga0070689_100365736 3300005340 Bacteria 1213
48 Ga0070689_100578044 3300005340 Bacteria 971
49 Ga0070689_100838081 3300005340 Bacteria 810
50 Ga0070689_101135567 3300005340 Bacteria 699
51 Ga0070687_100083037 3300005343 Bacteria 1753
52 Ga0070687_101037040 3300005343 Bacteria 596
53 Ga0070661_100002884 3300005344 Bacteria 11832
54 Ga0070661_100191494 3300005344 Bacteria 1560
55 Ga0070692_10428259 3300005345 Bacteria 842
56 Ga0070668_100261609 3300005347 Bacteria 1439
57 Ga0070669_100244193 3300005353 Bacteria 1427
58 Ga0070669_100482647 3300005353 Unclassified 1026
59 Ga0070675_100269767 3300005354 Bacteria 1493
60 Ga0070675_100656737 3300005354 Bacteria 953
61 Ga0070671_100006703 3300005355 Bacteria 9212
62 Ga0070671_100036141 3300005355 Unclassified 4096
63 Ga0070671_100726123 3300005355 Bacteria 863
64 Ga0070673_100026536 3300005364 Bacteria 4279
65 Ga0070673_100775715 3300005364 Bacteria 884
66 Ga0070673_100990732 3300005364 Bacteria 782
67 Ga0070673_101875663 3300005364 Bacteria 568
68 Ga0070688_100033192 3300005365 Unclassified 3118
69 Ga0070688_100411780 3300005365 Unclassified 1003
70 Ga0070659_100328360 3300005366 Bacteria 1280
71 Ga0070659_100368340 3300005366 Bacteria 1208
72 Ga0070667_100007538 3300005367 Bacteria 9028
73 Ga0070667_100069663 3300005367 Unclassified 2994
74 Ga0070667_100124536 3300005367 Bacteria 2245
75 Ga0070667_100436427 3300005367 Bacteria 1195
76 Ga0070667_100991109 3300005367 Bacteria 784
77 Ga0070709_11791934 3300005434 Bacteria 502
78 Ga0070663_100557524 3300005455 Bacteria 958
79 Ga0070663_101009658 3300005455 Bacteria 724
80 Ga0070678_100168048 3300005456 Unclassified 1783
81 Ga0070678_100223428 3300005456 Bacteria 1566
82 Ga0070678_101388717 3300005456 Unclassified 655
83 Ga0070678_101463028 3300005456 Bacteria 639
84 Ga0070678_101709821 3300005456 Unclassified 592
85 Ga0070662_100002969 3300005457 Bacteria 10535
86 Ga0070662_100017545 3300005457 Bacteria 4828
87 Ga0070662_100190975 3300005457 Bacteria 1620
88 Ga0070662_100421949 3300005457 Bacteria 1104
89 Ga0070662_101243336 3300005457 Bacteria 640
90 Ga0068867_100082858 3300005459 Bacteria 2421
91 Ga0068867_100116362 3300005459 Bacteria 2060
92 Ga0068867_100148048 3300005459 Bacteria 1842
93 Ga0068867_100305515 3300005459 Bacteria 1313
94 Ga0068867_101058136 3300005459 Unclassified 739
95 Ga0068867_101373034 3300005459 Bacteria 654
96 Ga0070685_10117039 3300005466 Unclassified 1650
97 Ga0070685_10186267 3300005466 Unclassified 1340
98 Ga0070685_10595880 3300005466 Bacteria 795
99 Ga0070679_100127062 3300005530 Bacteria 2531
100 Ga0070679_100842708 3300005530 Bacteria 860
101 Ga0070684_100021116 3300005535 Bacteria 5411
102 Ga0070684_100073118 3300005535 Bacteria 3020
103 Ga0070684_100087373 3300005535 Bacteria 2769
104 Ga0070684_100325187 3300005535 Bacteria 1413
105 Ga0070684_100440951 3300005535 Unclassified 1203
106 Ga0070684_100970997 3300005535 Bacteria 797
107 Ga0070697_101481929 3300005536 Bacteria 606
108 Ga0068853_100033618 3300005539 Bacteria 4351
109 Ga0068853_100062008 3300005539 Bacteria 3235
110 Ga0068853_100767113 3300005539 Bacteria 922
111 Ga0068853_100997648 3300005539 Bacteria 806
112 Ga0068853_101113050 3300005539 Unclassified 762
113 Ga0070686_100013237 3300005544 Unclassified 4717
114 Ga0070686_100086018 3300005544 Bacteria 2092
115 Ga0070686_100327514 3300005544 Bacteria 1144
116 Ga0070686_100956827 3300005544 Bacteria 700
117 Ga0070686_101512177 3300005544 Unclassified 566
118 Ga0070693_100984371 3300005547 Bacteria 637
119 Ga0070665_100110981 3300005548 Bacteria 2745
120 Ga0070704_101154009 3300005549 Bacteria 705
121 Ga0068855_100596212 3300005563 Unclassified 1192
122 Ga0068855_101232266 3300005563 Bacteria 777
123 Ga0068855_101549938 3300005563 Bacteria 679
124 Ga0070664_100017898 3300005564 Bacteria 5818
125 Ga0070664_100139591 3300005564 Bacteria 2133
126 Ga0070664_100183979 3300005564 Bacteria 1859
127 Ga0070664_100205180 3300005564 Bacteria 1760
128 Ga0068857_100051756 3300005577 Bacteria 3644
129 Ga0068857_100067498 3300005577 Bacteria 3183
130 Ga0068857_100145841 3300005577 Bacteria 2142
131 Ga0068854_100764919 3300005578 Bacteria 839
132 Ga0068854_100858792 3300005578 Bacteria 795
133 Ga0068854_101690295 3300005578 Bacteria 578
134 Ga0068854_102194662 3300005578 Bacteria 511
135 Ga0070702_100061490 3300005615 Unclassified 2187
136 Ga0070702_100656749 3300005615 Bacteria 794
137 Ga0068852_100005802 3300005616 Bacteria 8866
138 Ga0068852_100152702 3300005616 Bacteria 2149
139 Ga0068852_100178051 3300005616 Bacteria 1998
140 Ga0068852_100762610 3300005616 Bacteria 980
141 Ga0068852_101070036 3300005616 Bacteria 826
142 Ga0068852_101176868 3300005616 Bacteria 788
143 Ga0068852_101276425 3300005616 Bacteria 756
144 Ga0068852_101867271 3300005616 Bacteria 623
145 Ga0068852_102423732 3300005616 Bacteria 545
146 Ga0068859_100107438 3300005617 Bacteria 2851
147 Ga0068859_100120320 3300005617 Bacteria 2692
148 Ga0068859_100404006 3300005617 Bacteria 1462
149 Ga0068859_101034146 3300005617 Bacteria 903
150 Ga0068859_101470451 3300005617 Bacteria 752
151 Ga0068864_100004334 3300005618 Bacteria 11652
152 Ga0068864_100077479 3300005618 Bacteria 2907
153 Ga0068864_100084084 3300005618 Bacteria 2796
154 Ga0068864_100092355 3300005618 Unclassified 2672
155 Ga0068864_100560813 3300005618 Bacteria 1105
156 Ga0068864_100647685 3300005618 Bacteria 1029
157 Ga0068864_100789569 3300005618 Bacteria 932
158 Ga0068864_100935893 3300005618 Bacteria 857
159 Ga0068866_10007246 3300005718 Unclassified 4639
160 Ga0068866_10180936 3300005718 Bacteria 1245
161 Ga0068861_100284270 3300005719 Bacteria 1426
162 Ga0068861_101800352 3300005719 Bacteria 607
163 Ga0068870_10144439 3300005840 Unclassified 1395
164 Ga0068863_100183017 3300005841 Bacteria 2011
165 Ga0068863_100318867 3300005841 Bacteria 1509
166 Ga0068863_101052571 3300005841 Bacteria 817
167 Ga0068863_101207069 3300005841 Bacteria 762
168 Ga0068863_101229184 3300005841 Bacteria 755
169 Ga0068858_102161390 3300005842 Bacteria 550
170 Ga0068858_102524808 3300005842 Bacteria 507
171 Ga0068860_100000078 3300005843 Bacteria 171062
172 Ga0068860_100079618 3300005843 Bacteria 3115
173 Ga0068860_100188454 3300005843 Bacteria 1995
174 Ga0068860_101432128 3300005843 Bacteria 712
175 Ga0068860_101980129 3300005843 Unclassified 604
176 Ga0068862_100321232 3300005844 Bacteria 1429
177 Ga0068862_100597740 3300005844 Bacteria 1059
178 Ga0068862_100744978 3300005844 Bacteria 953
179 Ga0081539_10022531 3300005985 Bacteria 4164
180 Ga0070715_10050848 3300006163 Bacteria 1780
181 Ga0070715_10917333 3300006163 Bacteria 540
182 Ga0075366_10057800 3300006195 Bacteria 2304
183 Ga0075366_10099336 3300006195 Bacteria 1746
184 Ga0097621_100000966 3300006237 Bacteria 20113
185 Ga0097621_100095202 3300006237 Unclassified 2497
186 Ga0097621_100338914 3300006237 Bacteria 1335
187 Ga0097621_101166719 3300006237 Bacteria 725
188 Ga0068871_100025073 3300006358 Bacteria 4634
189 Ga0068871_100027191 3300006358 Bacteria 4471
190 Ga0068871_100227777 3300006358 Bacteria 1617
191 Ga0068871_100369199 3300006358 Unclassified 1272
192 Ga0068871_100463981 3300006358 Bacteria 1137
193 Ga0068871_101547021 3300006358 Bacteria 627
194 Ga0068865_100051242 3300006881 Bacteria 2856
195 Ga0068865_100301815 3300006881 Bacteria 1282
196 Ga0068865_100554878 3300006881 Bacteria 965
197 Ga0097620_100107436 3300006931 Bacteria 2851
198 Ga0097620_100120322 3300006931 Bacteria 2692
199 Ga0097620_100404010 3300006931 Bacteria 1462
200 Ga0097620_101034105 3300006931 Bacteria 903
201 Ga0097620_101470632 3300006931 Bacteria 752
202 Ga0075435_100574234 3300007076 Unclassified 977
203 Ga0105251_10103642 3300009011 Bacteria 1300
204 Ga0105240_10038996 3300009093 Bacteria 6088
205 Ga0105240_10071507 3300009093 Bacteria 4290
206 Ga0105240_10577636 3300009093 Unclassified 1240
207 Ga0114129_10499564 3300009147 Unclassified 1589
208 Ga0105243_11306127 3300009148 Bacteria 743
209 Ga0105243_11523136 3300009148 Bacteria 693
210 Ga0105241_10362978 3300009174 Unclassified 1261
211 Ga0105241_11195789 3300009174 Bacteria 720
212 Ga0105241_11851372 3300009174 Unclassified 590
213 Ga0105242_10125658 3300009176 Bacteria 2207
214 Ga0105242_10886887 3300009176 Unclassified 891
215 Ga0105242_11981575 3300009176 Bacteria 624
216 Ga0105248_10101978 3300009177 Bacteria 3235
217 Ga0105237_10008755 3300009545 Bacteria 10920
218 Ga0105237_11032121 3300009545 Bacteria 829
219 Ga0105237_11113500 3300009545 Bacteria 796
220 Ga0105238_10806482 3300009551 Bacteria 954
221 Ga0105249_10001952 3300009553 Bacteria 17885
222 Ga0105249_10023245 3300009553 Bacteria 5560
223 Ga0105249_10034838 3300009553 Bacteria 4564
224 Ga0105249_10241984 3300009553 Bacteria 1784
225 Ga0105249_10344272 3300009553 Bacteria 1508
226 Ga0105249_10400890 3300009553 Bacteria 1402
227 Ga0105249_10438101 3300009553 Bacteria 1344
228 Ga0105239_10000852 3300010375 Bacteria 43369
229 Ga0105239_10012171 3300010375 Bacteria 9593
230 Ga0105239_10021864 3300010375 Bacteria 7051
231 Ga0105239_10023373 3300010375 Bacteria 6807
232 Ga0105239_12273740 3300010375 Bacteria 631
233 Ga0105239_12660694 3300010375 Bacteria 584
234 Ga0105246_10995907 3300011119 Unclassified 758
235 Ga0157338_1063659 3300012515 Bacteria 560
236 Ga0157373_10039087 3300013100 Bacteria 3398
237 Ga0157373_10040794 3300013100 Bacteria 3321
238 Ga0157371_10195405 3300013102 Unclassified 1449
239 Ga0157371_11022848 3300013102 Unclassified 631
240 Ga0157369_10494350 3300013105 Bacteria 1266
241 Ga0157374_10003213 3300013296 Bacteria 13723
242 Ga0157374_10069020 3300013296 Bacteria 3327
243 Ga0157374_10290214 3300013296 Bacteria 1616
244 Ga0157374_10433224 3300013296 Bacteria 1315
245 Ga0157374_11071619 3300013296 Bacteria 826
246 Ga0157374_11617772 3300013296 Bacteria 672
247 Ga0157378_10040174 3300013297 Bacteria 4148
248 Ga0157378_10079169 3300013297 Bacteria 2966
249 Ga0157378_10245618 3300013297 Bacteria 1712
250 Ga0157378_10318685 3300013297 Unclassified 1510
251 Ga0163162_10001515 3300013306 Bacteria 21637
252 Ga0163162_10003365 3300013306 Bacteria 15300
253 Ga0163162_10008531 3300013306 Bacteria 9991
254 Ga0163162_10019481 3300013306 Bacteria 6656
255 Ga0163162_10039079 3300013306 Bacteria 4739
256 Ga0163162_10039133 3300013306 Bacteria 4737
257 Ga0163162_11692390 3300013306 Unclassified 722
258 Ga0157372_10042629 3300013307 Bacteria 5021
259 Ga0157372_10052350 3300013307 Bacteria 4546
260 Ga0157372_10589034 3300013307 Bacteria 1296
261 Ga0157372_10630165 3300013307 Bacteria 1249
262 Ga0157372_11255386 3300013307 Unclassified 855
263 Ga0157372_12119046 3300013307 Bacteria 646
264 Ga0157375_10004609 3300013308 Bacteria 11983
265 Ga0157375_10053960 3300013308 Bacteria 3957
266 Ga0157375_10059347 3300013308 Bacteria 3790
267 Ga0157375_10098391 3300013308 Bacteria 3002
268 Ga0157375_10127818 3300013308 Bacteria 2658
269 Ga0157375_10561933 3300013308 Bacteria 1302
270 Ga0157375_11712958 3300013308 Bacteria 744
271 Ga0163163_10000399 3300014325 Bacteria 41026
272 Ga0163163_10001564 3300014325 Bacteria 19316
273 Ga0163163_10111368 3300014325 Unclassified 2766
274 Ga0163163_10170426 3300014325 Bacteria 2223
275 Ga0163163_10376819 3300014325 Bacteria 1476
276 Ga0157380_10671992 3300014326 Bacteria 1036
277 Ga0157380_10691996 3300014326 Unclassified 1023
278 Ga0157380_11637848 3300014326 Bacteria 700
279 Ga0157377_10006220 3300014745 Bacteria 5679
280 Ga0157377_10018850 3300014745 Bacteria 3594
281 Ga0157377_10234587 3300014745 Unclassified 1181
282 Ga0157379_10010182 3300014968 Bacteria 8192
283 Ga0157379_10024927 3300014968 Bacteria 5308
284 Ga0157379_10243637 3300014968 Bacteria 1631
285 Ga0157379_11101083 3300014968 Unclassified 761
286 Ga0157379_11462522 3300014968 Unclassified 664
287 Ga0157376_10013856 3300014969 Bacteria 6028
288 Ga0157376_10015054 3300014969 Bacteria 5830
289 Ga0157376_10048476 3300014969 Unclassified 3513
290 Ga0157376_10204706 3300014969 Bacteria 1818
291 Ga0157376_10286086 3300014969 Bacteria 1555
292 Ga0157376_10662868 3300014969 Unclassified 1045
293 Ga0157376_10828816 3300014969 Bacteria 939
294 Ga0157376_12229568 3300014969 Bacteria 587
295 Ga0163161_10005063 3300017792 Bacteria 9170
296 Ga0163161_10014013 3300017792 Bacteria 5583
297 Ga0163161_10122435 3300017792 Unclassified 1956
298 Ga0163161_10312703 3300017792 Bacteria 1240
299 Ga0163161_10321372 3300017792 Bacteria 1224
300 Ga0213876_10005170 3300021384 Bacteria 7196
301 Ga0209646_1001253 3300025246 Bacteria 7204
302 Ga0207697_10084991 3300025315 Unclassified 1336
303 Ga0207697_10097237 3300025315 Bacteria 1252
304 Ga0207697_10247516 3300025315 Unclassified 788
305 Ga0207656_10354189 3300025321 Bacteria 733
306 Ga0207642_10014069 3300025899 Unclassified 2940
307 Ga0207642_10150828 3300025899 Bacteria 1237
308 Ga0207680_10030621 3300025903 Bacteria 3038
309 Ga0207680_10882761 3300025903 Bacteria 641
310 Ga0207647_10091729 3300025904 Bacteria 1811
311 Ga0207685_10280607 3300025905 Bacteria 817
312 Ga0207685_10683240 3300025905 Bacteria 557
313 Ga0207699_11482582 3300025906 Bacteria 502
314 Ga0207645_10012201 3300025907 Bacteria 5835
315 Ga0207645_10738825 3300025907 Bacteria 669
316 Ga0207645_11068812 3300025907 Bacteria 545
317 Ga0207705_10694385 3300025909 Bacteria 791
318 Ga0207654_11151464 3300025911 Unclassified 565
319 Ga0207695_10000652 3300025913 Bacteria 68928
320 Ga0207695_10039839 3300025913 Bacteria 5047
321 Ga0207695_10052284 3300025913 Bacteria 4281
322 Ga0207671_10625877 3300025914 Bacteria 857
323 Ga0207671_10801100 3300025914 Bacteria 747
324 Ga0207671_11337081 3300025914 Bacteria 557
325 Ga0207660_10238972 3300025917 Bacteria 1430
326 Ga0207662_10526369 3300025918 Bacteria 816
327 Ga0207662_10653128 3300025918 Bacteria 735
328 Ga0207657_10604953 3300025919 Bacteria 855
329 Ga0207649_10008066 3300025920 Bacteria 5733
330 Ga0207649_10008214 3300025920 Bacteria 5685
331 Ga0207649_10217894 3300025920 Unclassified 1358
332 Ga0207652_10087133 3300025921 Bacteria 2738
333 Ga0207646_10070110 3300025922 Bacteria 3131
334 Ga0207681_10682578 3300025923 Unclassified 853
335 Ga0207681_11220396 3300025923 Bacteria 632
336 Ga0207650_10036621 3300025925 Unclassified 3571
337 Ga0207650_10112695 3300025925 Bacteria 2108
338 Ga0207650_10202952 3300025925 Bacteria 1589
339 Ga0207650_10240856 3300025925 Unclassified 1462
340 Ga0207659_10038040 3300025926 Bacteria 3344
341 Ga0207659_11026536 3300025926 Bacteria 710
342 Ga0207644_10124992 3300025931 Bacteria 1962
343 Ga0207644_10185711 3300025931 Bacteria 1632
344 Ga0207644_10585862 3300025931 Bacteria 925
345 Ga0207644_10617972 3300025931 Bacteria 901
346 Ga0207644_11219179 3300025931 Bacteria 632
347 Ga0207690_10188397 3300025932 Bacteria 1559
348 Ga0207690_10791936 3300025932 Bacteria 783
349 Ga0207706_10006348 3300025933 Bacteria 10983
350 Ga0207706_10026060 3300025933 Bacteria 5235
351 Ga0207706_10058862 3300025933 Bacteria 3384
352 Ga0207706_10161041 3300025933 Bacteria 1972
353 Ga0207706_10945968 3300025933 Viruses 726
354 Ga0207706_11454223 3300025933 Bacteria 561
355 Ga0207686_10288967 3300025934 Unclassified 1213
356 Ga0207670_10283829 3300025936 Bacteria 1291
357 Ga0207670_10468585 3300025936 Bacteria 1018
358 Ga0207670_10679947 3300025936 Bacteria 851
359 Ga0207704_10093672 3300025938 Bacteria 1981
360 Ga0207704_10122907 3300025938 Bacteria 1781
361 Ga0207691_10128377 3300025940 Bacteria 2241
362 Ga0207691_10134508 3300025940 Bacteria 2182
363 Ga0207711_11120815 3300025941 Bacteria 728
364 Ga0207689_10001963 3300025942 Bacteria 19421
365 Ga0207689_10035248 3300025942 Bacteria 4158
366 Ga0207689_10036860 3300025942 Bacteria 4058
367 Ga0207689_10182197 3300025942 Bacteria 1732
368 Ga0207689_10451019 3300025942 Unclassified 1075
369 Ga0207661_10170570 3300025944 Bacteria 1894
370 Ga0207661_10218779 3300025944 Unclassified 1682
371 Ga0207661_10354689 3300025944 Unclassified 1324
372 Ga0207661_10579369 3300025944 Bacteria 1029
373 Ga0207661_10742901 3300025944 Bacteria 903
374 Ga0207679_10154862 3300025945 Bacteria 1870
375 Ga0207679_10178905 3300025945 Bacteria 1753
376 Ga0207679_10317057 3300025945 Unclassified 1349
377 Ga0207679_10440048 3300025945 Unclassified 1154
378 Ga0207679_10483020 3300025945 Bacteria 1103
379 Ga0207679_10675790 3300025945 Bacteria 936
380 Ga0207651_10049302 3300025960 Unclassified 2852
381 Ga0207651_10185487 3300025960 Bacteria 1655
382 Ga0207651_10242315 3300025960 Bacteria 1470
383 Ga0207651_10679508 3300025960 Bacteria 906
384 Ga0207651_10769427 3300025960 Bacteria 852
385 Ga0207651_10904384 3300025960 Unclassified 786
386 Ga0207651_11217672 3300025960 Bacteria 676
387 Ga0207712_10045716 3300025961 Bacteria 3033
388 Ga0207712_10063837 3300025961 Bacteria 2623
389 Ga0207712_10233707 3300025961 Bacteria 1477
390 Ga0207712_10432383 3300025961 Bacteria 1113
391 Ga0207712_11352200 3300025961 Bacteria 637
392 Ga0207668_10377797 3300025972 Bacteria 1192
393 Ga0207640_10261296 3300025981 Unclassified 1349
394 Ga0207640_10939049 3300025981 Bacteria 758
395 Ga0207640_11089850 3300025981 Bacteria 706
396 Ga0207640_11445969 3300025981 Bacteria 617
397 Ga0207640_11447195 3300025981 Bacteria 616
398 Ga0207658_10022993 3300025986 Bacteria 4346
399 Ga0207658_10101460 3300025986 Unclassified 2255
400 Ga0207658_10149505 3300025986 Bacteria 1901
401 Ga0207658_10733405 3300025986 Bacteria 894
402 Ga0207658_10769387 3300025986 Bacteria 873
403 Ga0207658_11446344 3300025986 Bacteria 629
404 Ga0207677_10027002 3300026023 Bacteria 3609
405 Ga0207677_10067255 3300026023 Bacteria 2509
406 Ga0207677_10139324 3300026023 Unclassified 1855
407 Ga0207677_10732966 3300026023 Unclassified 880
408 Ga0207677_11451843 3300026023 Bacteria 633
409 Ga0207703_10173419 3300026035 Unclassified 1899
410 Ga0207703_10605075 3300026035 Bacteria 1037
411 Ga0207639_10006671 3300026041 Bacteria 7851
412 Ga0207639_10190239 3300026041 Bacteria 1753
413 Ga0207639_10194463 3300026041 Bacteria 1735
414 Ga0207639_10414075 3300026041 Bacteria 1217
415 Ga0207639_10770891 3300026041 Bacteria 895
416 Ga0207639_10860314 3300026041 Bacteria 847
417 Ga0207678_10042820 3300026067 Bacteria 3920
418 Ga0207678_10251596 3300026067 Unclassified 1513
419 Ga0207678_11149833 3300026067 Bacteria 687
420 Ga0207641_10195019 3300026088 Unclassified 1864
421 Ga0207641_10522353 3300026088 Bacteria 1155
422 Ga0207641_10810439 3300026088 Bacteria 926
423 Ga0207641_10932998 3300026088 Bacteria 863
424 Ga0207641_11161923 3300026088 Bacteria 771
425 Ga0207648_10021277 3300026089 Bacteria 5830
426 Ga0207648_10037865 3300026089 Bacteria 4246
427 Ga0207648_10292121 3300026089 Bacteria 1460
428 Ga0207648_10358074 3300026089 Bacteria 1316
429 Ga0207648_10540584 3300026089 Bacteria 1069
430 Ga0207676_10059534 3300026095 Bacteria 3017
431 Ga0207676_10069058 3300026095 Bacteria 2828
432 Ga0207676_10081992 3300026095 Bacteria 2622
433 Ga0207676_10223792 3300026095 Bacteria 1677
434 Ga0207676_10544589 3300026095 Bacteria 1108
435 Ga0207676_10823980 3300026095 Bacteria 906
436 Ga0207676_10914152 3300026095 Bacteria 861
437 Ga0207676_11745480 3300026095 Bacteria 621
438 Ga0207674_10019971 3300026116 Bacteria 7250
439 Ga0207674_10478987 3300026116 Bacteria 1203
440 Ga0207674_10676859 3300026116 Bacteria 996
441 Ga0207674_11418789 3300026116 Bacteria 664
442 Ga0207675_100019697 3300026118 Bacteria 6298
443 Ga0207675_100116412 3300026118 Bacteria 2526
444 Ga0207675_100577730 3300026118 Bacteria 1125
445 Ga0207675_101636018 3300026118 Bacteria 664
446 Ga0207683_10026164 3300026121 Bacteria 5036
447 Ga0207683_10254420 3300026121 Bacteria 1603
448 Ga0207683_11114375 3300026121 Bacteria 732
449 Ga0207683_11625860 3300026121 Unclassified 595
450 Ga0207683_11861759 3300026121 Unclassified 551
451 Ga0207698_10170316 3300026142 Bacteria 1916
452 Ga0207698_10282089 3300026142 Bacteria 1537
453 Ga0207698_10306202 3300026142 Bacteria 1481
454 Ga0207698_10345977 3300026142 Bacteria 1402
455 Ga0207698_10440781 3300026142 Unclassified 1255
456 Ga0207698_12110363 3300026142 Bacteria 577
457 Ga0268266_10239761 3300028379 Unclassified 1673
458 Ga0268266_10287279 3300028379 Bacteria 1531
459 Ga0268265_10081707 3300028380 Bacteria 2553
460 Ga0268265_10134420 3300028380 Bacteria 2061
461 Ga0268265_11714168 3300028380 Bacteria 634
462 Ga0268264_10000105 3300028381 Bacteria 212531
463 Ga0268264_10454742 3300028381 Unclassified 1241
464 Ga0268264_10470527 3300028381 Bacteria 1221
465 Ga0307511_10002038 3300030521 Bacteria 21181
466 Ga0307508_10349192 3300031616 Bacteria 1071
467 Ga0307516_10008497 3300031730 Bacteria 11604
468 Ga0307406_10943853 3300031901 Unclassified 737
469 Ga0307409_101758483 3300031995 Bacteria 649
470 Ga0307414_10316808 3300032004 Unclassified 1326
471 Ga0373936_0198895 3300035113 Bacteria 884
472 Ga0373956_0151171 3300035119 Bacteria 1092
473 Ga0373957_0326863 3300035120 Bacteria 653
474 Ga0373943_0070038 3300035170 Bacteria 1774
475 Ga0373943_0150981 3300035170 Unclassified 1259
476 Ga0373942_0307124 3300035207 Unclassified 552
477 Ga0373962_0058063 3300035242 Bacteria 1131
478 Ga0373924_0045762 3300035410 Unclassified 1800
479 Ga0373935_0188704 3300035692 Unclassified 1419
480 Ga0373933_0410862 3300035724 Bacteria 883
481 Ga0373933_0482471 3300035724 Bacteria 812
482 Ga0373947_0367679 3300035725 Unclassified 967
483 Ga0373947_0386521 3300035725 Bacteria 943
484 Ga0373937_0044748 3300036401 Bacteria 4043
485 Ga0373925_1330380 3300037068 Bacteria 589
486 Ga0395900_0838962 3300037418 Unclassified 845
487 Ga0436365_0549952 3300039437 Bacteria 1493
488 Ga0436365_0811521 3300039437 Bacteria 528
489 Ga0451791_0568370 3300041451 Bacteria 566
490 Ga0451800_0805264 3300041459 Bacteria 1115
491 Ga0451800_1008287 3300041459 Bacteria 907
492 Ga0451802_1644605 3300041460 Bacteria 1130
493 Ga0451835_0361914 3300041492 Bacteria 745
494 Ga0451837_0488980 3300041494 Bacteria 1409
495 Ga0451841_0235359 3300041498 Bacteria 1602
496 Ga0451849_0869576 3300041505 Bacteria 579
497 Ga0451853_0997362 3300041512 Bacteria 1526
498 Ga0451577_0123816 3300042876 Unclassified 2317
499 Ga0466972_0000023 3300044658 Bacteria 192679
500 Ga0466972_0026838 3300044658 Bacteria 2853
501 Ga0466972_0181452 3300044658 Bacteria 987
502 Ga0466961_0010198 3300044693 Bacteria 5985
503 Ga0466964_0024070 3300044706 Bacteria 2371
504 Ga0466971_0031573 3300044719 Unclassified 2372
505 Ga0466971_0554365 3300044719 Bacteria 570
506 Ga0466970_0007060 3300044765 Bacteria 5618
507 Ga0466970_0270744 3300044765 Bacteria 954
508 Ga0466957_0000871 3300044842 Bacteria 15502
509 Ga0466957_0006731 3300044842 Bacteria 6496
510 Ga0466957_0069590 3300044842 Bacteria 2174
511 Ga0466959_0004406 3300045049 Bacteria 9424
512 Ga0466958_0127817 3300045836 Bacteria 1594
513 Ga0495592_0130440 3300046454 Unclassified 1759
514 Ga0495638_0089089 3300046460 Bacteria 1862
515 Ga0495653_0136104 3300046463 Bacteria 1733
516 Ga0495580_0605137 3300046472 Bacteria 724
517 Ga0495662_0374775 3300046476 Bacteria 699
518 Ga0495664_0442159 3300046477 Bacteria 779
519 Ga0495618_0143192 3300046514 Bacteria 1529
520 Ga0495628_0008793 3300046516 Bacteria 8643
521 Ga0495630_0026638 3300046517 Bacteria 4282
522 Ga0495652_0365322 3300046529 Bacteria 1030
523 Ga0495587_0054845 3300046536 Bacteria 2348
524 Ga0495621_0407012 3300046539 Bacteria 578
525 Ga0495667_0060277 3300046559 Bacteria 2489
526 Ga0495634_0044252 3300046642 Bacteria 3014
527 Ga0495657_0385665 3300046675 Bacteria 826
528 Ga0495599_0226877 3300046678 Bacteria 1141
529 Ga0495646_0412250 3300046680 Bacteria 701
530 Ga0495647_0357208 3300046681 Bacteria 666
531 Ga0495613_0086312 3300046689 Bacteria 2276
532 Ga0495624_0816116 3300046690 Bacteria 551
533 Ga0495649_0329660 3300046694 Bacteria 774
534 Ga0495649_0532471 3300046694 Unclassified 583
535 Ga0495600_0324402 3300046809 Bacteria 968
536 Ga0495581_0213872 3300047315 Bacteria 1127
537 Ga0495581_0371340 3300047315 Bacteria 835
538 Ga0495674_0170573 3300047319 Bacteria 1816
539 Ga0495672_0016197 3300047320 Bacteria 5036
540 Ga0495684_0147730 3300047471 Bacteria 1759
541 Ga0495686_0018947 3300047472 Bacteria 4606
542 Ga0495686_0138614 3300047472 Bacteria 1437
543 Ga0496100_0552873 3300048903 Bacteria 891
544 Ga0496101_0429596 3300048904 Bacteria 1041
545 Ga0496102_0350299 3300048905 Bacteria 1390
546 Ga0496104_1531776 3300048907 Unclassified 570
547 Ga0496105_0712715 3300048908 Unclassified 769
548 Ga0496106_0101043 3300048909 Bacteria 2237
549 Ga0496108_0835762 3300048911 Unclassified 793
550 Ga0496110_0140189 3300048913 Bacteria 2186
551 Ga0496111_0335233 3300048914 Bacteria 1120
552 Ga0496112_0783000 3300048915 Bacteria 879
553 Ga0501036_1232753 3300049572 Bacteria 609
554 Ga0501037_0374726 3300049573 Bacteria 979
555 Ga0501043_1144251 3300049579 Bacteria 548
556 Ga0501047_0632693 3300049581 Bacteria 890
557 Ga0501070_0887368 3300049586 Bacteria 696
558 Ga0501074_0915649 3300049590 Bacteria 617
559 Ga0501235_203256 3300049669 Bacteria 537
560 Ga0501257_265652 3300049686 Bacteria 513
561 Ga0501225_0011256 3300049705 Bacteria 2519
562 Ga0501080_0462811 3300049742 Bacteria 1136
563 Ga0501080_0718035 3300049742 Unclassified 881
564 Ga0501083_0586370 3300049744 Bacteria 725
565 Ga0501035_0347843 3300049822 Bacteria 1241
566 Ga0501035_0393402 3300049822 Bacteria 1154
567 Ga0501044_0001962 3300049823 Bacteria 23802
568 Ga0501044_0347991 3300049823 Bacteria 1402
569 nmdc:mga0k408_36216_c1 3300050493 Bacteria 2832
570 nmdc:mga07m45_875748_c1 3300050496 Bacteria 514
571 nmdc:mga05p37_334024_c1 3300050507 Bacteria 1789
572 nmdc:mga05p37_7694_c1 3300050507 Bacteria 12715
573 nmdc:mga0rr50_619376_c1 3300050513 Unclassified 923
574 Ga0495619_0279682 3300053085 Bacteria 1156
575 Ga0500578_0064825 3300053086 Bacteria 2330
576 Ga0500644_0092772 3300053088 Bacteria 1133
577 Ga0500646_0025130 3300053090 Bacteria 1607
578 Ga0500646_0163410 3300053090 Bacteria 745
579 Ga0500583_0000042 3300053092 Bacteria 82406
580 Ga0500641_0003073 3300053096 Bacteria 5916
581 Ga0500650_0066958 3300053098 Bacteria 1678
582 Ga0500555_056186 3300053103 Bacteria 1067
583 Ga0500556_0313701 3300053104 Bacteria 612
584 Ga0500572_007573 3300053111 Bacteria 2517
585 Ga0500642_0147696 3300053130 Bacteria 1103
586 Ga0500658_0131877 3300053134 Bacteria 1115
587 Ga0500559_0405561 3300053136 Bacteria 634
588 Ga0500589_081916 3300053147 Bacteria 1439
589 Ga0500622_0194439 3300053156 Bacteria 927
590 Ga0500636_0243865 3300053177 Bacteria 921
591 Ga0500611_000011 3300053727 Bacteria 141259
592 Ga0587076_077762 3300059645 Bacteria 702
593 Ga0466962_0020267 3300061719 Bacteria 3196
594 2738727680 2738541278 Bacteria 9755573
595 Ga0070707_100132304
596 ARcpr5yngRDRAFT_c009477
597 JGI24740J21852_10023673
598 JGI24751J29686_10000860
599 rootH2_10040915
600 rootL2_10127592
601 rootH1_10153594
602 rootH1_10262828
603 rootH1_10324577
604 Ga0065712_10228577
605 Ga0070658_10127863
606 Ga0070658_11276367
607 Ga0070676_10009776
608 Ga0070676_10564951
609 Ga0070683_100014200
610 Ga0070683_100084512
611 Ga0070683_100088439
612 Ga0070683_100165526
613 Ga0070683_100200933
614 Ga0070690_100108731
615 Ga0070670_100036117
616 Ga0070670_100050382
617 Ga0070670_100096804
618 Ga0070670_100130288
619 Ga0070670_100152213
620 Ga0070670_100387808
621 Ga0070670_100769215
622 Ga0070677_10427150
623 Ga0068869_100019682
624 Ga0068869_100047971
625 Ga0068869_100087052
626 Ga0068869_100097262
627 Ga0068869_100509383
628 Ga0070666_10047701
629 Ga0070666_10099503
630 Ga0070666_10706883
631 Ga0070666_11379950
632 Ga0070680_100118515
633 Ga0070682_101033454
634 Ga0070682_101068122
635 Ga0068868_100029175
636 Ga0068868_100043804
637 Ga0068868_100048383
638 Ga0068868_100391942
639 Ga0070660_100978689
640 Ga0070689_100178021
641 Ga0070689_100365736
642 Ga0070689_100578044
643 Ga0070689_100838081
644 Ga0070689_101135567
645 Ga0070687_100083037
646 Ga0070687_101037040
647 Ga0070661_100002884
648 Ga0070661_100191494
649 Ga0070692_10428259
650 Ga0070668_100261609
651 Ga0070669_100244193
652 Ga0070669_100482647
653 Ga0070675_100269767
654 Ga0070675_100656737
655 Ga0070671_100006703
656 Ga0070671_100036141
657 Ga0070671_100726123
658 Ga0070673_100026536
659 Ga0070673_100775715
660 Ga0070673_100990732
661 Ga0070673_101875663
662 Ga0070688_100033192
663 Ga0070688_100411780
664 Ga0070659_100328360
665 Ga0070659_100368340
666 Ga0070667_100007538
667 Ga0070667_100069663
668 Ga0070667_100124536
669 Ga0070667_100436427
670 Ga0070667_100991109
671 Ga0070709_11791934
672 Ga0070663_100557524
673 Ga0070663_101009658
674 Ga0070678_100168048
675 Ga0070678_100223428
676 Ga0070678_101388717
677 Ga0070678_101463028
678 Ga0070678_101709821
679 Ga0070662_100002969
680 Ga0070662_100017545
681 Ga0070662_100190975
682 Ga0070662_100421949
683 Ga0070662_101243336
684 Ga0068867_100082858
685 Ga0068867_100116362
686 Ga0068867_100148048
687 Ga0068867_100305515
688 Ga0068867_101058136
689 Ga0068867_101373034
690 Ga0070685_10117039
691 Ga0070685_10186267
692 Ga0070685_10595880
693 Ga0070679_100127062
694 Ga0070679_100842708
695 Ga0070684_100021116
696 Ga0070684_100073118
697 Ga0070684_100087373
698 Ga0070684_100325187
699 Ga0070684_100440951
700 Ga0070684_100970997
701 Ga0070697_101481929
702 Ga0068853_100033618
703 Ga0068853_100062008
704 Ga0068853_100767113
705 Ga0068853_100997648
706 Ga0068853_101113050
707 Ga0070686_100013237
708 Ga0070686_100086018
709 Ga0070686_100327514
710 Ga0070686_100956827
711 Ga0070686_101512177
712 Ga0070693_100984371
713 Ga0070665_100110981
714 Ga0070704_101154009
715 Ga0068855_100596212
716 Ga0068855_101232266
717 Ga0068855_101549938
718 Ga0070664_100017898
719 Ga0070664_100139591
720 Ga0070664_100183979
721 Ga0070664_100205180
722 Ga0068857_100051756
723 Ga0068857_100067498
724 Ga0068857_100145841
725 Ga0068854_100764919
726 Ga0068854_100858792
727 Ga0068854_101690295
728 Ga0068854_102194662
729 Ga0070702_100061490
730 Ga0070702_100656749
731 Ga0068852_100005802
732 Ga0068852_100152702
733 Ga0068852_100178051
734 Ga0068852_100762610
735 Ga0068852_101070036
736 Ga0068852_101176868
737 Ga0068852_101276425
738 Ga0068852_101867271
739 Ga0068852_102423732
740 Ga0068859_100107438
741 Ga0068859_100120320
742 Ga0068859_100404006
743 Ga0068859_101034146
744 Ga0068859_101470451
745 Ga0068864_100004334
746 Ga0068864_100077479
747 Ga0068864_100084084
748 Ga0068864_100092355
749 Ga0068864_100560813
750 Ga0068864_100647685
751 Ga0068864_100789569
752 Ga0068864_100935893
753 Ga0068866_10007246
754 Ga0068866_10180936
755 Ga0068861_100284270
756 Ga0068861_101800352
757 Ga0068870_10144439
758 Ga0068863_100183017
759 Ga0068863_100318867
760 Ga0068863_101052571
761 Ga0068863_101207069
762 Ga0068863_101229184
763 Ga0068858_102161390
764 Ga0068858_102524808
765 Ga0068860_100000078
766 Ga0068860_100079618
767 Ga0068860_100188454
768 Ga0068860_101432128
769 Ga0068860_101980129
770 Ga0068862_100321232
771 Ga0068862_100597740
772 Ga0068862_100744978
773 Ga0081539_10022531
774 Ga0070715_10050848
775 Ga0070715_10917333
776 Ga0075366_10057800
777 Ga0075366_10099336
778 Ga0097621_100000966
779 Ga0097621_100095202
780 Ga0097621_100338914
781 Ga0097621_101166719
782 Ga0068871_100025073
783 Ga0068871_100027191
784 Ga0068871_100227777
785 Ga0068871_100369199
786 Ga0068871_100463981
787 Ga0068871_101547021
788 Ga0068865_100051242
789 Ga0068865_100301815
790 Ga0068865_100554878
791 Ga0097620_100107436
792 Ga0097620_100120322
793 Ga0097620_100404010
794 Ga0097620_101034105
795 Ga0097620_101470632
796 Ga0075435_100574234
797 Ga0105251_10103642
798 Ga0105240_10038996
799 Ga0105240_10071507
800 Ga0105240_10577636
801 Ga0114129_10499564
802 Ga0105243_11306127
803 Ga0105243_11523136
804 Ga0105241_10362978
805 Ga0105241_11195789
806 Ga0105241_11851372
807 Ga0105242_10125658
808 Ga0105242_10886887
809 Ga0105242_11981575
810 Ga0105248_10101978
811 Ga0105237_10008755
812 Ga0105237_11032121
813 Ga0105237_11113500
814 Ga0105238_10806482
815 Ga0105249_10001952
816 Ga0105249_10023245
817 Ga0105249_10034838
818 Ga0105249_10241984
819 Ga0105249_10344272
820 Ga0105249_10400890
821 Ga0105249_10438101
822 Ga0105239_10000852
823 Ga0105239_10012171
824 Ga0105239_10021864
825 Ga0105239_10023373
826 Ga0105239_12273740
827 Ga0105239_12660694
828 Ga0105246_10995907
829 Ga0157338_1063659
830 Ga0157373_10039087
831 Ga0157373_10040794
832 Ga0157371_10195405
833 Ga0157371_11022848
834 Ga0157369_10494350
835 Ga0157374_10003213
836 Ga0157374_10069020
837 Ga0157374_10290214
838 Ga0157374_10433224
839 Ga0157374_11071619
840 Ga0157374_11617772
841 Ga0157378_10040174
842 Ga0157378_10079169
843 Ga0157378_10245618
844 Ga0157378_10318685
845 Ga0163162_10001515
846 Ga0163162_10003365
847 Ga0163162_10008531
848 Ga0163162_10019481
849 Ga0163162_10039079
850 Ga0163162_10039133
851 Ga0163162_11692390
852 Ga0157372_10042629
853 Ga0157372_10052350
854 Ga0157372_10589034
855 Ga0157372_10630165
856 Ga0157372_11255386
857 Ga0157372_12119046
858 Ga0157375_10004609
859 Ga0157375_10053960
860 Ga0157375_10059347
861 Ga0157375_10098391
862 Ga0157375_10127818
863 Ga0157375_10561933
864 Ga0157375_11712958
865 Ga0163163_10000399
866 Ga0163163_10001564
867 Ga0163163_10111368
868 Ga0163163_10170426
869 Ga0163163_10376819
870 Ga0157380_10671992
871 Ga0157380_10691996
872 Ga0157380_11637848
873 Ga0157377_10006220
874 Ga0157377_10018850
875 Ga0157377_10234587
876 Ga0157379_10010182
877 Ga0157379_10024927
878 Ga0157379_10243637
879 Ga0157379_11101083
880 Ga0157379_11462522
881 Ga0157376_10013856
882 Ga0157376_10015054
883 Ga0157376_10048476
884 Ga0157376_10204706
885 Ga0157376_10286086
886 Ga0157376_10662868
887 Ga0157376_10828816
888 Ga0157376_12229568
889 Ga0163161_10005063
890 Ga0163161_10014013
891 Ga0163161_10122435
892 Ga0163161_10312703
893 Ga0163161_10321372
894 Ga0213876_10005170
895 Ga0209646_1001253
896 Ga0207697_10084991
897 Ga0207697_10097237
898 Ga0207697_10247516
899 Ga0207656_10354189
900 Ga0207642_10014069
901 Ga0207642_10150828
902 Ga0207680_10030621
903 Ga0207680_10882761
904 Ga0207647_10091729
905 Ga0207685_10280607
906 Ga0207685_10683240
907 Ga0207699_11482582
908 Ga0207645_10012201
909 Ga0207645_10738825
910 Ga0207645_11068812
911 Ga0207705_10694385
912 Ga0207654_11151464
913 Ga0207695_10000652
914 Ga0207695_10039839
915 Ga0207695_10052284
916 Ga0207671_10625877
917 Ga0207671_10801100
918 Ga0207671_11337081
919 Ga0207660_10238972
920 Ga0207662_10526369
921 Ga0207662_10653128
922 Ga0207657_10604953
923 Ga0207649_10008066
924 Ga0207649_10008214
925 Ga0207649_10217894
926 Ga0207652_10087133
927 Ga0207646_10070110
928 Ga0207681_10682578
929 Ga0207681_11220396
930 Ga0207650_10036621
931 Ga0207650_10112695
932 Ga0207650_10202952
933 Ga0207650_10240856
934 Ga0207659_10038040
935 Ga0207659_11026536
936 Ga0207644_10124992
937 Ga0207644_10185711
938 Ga0207644_10585862
939 Ga0207644_10617972
940 Ga0207644_11219179
941 Ga0207690_10188397
942 Ga0207690_10791936
943 Ga0207706_10006348
944 Ga0207706_10026060
945 Ga0207706_10058862
946 Ga0207706_10161041
947 Ga0207706_10945968
948 Ga0207706_11454223
949 Ga0207686_10288967
950 Ga0207670_10283829
951 Ga0207670_10468585
952 Ga0207670_10679947
953 Ga0207704_10093672
954 Ga0207704_10122907
955 Ga0207691_10128377
956 Ga0207691_10134508
957 Ga0207711_11120815
958 Ga0207689_10001963
959 Ga0207689_10035248
960 Ga0207689_10036860
961 Ga0207689_10182197
962 Ga0207689_10451019
963 Ga0207661_10170570
964 Ga0207661_10218779
965 Ga0207661_10354689
966 Ga0207661_10579369
967 Ga0207661_10742901
968 Ga0207679_10154862
969 Ga0207679_10178905
970 Ga0207679_10317057
971 Ga0207679_10440048
972 Ga0207679_10483020
973 Ga0207679_10675790
974 Ga0207651_10049302
975 Ga0207651_10185487
976 Ga0207651_10242315
977 Ga0207651_10679508
978 Ga0207651_10769427
979 Ga0207651_10904384
980 Ga0207651_11217672
981 Ga0207712_10045716
982 Ga0207712_10063837
983 Ga0207712_10233707
984 Ga0207712_10432383
985 Ga0207712_11352200
986 Ga0207668_10377797
987 Ga0207640_10261296
988 Ga0207640_10939049
989 Ga0207640_11089850
990 Ga0207640_11445969
991 Ga0207640_11447195
992 Ga0207658_10022993
993 Ga0207658_10101460
994 Ga0207658_10149505
995 Ga0207658_10733405
996 Ga0207658_10769387
997 Ga0207658_11446344
998 Ga0207677_10027002
999 Ga0207677_10067255
1000 Ga0207677_10139324
1001 Ga0207677_10732966
1002 Ga0207677_11451843
1003 Ga0207703_10173419
1004 Ga0207703_10605075
1005 Ga0207639_10006671
1006 Ga0207639_10190239
1007 Ga0207639_10194463
1008 Ga0207639_10414075
1009 Ga0207639_10770891
1010 Ga0207639_10860314
1011 Ga0207678_10042820
1012 Ga0207678_10251596
1013 Ga0207678_11149833
1014 Ga0207641_10195019
1015 Ga0207641_10522353
1016 Ga0207641_10810439
1017 Ga0207641_10932998
1018 Ga0207641_11161923
1019 Ga0207648_10021277
1020 Ga0207648_10037865
1021 Ga0207648_10292121
1022 Ga0207648_10358074
1023 Ga0207648_10540584
1024 Ga0207676_10059534
1025 Ga0207676_10069058
1026 Ga0207676_10081992
1027 Ga0207676_10223792
1028 Ga0207676_10544589
1029 Ga0207676_10823980
1030 Ga0207676_10914152
1031 Ga0207676_11745480
1032 Ga0207674_10019971
1033 Ga0207674_10478987
1034 Ga0207674_10676859
1035 Ga0207674_11418789
1036 Ga0207675_100019697
1037 Ga0207675_100116412
1038 Ga0207675_100577730
1039 Ga0207675_101636018
1040 Ga0207683_10026164
1041 Ga0207683_10254420
1042 Ga0207683_11114375
1043 Ga0207683_11625860
1044 Ga0207683_11861759
1045 Ga0207698_10170316
1046 Ga0207698_10282089
1047 Ga0207698_10306202
1048 Ga0207698_10345977
1049 Ga0207698_10440781
1050 Ga0207698_12110363
1051 Ga0268266_10239761
1052 Ga0268266_10287279
1053 Ga0268265_10081707
1054 Ga0268265_10134420
1055 Ga0268265_11714168
1056 Ga0268264_10000105
1057 Ga0268264_10454742
1058 Ga0268264_10470527
1059 Ga0307511_10002038
1060 Ga0307508_10349192
1061 Ga0307516_10008497
1062 Ga0307406_10943853
1063 Ga0307409_101758483
1064 Ga0307414_10316808
1065 Ga0373936_0198895
1066 Ga0373956_0151171
1067 Ga0373957_0326863
1068 Ga0373943_0070038
1069 Ga0373943_0150981
1070 Ga0373942_0307124
1071 Ga0373962_0058063
1072 Ga0373924_0045762
1073 Ga0373935_0188704
1074 Ga0373933_0410862
1075 Ga0373933_0482471
1076 Ga0373947_0367679
1077 Ga0373947_0386521
1078 Ga0373937_0044748
1079 Ga0373925_1330380
1080 Ga0395900_0838962
1081 Ga0436365_0549952
1082 Ga0436365_0811521
1083 Ga0451791_0568370
1084 Ga0451800_0805264
1085 Ga0451800_1008287
1086 Ga0451802_1644605
1087 Ga0451835_0361914
1088 Ga0451837_0488980
1089 Ga0451841_0235359
1090 Ga0451849_0869576
1091 Ga0451853_0997362
1092 Ga0451577_0123816
1093 Ga0466972_0000023
1094 Ga0466972_0026838
1095 Ga0466972_0181452
1096 Ga0466961_0010198
1097 Ga0466964_0024070
1098 Ga0466971_0031573
1099 Ga0466971_0554365
1100 Ga0466970_0007060
1101 Ga0466970_0270744
1102 Ga0466957_0000871
1103 Ga0466957_0006731
1104 Ga0466957_0069590
1105 Ga0466959_0004406
1106 Ga0466958_0127817
1107 Ga0495592_0130440
1108 Ga0495638_0089089
1109 Ga0495653_0136104
1110 Ga0495580_0605137
1111 Ga0495662_0374775
1112 Ga0495664_0442159
1113 Ga0495618_0143192
1114 Ga0495628_0008793
1115 Ga0495630_0026638
1116 Ga0495652_0365322
1117 Ga0495587_0054845
1118 Ga0495621_0407012
1119 Ga0495667_0060277
1120 Ga0495634_0044252
1121 Ga0495657_0385665
1122 Ga0495599_0226877
1123 Ga0495646_0412250
1124 Ga0495647_0357208
1125 Ga0495613_0086312
1126 Ga0495624_0816116
1127 Ga0495649_0329660
1128 Ga0495649_0532471
1129 Ga0495600_0324402
1130 Ga0495581_0213872
1131 Ga0495581_0371340
1132 Ga0495674_0170573
1133 Ga0495672_0016197
1134 Ga0495684_0147730
1135 Ga0495686_0018947
1136 Ga0495686_0138614
1137 Ga0496100_0552873
1138 Ga0496101_0429596
1139 Ga0496102_0350299
1140 Ga0496104_1531776
1141 Ga0496105_0712715
1142 Ga0496106_0101043
1143 Ga0496108_0835762
1144 Ga0496110_0140189
1145 Ga0496111_0335233
1146 Ga0496112_0783000
1147 Ga0501036_1232753
1148 Ga0501037_0374726
1149 Ga0501043_1144251
1150 Ga0501047_0632693
1151 Ga0501070_0887368
1152 Ga0501074_0915649
1153 Ga0501235_203256
1154 Ga0501257_265652
1155 Ga0501225_0011256
1156 Ga0501080_0462811
1157 Ga0501080_0718035
1158 Ga0501083_0586370
1159 Ga0501035_0347843
1160 Ga0501035_0393402
1161 Ga0501044_0001962
1162 Ga0501044_0347991
1163 nmdc:mga0k408_36216_c1
1164 nmdc:mga07m45_875748_c1
1165 nmdc:mga05p37_334024_c1
1166 nmdc:mga05p37_7694_c1
1167 nmdc:mga0rr50_619376_c1
1168 Ga0495619_0279682
1169 Ga0500578_0064825
1170 Ga0500644_0092772
1171 Ga0500646_0025130
1172 Ga0500646_0163410
1173 Ga0500583_0000042
1174 Ga0500641_0003073
1175 Ga0500650_0066958
1176 Ga0500555_056186
1177 Ga0500556_0313701
1178 Ga0500572_007573
1179 Ga0500642_0147696
1180 Ga0500658_0131877
1181 Ga0500559_0405561
1182 Ga0500589_081916
1183 Ga0500622_0194439
1184 Ga0500636_0243865
1185 Ga0500611_000011
1186 Ga0587076_077762
1187 Ga0466962_0020267
1188 2738727680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02699

YajC

Preprotein translocase subunit

21

94

0.9

Map