F467194
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 313 | 578 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100064034|Ga0070663_1000640343 |
| Length | 283 |
| Sequence | MNIFASVGRLFLLFLAEXXXXTRFTVSAVSSIVRPPVYWRLLLQQIMRIGWFSLPVVGLTAFFTGGALALQIFIGGNRYGAEAIVPQIVVLGITRELGPVIAGLMVAGRVAAAIAAEIGTMRVTEQIDALTTLSTNPVKYLVVPRLIAAVLTMPILVAIADSIGVFGGYIVATKSLGFNGAVYLKNTADFVTSHDVMSGLVKAAVFGFVIALMGCYSGFNSKGGAQGVGRATTNAVVSCRSSFSPPTIFSPRSCSRARPWTPRSNCRASRNGSARRSCWTASI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 2 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 5 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 6 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 7 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 8 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 9 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 10 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 11 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 12 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 13 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 14 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 15 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 189 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 190 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 191 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 235 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 236 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 237 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 238 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 239 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 240 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 241 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 282 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 283 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 285 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 286 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 287 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 288 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 289 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 290 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 291 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 292 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 293 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 294 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 295 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 296 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 299 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 303 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 306 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 308 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 310 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.47 |
| Metatranscriptomes | 0 |
| Isolates | 2.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.61 |
| Nodule | 0 |
| Rhizoplane | 1.18 |
| Rhizosphere | 81.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10003190 | 3300001989 | Bacteria | 6254 |
| 2 | JGI24739J22299_10038795 | 3300001989 | Bacteria | 1599 |
| 3 | rootH2_10058962 | 3300003320 | Bacteria | 2975 |
| 4 | rootH2_10093856 | 3300003320 | Bacteria | 4620 |
| 5 | rootL2_10021435 | 3300003322 | Bacteria | 6513 |
| 6 | Ga0055536_1003093 | 3300003781 | Bacteria | 9056 |
| 7 | Ga0055536_1003367 | 3300003781 | Bacteria | 8625 |
| 8 | Ga0055530_10002805 | 3300003791 | Bacteria | 10721 |
| 9 | Ga0055531_10000644 | 3300003794 | Bacteria | 30161 |
| 10 | Ga0065165_1000499 | 3300005262 | Bacteria | 60740 |
| 11 | Ga0065715_10097850 | 3300005293 | Bacteria | 3641 |
| 12 | Ga0065707_10082679 | 3300005295 | Bacteria | 12785 |
| 13 | Ga0065707_10086182 | 3300005295 | Bacteria | 5613 |
| 14 | Ga0070658_10081439 | 3300005327 | Bacteria | 2659 |
| 15 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 16 | Ga0070670_100000528 | 3300005331 | Bacteria | 30641 |
| 17 | Ga0070670_100080899 | 3300005331 | Bacteria | 2792 |
| 18 | Ga0070670_100402300 | 3300005331 | Bacteria | 1209 |
| 19 | Ga0070666_10009592 | 3300005335 | Bacteria | 6042 |
| 20 | Ga0070666_10179141 | 3300005335 | Bacteria | 1486 |
| 21 | Ga0070680_100000201 | 3300005336 | Bacteria | 38933 |
| 22 | Ga0070680_100116041 | 3300005336 | Bacteria | 2231 |
| 23 | Ga0070660_100043403 | 3300005339 | Bacteria | 3436 |
| 24 | Ga0070691_10019410 | 3300005341 | Bacteria | 3137 |
| 25 | Ga0070661_100011657 | 3300005344 | Bacteria | 6130 |
| 26 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 27 | Ga0070668_100166645 | 3300005347 | Bacteria | 1791 |
| 28 | Ga0070669_100000195 | 3300005353 | Bacteria | 53791 |
| 29 | Ga0070671_100000388 | 3300005355 | Bacteria | 30256 |
| 30 | Ga0070673_100168747 | 3300005364 | Bacteria | 1866 |
| 31 | Ga0070659_100014668 | 3300005366 | Bacteria | 5859 |
| 32 | Ga0070659_100069377 | 3300005366 | Bacteria | 2798 |
| 33 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 34 | Ga0070667_100001850 | 3300005367 | Bacteria | 18783 |
| 35 | Ga0070709_10042688 | 3300005434 | Bacteria | 2802 |
| 36 | Ga0070714_100090017 | 3300005435 | Bacteria | 2687 |
| 37 | Ga0070714_100143203 | 3300005435 | Bacteria | 2148 |
| 38 | Ga0070714_100351234 | 3300005435 | Bacteria | 1385 |
| 39 | Ga0070713_100000003 | 3300005436 | Bacteria | 245840 |
| 40 | Ga0070713_100270279 | 3300005436 | Unclassified | 1556 |
| 41 | Ga0070711_100042521 | 3300005439 | Bacteria | 3072 |
| 42 | Ga0070711_100459064 | 3300005439 | Bacteria | 1044 |
| 43 | Ga0070708_100158845 | 3300005445 | Bacteria | 2106 |
| 44 | Ga0070663_100064034 | 3300005455 | Bacteria | 2657 |
| 45 | Ga0070678_100060101 | 3300005456 | Bacteria | 2796 |
| 46 | Ga0070681_10000005 | 3300005458 | Bacteria | 183053 |
| 47 | Ga0070681_10561538 | 3300005458 | Bacteria | 1055 |
| 48 | Ga0070681_10701798 | 3300005458 | Bacteria | 927 |
| 49 | Ga0070707_100010180 | 3300005468 | Bacteria | 8753 |
| 50 | Ga0070698_100055153 | 3300005471 | Bacteria | 4032 |
| 51 | Ga0070679_100000293 | 3300005530 | Bacteria | 42433 |
| 52 | Ga0070679_100295020 | 3300005530 | Bacteria | 1572 |
| 53 | Ga0070684_100751794 | 3300005535 | Bacteria | 910 |
| 54 | Ga0068853_100007775 | 3300005539 | Bacteria | 8597 |
| 55 | Ga0068853_100011500 | 3300005539 | Bacteria | 7195 |
| 56 | Ga0068853_100118929 | 3300005539 | Bacteria | 2355 |
| 57 | Ga0070693_100004688 | 3300005547 | Bacteria | 6495 |
| 58 | Ga0070665_100288687 | 3300005548 | Bacteria | 1643 |
| 59 | Ga0070665_100717359 | 3300005548 | Bacteria | 1013 |
| 60 | Ga0068855_100000063 | 3300005563 | Bacteria | 131058 |
| 61 | Ga0068855_100029600 | 3300005563 | Bacteria | 6545 |
| 62 | Ga0068855_100139809 | 3300005563 | Bacteria | 2761 |
| 63 | Ga0068855_100510747 | 3300005563 | Bacteria | 1305 |
| 64 | Ga0070664_100094763 | 3300005564 | Bacteria | 2589 |
| 65 | Ga0068857_100003278 | 3300005577 | Bacteria | 13448 |
| 66 | Ga0068857_100021236 | 3300005577 | Bacteria | 5713 |
| 67 | Ga0068857_100142709 | 3300005577 | Bacteria | 2165 |
| 68 | Ga0068857_100368811 | 3300005577 | Bacteria | 1332 |
| 69 | Ga0068854_100112409 | 3300005578 | Bacteria | 2056 |
| 70 | Ga0068854_100235853 | 3300005578 | Bacteria | 1454 |
| 71 | Ga0068854_100242838 | 3300005578 | Bacteria | 1435 |
| 72 | Ga0068856_100001293 | 3300005614 | Bacteria | 26357 |
| 73 | Ga0068856_100001833 | 3300005614 | Bacteria | 22244 |
| 74 | Ga0068856_101030720 | 3300005614 | Bacteria | 841 |
| 75 | Ga0068852_100017052 | 3300005616 | Bacteria | 5688 |
| 76 | Ga0068852_100099572 | 3300005616 | Bacteria | 2620 |
| 77 | Ga0068852_100152567 | 3300005616 | Bacteria | 2150 |
| 78 | Ga0068852_100317212 | 3300005616 | Bacteria | 1513 |
| 79 | Ga0068859_100010247 | 3300005617 | Bacteria | 9433 |
| 80 | Ga0068859_100034906 | 3300005617 | Bacteria | 5046 |
| 81 | Ga0068864_100000011 | 3300005618 | Bacteria | 350056 |
| 82 | Ga0068864_100013485 | 3300005618 | Bacteria | 6776 |
| 83 | Ga0068864_100028365 | 3300005618 | Bacteria | 4730 |
| 84 | Ga0068864_100793852 | 3300005618 | Bacteria | 930 |
| 85 | Ga0068861_100034416 | 3300005719 | Bacteria | 3746 |
| 86 | Ga0068863_100022726 | 3300005841 | Bacteria | 5990 |
| 87 | Ga0068863_100053251 | 3300005841 | Bacteria | 3835 |
| 88 | Ga0068863_100199127 | 3300005841 | Bacteria | 1926 |
| 89 | Ga0068858_100007133 | 3300005842 | Bacteria | 10854 |
| 90 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 91 | Ga0068862_100000011 | 3300005844 | Bacteria | 270105 |
| 92 | Ga0068862_100000989 | 3300005844 | Bacteria | 27179 |
| 93 | Ga0068862_100249580 | 3300005844 | Bacteria | 1617 |
| 94 | Ga0070716_100072663 | 3300006173 | Bacteria | 2026 |
| 95 | Ga0070712_100000494 | 3300006175 | Bacteria | 22527 |
| 96 | Ga0070712_100002914 | 3300006175 | Bacteria | 10604 |
| 97 | Ga0070712_100204858 | 3300006175 | Bacteria | 1552 |
| 98 | Ga0075366_10014001 | 3300006195 | Bacteria | 4574 |
| 99 | Ga0075366_10049220 | 3300006195 | Bacteria | 2501 |
| 100 | Ga0097621_100210886 | 3300006237 | Bacteria | 1690 |
| 101 | Ga0068871_100131164 | 3300006358 | Bacteria | 2125 |
| 102 | Ga0075430_100303448 | 3300006846 | Bacteria | 1321 |
| 103 | Ga0075434_100233773 | 3300006871 | Bacteria | 1858 |
| 104 | Ga0075436_100000023 | 3300006914 | Bacteria | 116796 |
| 105 | Ga0075436_100035481 | 3300006914 | Bacteria | 3440 |
| 106 | Ga0075436_100170471 | 3300006914 | Bacteria | 1537 |
| 107 | Ga0097620_100010246 | 3300006931 | Bacteria | 9433 |
| 108 | Ga0097620_100034906 | 3300006931 | Bacteria | 5046 |
| 109 | Ga0097620_100118248 | 3300006931 | Bacteria | 2716 |
| 110 | Ga0075435_100028059 | 3300007076 | Bacteria | 4412 |
| 111 | Ga0105240_10001135 | 3300009093 | Bacteria | 46650 |
| 112 | Ga0105240_10007836 | 3300009093 | Bacteria | 15413 |
| 113 | Ga0105240_10015791 | 3300009093 | Bacteria | 10245 |
| 114 | Ga0105240_10016423 | 3300009093 | Bacteria | 10022 |
| 115 | Ga0105240_10030255 | 3300009093 | Bacteria | 7038 |
| 116 | Ga0105240_10333539 | 3300009093 | Bacteria | 1725 |
| 117 | Ga0105240_10567118 | 3300009093 | Bacteria | 1254 |
| 118 | Ga0111539_10062518 | 3300009094 | Bacteria | 4407 |
| 119 | Ga0105245_10785887 | 3300009098 | Bacteria | 989 |
| 120 | Ga0105247_10055927 | 3300009101 | Bacteria | 2436 |
| 121 | Ga0105247_10166255 | 3300009101 | Bacteria | 1464 |
| 122 | Ga0105241_10049668 | 3300009174 | Bacteria | 3195 |
| 123 | Ga0105241_10184456 | 3300009174 | Bacteria | 1733 |
| 124 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 125 | Ga0105248_10000069 | 3300009177 | Bacteria | 120989 |
| 126 | Ga0105248_10025033 | 3300009177 | Bacteria | 6635 |
| 127 | Ga0105248_10064572 | 3300009177 | Bacteria | 4109 |
| 128 | Ga0105248_10086327 | 3300009177 | Bacteria | 3531 |
| 129 | Ga0105248_10245859 | 3300009177 | Bacteria | 2014 |
| 130 | Ga0105237_10005796 | 3300009545 | Bacteria | 13860 |
| 131 | Ga0105237_10018738 | 3300009545 | Bacteria | 7157 |
| 132 | Ga0105237_10139699 | 3300009545 | Bacteria | 2416 |
| 133 | Ga0105237_10482958 | 3300009545 | Bacteria | 1245 |
| 134 | Ga0105238_10005700 | 3300009551 | Bacteria | 12311 |
| 135 | Ga0105238_10010958 | 3300009551 | Bacteria | 9118 |
| 136 | Ga0105238_10038976 | 3300009551 | Bacteria | 4822 |
| 137 | Ga0105238_10134932 | 3300009551 | Bacteria | 2446 |
| 138 | Ga0105239_10000513 | 3300010375 | Bacteria | 55836 |
| 139 | Ga0105239_10000694 | 3300010375 | Bacteria | 47928 |
| 140 | Ga0105239_10117421 | 3300010375 | Bacteria | 2952 |
| 141 | Ga0105239_10175291 | 3300010375 | Bacteria | 2398 |
| 142 | Ga0105239_10305171 | 3300010375 | Bacteria | 1793 |
| 143 | Ga0105239_11035247 | 3300010375 | Bacteria | 944 |
| 144 | Ga0157326_1000424 | 3300012513 | Bacteria | 5015 |
| 145 | Ga0157373_10004385 | 3300013100 | Bacteria | 10638 |
| 146 | Ga0157370_10004544 | 3300013104 | Bacteria | 15891 |
| 147 | Ga0157370_10132969 | 3300013104 | Bacteria | 2320 |
| 148 | Ga0157369_10005962 | 3300013105 | Bacteria | 14151 |
| 149 | Ga0157369_10066992 | 3300013105 | Bacteria | 3862 |
| 150 | Ga0157374_10082693 | 3300013296 | Bacteria | 3049 |
| 151 | Ga0157374_10312794 | 3300013296 | Bacteria | 1555 |
| 152 | Ga0157378_10122125 | 3300013297 | Bacteria | 2402 |
| 153 | Ga0157378_10138420 | 3300013297 | Bacteria | 2259 |
| 154 | Ga0163162_10481030 | 3300013306 | Bacteria | 1373 |
| 155 | Ga0157372_10045612 | 3300013307 | Bacteria | 4864 |
| 156 | Ga0157372_10048189 | 3300013307 | Bacteria | 4736 |
| 157 | Ga0157372_10052770 | 3300013307 | Bacteria | 4529 |
| 158 | Ga0157372_10062892 | 3300013307 | Bacteria | 4159 |
| 159 | Ga0157375_10046901 | 3300013308 | Bacteria | 4216 |
| 160 | Ga0163163_10059627 | 3300014325 | Bacteria | 3776 |
| 161 | Ga0163163_10095807 | 3300014325 | Bacteria | 2988 |
| 162 | Ga0157380_10003531 | 3300014326 | Bacteria | 10746 |
| 163 | Ga0157379_10001171 | 3300014968 | Bacteria | 21362 |
| 164 | Ga0157379_10002326 | 3300014968 | Bacteria | 15840 |
| 165 | Ga0157379_10030165 | 3300014968 | Bacteria | 4824 |
| 166 | Ga0157379_10076482 | 3300014968 | Bacteria | 2997 |
| 167 | Ga0157379_10267690 | 3300014968 | Bacteria | 1553 |
| 168 | Ga0157379_10268329 | 3300014968 | Bacteria | 1552 |
| 169 | Ga0163161_10393420 | 3300017792 | Bacteria | 1110 |
| 170 | Ga0213876_10000469 | 3300021384 | Bacteria | 32156 |
| 171 | Ga0213876_10000586 | 3300021384 | Bacteria | 27090 |
| 172 | Ga0213876_10026209 | 3300021384 | Bacteria | 3075 |
| 173 | Ga0209676_1000272 | 3300025292 | Bacteria | 107765 |
| 174 | Ga0209676_1000899 | 3300025292 | Bacteria | 37563 |
| 175 | Ga0209564_1002018 | 3300025295 | Bacteria | 17672 |
| 176 | Ga0209564_1029307 | 3300025295 | Bacteria | 1735 |
| 177 | Ga0209758_1004244 | 3300025297 | Bacteria | 12126 |
| 178 | Ga0209050_1000344 | 3300025298 | Bacteria | 92033 |
| 179 | Ga0209050_1002568 | 3300025298 | Bacteria | 15109 |
| 180 | Ga0209256_1000666 | 3300025299 | Bacteria | 46480 |
| 181 | Ga0209256_1010423 | 3300025299 | Bacteria | 3895 |
| 182 | Ga0209051_1000743 | 3300025303 | Bacteria | 35022 |
| 183 | Ga0209257_1000066 | 3300025304 | Bacteria | 344166 |
| 184 | Ga0209257_1000624 | 3300025304 | Bacteria | 56974 |
| 185 | Ga0209257_1020404 | 3300025304 | Bacteria | 2451 |
| 186 | Ga0207680_10001384 | 3300025903 | Bacteria | 11457 |
| 187 | Ga0207680_10136334 | 3300025903 | Bacteria | 1623 |
| 188 | Ga0207699_10000126 | 3300025906 | Bacteria | 53299 |
| 189 | Ga0207705_10000263 | 3300025909 | Bacteria | 50599 |
| 190 | Ga0207654_10319422 | 3300025911 | Bacteria | 1061 |
| 191 | Ga0207707_10000005 | 3300025912 | Bacteria | 382024 |
| 192 | Ga0207707_10028347 | 3300025912 | Bacteria | 4894 |
| 193 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 194 | Ga0207695_10002114 | 3300025913 | Bacteria | 30152 |
| 195 | Ga0207695_10025853 | 3300025913 | Bacteria | 6561 |
| 196 | Ga0207695_10028954 | 3300025913 | Bacteria | 6130 |
| 197 | Ga0207695_10139002 | 3300025913 | Bacteria | 2380 |
| 198 | Ga0207695_10144956 | 3300025913 | Bacteria | 2320 |
| 199 | Ga0207695_10266654 | 3300025913 | Bacteria | 1609 |
| 200 | Ga0207671_10004851 | 3300025914 | Bacteria | 12657 |
| 201 | Ga0207671_10012710 | 3300025914 | Bacteria | 6753 |
| 202 | Ga0207671_10411789 | 3300025914 | Bacteria | 1075 |
| 203 | Ga0207693_10000295 | 3300025915 | Bacteria | 46423 |
| 204 | Ga0207693_10002754 | 3300025915 | Bacteria | 15224 |
| 205 | Ga0207693_10309015 | 3300025915 | Bacteria | 1238 |
| 206 | Ga0207663_10345474 | 3300025916 | Bacteria | 1125 |
| 207 | Ga0207663_10394660 | 3300025916 | Bacteria | 1057 |
| 208 | Ga0207660_10004821 | 3300025917 | Bacteria | 8779 |
| 209 | Ga0207660_10005434 | 3300025917 | Bacteria | 8269 |
| 210 | Ga0207657_10000114 | 3300025919 | Bacteria | 79120 |
| 211 | Ga0207649_10009157 | 3300025920 | Bacteria | 5414 |
| 212 | Ga0207652_10000320 | 3300025921 | Bacteria | 49730 |
| 213 | Ga0207652_10005507 | 3300025921 | Bacteria | 10269 |
| 214 | Ga0207646_10029610 | 3300025922 | Bacteria | 4972 |
| 215 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 216 | Ga0207681_10016173 | 3300025923 | Bacteria | 4661 |
| 217 | Ga0207694_10000005 | 3300025924 | Bacteria | 823704 |
| 218 | Ga0207694_10028078 | 3300025924 | Bacteria | 4289 |
| 219 | Ga0207694_10047323 | 3300025924 | Bacteria | 3327 |
| 220 | Ga0207694_10095576 | 3300025924 | Bacteria | 2349 |
| 221 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 222 | Ga0207650_10004568 | 3300025925 | Bacteria | 9467 |
| 223 | Ga0207650_10045113 | 3300025925 | Bacteria | 3243 |
| 224 | Ga0207650_10094945 | 3300025925 | Bacteria | 2285 |
| 225 | Ga0207700_10000010 | 3300025928 | Bacteria | 298473 |
| 226 | Ga0207664_10046955 | 3300025929 | Bacteria | 3391 |
| 227 | Ga0207664_10191132 | 3300025929 | Bacteria | 1762 |
| 228 | Ga0207644_10000197 | 3300025931 | Bacteria | 42679 |
| 229 | Ga0207644_10015582 | 3300025931 | Bacteria | 5104 |
| 230 | Ga0207690_10151904 | 3300025932 | Bacteria | 1717 |
| 231 | Ga0207706_10002602 | 3300025933 | Bacteria | 17565 |
| 232 | Ga0207706_10018319 | 3300025933 | Bacteria | 6301 |
| 233 | Ga0207665_10071107 | 3300025939 | Bacteria | 2375 |
| 234 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 235 | Ga0207711_10060742 | 3300025941 | Bacteria | 3257 |
| 236 | Ga0207711_10115718 | 3300025941 | Bacteria | 2390 |
| 237 | Ga0207679_10098942 | 3300025945 | Bacteria | 2276 |
| 238 | Ga0207667_10000183 | 3300025949 | Bacteria | 91183 |
| 239 | Ga0207667_10018054 | 3300025949 | Bacteria | 7922 |
| 240 | Ga0207668_10000026 | 3300025972 | Bacteria | 128309 |
| 241 | Ga0207668_10071530 | 3300025972 | Bacteria | 2478 |
| 242 | Ga0207640_10077579 | 3300025981 | Bacteria | 2259 |
| 243 | Ga0207640_10093632 | 3300025981 | Bacteria | 2088 |
| 244 | Ga0207640_10280436 | 3300025981 | Bacteria | 1309 |
| 245 | Ga0207640_10568880 | 3300025981 | Bacteria | 955 |
| 246 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 247 | Ga0207658_10000902 | 3300025986 | Bacteria | 24720 |
| 248 | Ga0207677_10100711 | 3300026023 | Bacteria | 2125 |
| 249 | Ga0207703_10000404 | 3300026035 | Bacteria | 46297 |
| 250 | Ga0207703_10076661 | 3300026035 | Bacteria | 2774 |
| 251 | Ga0207639_10004074 | 3300026041 | Bacteria | 9859 |
| 252 | Ga0207639_10013017 | 3300026041 | Bacteria | 5808 |
| 253 | Ga0207639_10024671 | 3300026041 | Bacteria | 4355 |
| 254 | Ga0207639_10601091 | 3300026041 | Bacteria | 1014 |
| 255 | Ga0207678_10271332 | 3300026067 | Bacteria | 1455 |
| 256 | Ga0207702_10000013 | 3300026078 | Bacteria | 257468 |
| 257 | Ga0207702_10001346 | 3300026078 | Bacteria | 24513 |
| 258 | Ga0207641_10000277 | 3300026088 | Bacteria | 64441 |
| 259 | Ga0207641_10011325 | 3300026088 | Bacteria | 7320 |
| 260 | Ga0207641_10041166 | 3300026088 | Bacteria | 3871 |
| 261 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 262 | Ga0207676_10000600 | 3300026095 | Bacteria | 29522 |
| 263 | Ga0207676_10014784 | 3300026095 | Bacteria | 5622 |
| 264 | Ga0207676_10228387 | 3300026095 | Bacteria | 1662 |
| 265 | Ga0207674_10001730 | 3300026116 | Bacteria | 27883 |
| 266 | Ga0207674_10012052 | 3300026116 | Bacteria | 9684 |
| 267 | Ga0207674_10077154 | 3300026116 | Bacteria | 3338 |
| 268 | Ga0207674_10173973 | 3300026116 | Bacteria | 2106 |
| 269 | Ga0207675_100004115 | 3300026118 | Bacteria | 14077 |
| 270 | Ga0207683_10105040 | 3300026121 | Bacteria | 2524 |
| 271 | Ga0207698_10101748 | 3300026142 | Bacteria | 2384 |
| 272 | Ga0207698_10172998 | 3300026142 | Bacteria | 1904 |
| 273 | Ga0268266_10244975 | 3300028379 | Bacteria | 1656 |
| 274 | Ga0268266_10419396 | 3300028379 | Bacteria | 1268 |
| 275 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 276 | Ga0268265_10010756 | 3300028380 | Bacteria | 6178 |
| 277 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 278 | Ga0265337_1003661 | 3300028556 | Bacteria | 6589 |
| 279 | Ga0265334_10003731 | 3300028573 | Bacteria | 6889 |
| 280 | Ga0265318_10000436 | 3300028577 | Bacteria | 31719 |
| 281 | Ga0265318_10046087 | 3300028577 | Bacteria | 1647 |
| 282 | Ga0307515_10058728 | 3300028794 | Bacteria | 5532 |
| 283 | Ga0307515_10105570 | 3300028794 | Bacteria | 3352 |
| 284 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 285 | Ga0265338_10019953 | 3300028800 | Bacteria | 7077 |
| 286 | Ga0265338_10031329 | 3300028800 | Bacteria | 5216 |
| 287 | Ga0265338_10121670 | 3300028800 | Bacteria | 2079 |
| 288 | Ga0265330_10007638 | 3300031235 | Bacteria | 5255 |
| 289 | Ga0265332_10040969 | 3300031238 | Bacteria | 2004 |
| 290 | Ga0265332_10068733 | 3300031238 | Bacteria | 1510 |
| 291 | Ga0265332_10119737 | 3300031238 | Bacteria | 1106 |
| 292 | Ga0265320_10000807 | 3300031240 | Bacteria | 23799 |
| 293 | Ga0265325_10000007 | 3300031241 | Bacteria | 208874 |
| 294 | Ga0265325_10000325 | 3300031241 | Bacteria | 33683 |
| 295 | Ga0265329_10050804 | 3300031242 | Bacteria | 1321 |
| 296 | Ga0265340_10000115 | 3300031247 | Bacteria | 39225 |
| 297 | Ga0265340_10000844 | 3300031247 | Bacteria | 17423 |
| 298 | Ga0265340_10018845 | 3300031247 | Bacteria | 3556 |
| 299 | Ga0265340_10032445 | 3300031247 | Bacteria | 2607 |
| 300 | Ga0265340_10040327 | 3300031247 | Bacteria | 2300 |
| 301 | Ga0265340_10107060 | 3300031247 | Bacteria | 1295 |
| 302 | Ga0265339_10001769 | 3300031249 | Bacteria | 15891 |
| 303 | Ga0265339_10053799 | 3300031249 | Bacteria | 2188 |
| 304 | Ga0265339_10106389 | 3300031249 | Bacteria | 1455 |
| 305 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 306 | Ga0265331_10002860 | 3300031250 | Bacteria | 11427 |
| 307 | Ga0265331_10006743 | 3300031250 | Bacteria | 6730 |
| 308 | Ga0265331_10026162 | 3300031250 | Bacteria | 2937 |
| 309 | Ga0265327_10000430 | 3300031251 | Bacteria | 76023 |
| 310 | Ga0265316_10014699 | 3300031344 | Bacteria | 6875 |
| 311 | Ga0265316_10018163 | 3300031344 | Bacteria | 6053 |
| 312 | Ga0265316_10019198 | 3300031344 | Bacteria | 5853 |
| 313 | Ga0265316_10052990 | 3300031344 | Bacteria | 3180 |
| 314 | Ga0265316_10119102 | 3300031344 | Bacteria | 1995 |
| 315 | Ga0265316_10184079 | 3300031344 | Bacteria | 1554 |
| 316 | Ga0265316_10415230 | 3300031344 | Bacteria | 968 |
| 317 | Ga0265313_10002331 | 3300031595 | Bacteria | 16628 |
| 318 | Ga0265313_10020238 | 3300031595 | Bacteria | 3676 |
| 319 | Ga0265313_10026131 | 3300031595 | Bacteria | 3082 |
| 320 | Ga0265313_10033777 | 3300031595 | Bacteria | 2595 |
| 321 | Ga0265314_10004741 | 3300031711 | Bacteria | 12463 |
| 322 | Ga0265314_10041163 | 3300031711 | Bacteria | 3310 |
| 323 | Ga0265314_10063482 | 3300031711 | Bacteria | 2505 |
| 324 | Ga0265314_10148944 | 3300031711 | Bacteria | 1437 |
| 325 | Ga0265342_10024454 | 3300031712 | Bacteria | 3812 |
| 326 | Ga0265342_10036320 | 3300031712 | Bacteria | 3010 |
| 327 | Ga0265342_10050131 | 3300031712 | Bacteria | 2495 |
| 328 | Ga0307516_10013579 | 3300031730 | Bacteria | 8660 |
| 329 | Ga0307406_10021598 | 3300031901 | Bacteria | 3810 |
| 330 | Ga0307406_10413477 | 3300031901 | Bacteria | 1073 |
| 331 | Ga0307412_10028714 | 3300031911 | Bacteria | 3484 |
| 332 | Ga0307416_100313733 | 3300032002 | Bacteria | 1566 |
| 333 | Ga0307416_100348657 | 3300032002 | Bacteria | 1497 |
| 334 | Ga0373951_0089688 | 3300035091 | Bacteria | 805 |
| 335 | Ga0373954_0031633 | 3300035118 | Bacteria | 2444 |
| 336 | Ga0373955_0067965 | 3300035172 | Bacteria | 1985 |
| 337 | Ga0373942_0011104 | 3300035207 | Bacteria | 2130 |
| 338 | Ga0373931_0013868 | 3300035691 | Bacteria | 3932 |
| 339 | Ga0373935_0010737 | 3300035692 | Bacteria | 5502 |
| 340 | Ga0373935_0114475 | 3300035692 | Bacteria | 1794 |
| 341 | Ga0373927_0056036 | 3300035695 | Bacteria | 2548 |
| 342 | Ga0373927_0103654 | 3300035695 | Bacteria | 1851 |
| 343 | Ga0373933_0026091 | 3300035724 | Bacteria | 3353 |
| 344 | Ga0373933_0028923 | 3300035724 | Bacteria | 3200 |
| 345 | Ga0373933_0141973 | 3300035724 | Bacteria | 1517 |
| 346 | Ga0373947_0024952 | 3300035725 | Bacteria | 3486 |
| 347 | Ga0373947_0149494 | 3300035725 | Bacteria | 1503 |
| 348 | Ga0373937_0013134 | 3300036401 | Bacteria | 7292 |
| 349 | Ga0373937_0024641 | 3300036401 | Bacteria | 5429 |
| 350 | Ga0373937_0052403 | 3300036401 | Bacteria | 3741 |
| 351 | Ga0373937_0284310 | 3300036401 | Bacteria | 1562 |
| 352 | Ga0373937_0770556 | 3300036401 | Bacteria | 910 |
| 353 | Ga0373925_0007893 | 3300037068 | Bacteria | 7751 |
| 354 | Ga0373925_0154626 | 3300037068 | Bacteria | 1803 |
| 355 | Ga0373925_0270492 | 3300037068 | Bacteria | 1367 |
| 356 | Ga0395905_0913943 | 3300037471 | Bacteria | 781 |
| 357 | Ga0436364_0184827 | 3300037853 | Bacteria | 146498 |
| 358 | Ga0436365_0073850 | 3300039437 | Bacteria | 40161 |
| 359 | Ga0436365_0508484 | 3300039437 | Bacteria | 190091 |
| 360 | Ga0436365_1535986 | 3300039437 | Bacteria | 4481 |
| 361 | Ga0436361_0858734 | 3300039447 | Bacteria | 1465 |
| 362 | Ga0436363_0405125 | 3300039450 | Bacteria | 7901 |
| 363 | Ga0436363_0761268 | 3300039450 | Bacteria | 4157 |
| 364 | Ga0436363_0949804 | 3300039450 | Bacteria | 2668 |
| 365 | Ga0451853_2643851 | 3300041512 | Bacteria | 2832 |
| 366 | Ga0439446_0064877 | 3300042156 | Bacteria | 1109 |
| 367 | Ga0439460_0008844 | 3300042461 | Bacteria | 2545 |
| 368 | Ga0466973_0215919 | 3300044659 | Bacteria | 1401 |
| 369 | Ga0495627_000751 | 3300046453 | Bacteria | 24156 |
| 370 | Ga0495592_0114085 | 3300046454 | Bacteria | 1909 |
| 371 | Ga0495603_0059861 | 3300046455 | Bacteria | 2251 |
| 372 | Ga0495590_0003110 | 3300046457 | Bacteria | 6786 |
| 373 | Ga0495638_0000283 | 3300046460 | Bacteria | 67742 |
| 374 | Ga0495638_0001944 | 3300046460 | Bacteria | 17720 |
| 375 | Ga0495638_0002498 | 3300046460 | Bacteria | 14971 |
| 376 | Ga0495638_0006034 | 3300046460 | Bacteria | 8869 |
| 377 | Ga0495638_0044711 | 3300046460 | Bacteria | 2789 |
| 378 | Ga0495650_0024719 | 3300046471 | Bacteria | 2832 |
| 379 | Ga0495582_0043843 | 3300046473 | Bacteria | 2463 |
| 380 | Ga0495583_0000234 | 3300046506 | Bacteria | 92118 |
| 381 | Ga0495610_0000158 | 3300046512 | Bacteria | 75123 |
| 382 | Ga0495610_0001132 | 3300046512 | Bacteria | 24265 |
| 383 | Ga0495610_0007739 | 3300046512 | Bacteria | 7091 |
| 384 | Ga0495631_0007917 | 3300046518 | Bacteria | 5380 |
| 385 | Ga0495631_0046806 | 3300046518 | Bacteria | 1901 |
| 386 | Ga0495632_0046359 | 3300046519 | Bacteria | 2160 |
| 387 | Ga0495637_0051691 | 3300046520 | Bacteria | 1718 |
| 388 | Ga0495643_0058055 | 3300046522 | Bacteria | 2060 |
| 389 | Ga0495643_0077621 | 3300046522 | Bacteria | 1735 |
| 390 | Ga0495643_0079090 | 3300046522 | Bacteria | 1715 |
| 391 | Ga0495643_0151891 | 3300046522 | Bacteria | 1146 |
| 392 | Ga0495648_0000098 | 3300046524 | Bacteria | 109074 |
| 393 | Ga0495642_0016296 | 3300046528 | Bacteria | 2895 |
| 394 | Ga0495654_0000264 | 3300046530 | Bacteria | 47686 |
| 395 | Ga0495654_0046723 | 3300046530 | Bacteria | 2131 |
| 396 | Ga0495665_0068846 | 3300046531 | Bacteria | 1866 |
| 397 | Ga0495621_0043406 | 3300046539 | Bacteria | 1586 |
| 398 | Ga0495645_0015164 | 3300046543 | Bacteria | 5479 |
| 399 | Ga0495622_0011314 | 3300046557 | Bacteria | 4121 |
| 400 | Ga0495633_0094799 | 3300046558 | Bacteria | 1387 |
| 401 | Ga0495668_0000389 | 3300046616 | Bacteria | 57953 |
| 402 | Ga0495668_0000984 | 3300046616 | Bacteria | 31110 |
| 403 | Ga0495668_0003334 | 3300046616 | Bacteria | 12109 |
| 404 | Ga0495668_0006115 | 3300046616 | Bacteria | 7971 |
| 405 | Ga0495634_0349436 | 3300046642 | Bacteria | 886 |
| 406 | Ga0495625_0000058 | 3300046660 | Bacteria | 180863 |
| 407 | Ga0495625_0000864 | 3300046660 | Bacteria | 41204 |
| 408 | Ga0495625_0001132 | 3300046660 | Bacteria | 34469 |
| 409 | Ga0495625_0030943 | 3300046660 | Bacteria | 3986 |
| 410 | Ga0495625_0146420 | 3300046660 | Bacteria | 1590 |
| 411 | Ga0495625_0154451 | 3300046660 | Bacteria | 1541 |
| 412 | Ga0495657_0203189 | 3300046675 | Bacteria | 1207 |
| 413 | Ga0495599_0049698 | 3300046678 | Bacteria | 2629 |
| 414 | Ga0495658_0001976 | 3300046683 | Bacteria | 10451 |
| 415 | Ga0495658_0063530 | 3300046683 | Bacteria | 2125 |
| 416 | Ga0495613_0047071 | 3300046689 | Bacteria | 3186 |
| 417 | Ga0495671_0106929 | 3300046692 | Bacteria | 1366 |
| 418 | Ga0495589_0039090 | 3300046794 | Bacteria | 2372 |
| 419 | Ga0495600_0433520 | 3300046809 | Bacteria | 815 |
| 420 | Ga0495672_0024447 | 3300047320 | Bacteria | 3891 |
| 421 | Ga0495675_0013756 | 3300047444 | Bacteria | 5114 |
| 422 | Ga0495679_021927 | 3300047446 | Bacteria | 2195 |
| 423 | Ga0495673_0000428 | 3300047469 | Bacteria | 47721 |
| 424 | Ga0495673_0000492 | 3300047469 | Bacteria | 42153 |
| 425 | Ga0495686_0000201 | 3300047472 | Bacteria | 110982 |
| 426 | Ga0495686_0000863 | 3300047472 | Bacteria | 38854 |
| 427 | Ga0495686_0001890 | 3300047472 | Bacteria | 20941 |
| 428 | Ga0495686_0009487 | 3300047472 | Bacteria | 7001 |
| 429 | Ga0495686_0021547 | 3300047472 | Bacteria | 4277 |
| 430 | Ga0495686_0038809 | 3300047472 | Bacteria | 3045 |
| 431 | Ga0495602_0243771 | 3300048088 | Bacteria | 1343 |
| 432 | Ga0496102_0013985 | 3300048905 | Bacteria | 6968 |
| 433 | Ga0496103_0000173 | 3300048906 | Bacteria | 67412 |
| 434 | Ga0496106_0011902 | 3300048909 | Bacteria | 6423 |
| 435 | Ga0496106_0329664 | 3300048909 | Bacteria | 1225 |
| 436 | Ga0496107_0000067 | 3300048910 | Bacteria | 52195 |
| 437 | Ga0496109_0024887 | 3300048912 | Bacteria | 5329 |
| 438 | Ga0496110_0164263 | 3300048913 | Bacteria | 2013 |
| 439 | Ga0496116_0000566 | 3300048919 | Bacteria | 49509 |
| 440 | Ga0496117_0000485 | 3300048920 | Bacteria | 65840 |
| 441 | Ga0496117_0021462 | 3300048920 | Bacteria | 5222 |
| 442 | Ga0496118_0000190 | 3300048921 | Bacteria | 108017 |
| 443 | Ga0496118_0013898 | 3300048921 | Bacteria | 7572 |
| 444 | Ga0496119_0112936 | 3300048922 | Bacteria | 1505 |
| 445 | Ga0496120_0023669 | 3300048923 | Bacteria | 3841 |
| 446 | Ga0496121_0000266 | 3300048924 | Bacteria | 109208 |
| 447 | Ga0496121_0003464 | 3300048924 | Bacteria | 22491 |
| 448 | Ga0496121_0008737 | 3300048924 | Bacteria | 11819 |
| 449 | Ga0496121_0061195 | 3300048924 | Bacteria | 3091 |
| 450 | Ga0496121_0075693 | 3300048924 | Bacteria | 2688 |
| 451 | Ga0496124_0000546 | 3300048927 | Bacteria | 63624 |
| 452 | Ga0496124_0028058 | 3300048927 | Bacteria | 5039 |
| 453 | Ga0496125_0051953 | 3300048928 | Bacteria | 3375 |
| 454 | Ga0496125_0072951 | 3300048928 | Bacteria | 2672 |
| 455 | Ga0496126_0000542 | 3300048929 | Bacteria | 73066 |
| 456 | Ga0496126_0009144 | 3300048929 | Bacteria | 10575 |
| 457 | Ga0496126_0236153 | 3300048929 | Bacteria | 1529 |
| 458 | Ga0495678_009454 | 3300049459 | Bacteria | 4820 |
| 459 | Ga0495682_0059023 | 3300049460 | Bacteria | 1387 |
| 460 | Ga0501031_0002125 | 3300049568 | Bacteria | 12501 |
| 461 | Ga0501031_0190838 | 3300049568 | Bacteria | 1338 |
| 462 | Ga0501032_0016626 | 3300049569 | Bacteria | 5172 |
| 463 | Ga0501032_0115196 | 3300049569 | Bacteria | 1777 |
| 464 | Ga0501033_0014156 | 3300049570 | Bacteria | 6064 |
| 465 | Ga0501033_0042348 | 3300049570 | Bacteria | 3395 |
| 466 | Ga0501033_0082811 | 3300049570 | Bacteria | 2352 |
| 467 | Ga0501034_0008881 | 3300049571 | Bacteria | 10566 |
| 468 | Ga0501034_0029743 | 3300049571 | Bacteria | 5553 |
| 469 | Ga0501034_0111134 | 3300049571 | Bacteria | 2731 |
| 470 | Ga0501036_0002345 | 3300049572 | Bacteria | 14799 |
| 471 | Ga0501036_0039405 | 3300049572 | Bacteria | 3998 |
| 472 | Ga0501036_0057057 | 3300049572 | Bacteria | 3308 |
| 473 | Ga0501037_0033298 | 3300049573 | Bacteria | 3806 |
| 474 | Ga0501037_0447845 | 3300049573 | Bacteria | 881 |
| 475 | Ga0501038_0053264 | 3300049574 | Bacteria | 3484 |
| 476 | Ga0501038_0079962 | 3300049574 | Bacteria | 2756 |
| 477 | Ga0501039_0003435 | 3300049575 | Bacteria | 11827 |
| 478 | Ga0501040_0006325 | 3300049576 | Bacteria | 7688 |
| 479 | Ga0501041_0026403 | 3300049577 | Bacteria | 3494 |
| 480 | Ga0501042_0030314 | 3300049578 | Bacteria | 3819 |
| 481 | Ga0501042_0200924 | 3300049578 | Bacteria | 1437 |
| 482 | Ga0501043_0003381 | 3300049579 | Bacteria | 13137 |
| 483 | Ga0501043_0288346 | 3300049579 | Bacteria | 1257 |
| 484 | Ga0501043_0617511 | 3300049579 | Bacteria | 799 |
| 485 | Ga0501046_0004299 | 3300049580 | Bacteria | 12964 |
| 486 | Ga0501046_0013015 | 3300049580 | Bacteria | 7061 |
| 487 | Ga0501046_0051216 | 3300049580 | Bacteria | 3259 |
| 488 | Ga0501046_0379608 | 3300049580 | Bacteria | 1023 |
| 489 | Ga0501047_0000402 | 3300049581 | Bacteria | 48648 |
| 490 | Ga0501047_0006146 | 3300049581 | Bacteria | 11288 |
| 491 | Ga0501047_0132683 | 3300049581 | Bacteria | 2370 |
| 492 | Ga0501047_0304684 | 3300049581 | Bacteria | 1435 |
| 493 | Ga0501048_0125885 | 3300049582 | Bacteria | 1811 |
| 494 | Ga0501067_0007275 | 3300049583 | Bacteria | 6146 |
| 495 | Ga0501067_0018443 | 3300049583 | Bacteria | 3865 |
| 496 | Ga0501067_0035034 | 3300049583 | Bacteria | 2786 |
| 497 | Ga0501068_0018923 | 3300049584 | Bacteria | 3992 |
| 498 | Ga0501068_0161264 | 3300049584 | Bacteria | 1413 |
| 499 | Ga0501070_0000047 | 3300049586 | Bacteria | 107704 |
| 500 | Ga0501070_0003346 | 3300049586 | Bacteria | 13920 |
| 501 | Ga0501070_0204270 | 3300049586 | Bacteria | 1622 |
| 502 | Ga0501070_0435401 | 3300049586 | Bacteria | 1058 |
| 503 | Ga0501071_0062130 | 3300049587 | Bacteria | 2706 |
| 504 | Ga0501071_0346469 | 3300049587 | Bacteria | 1130 |
| 505 | Ga0501072_0238499 | 3300049588 | Bacteria | 1448 |
| 506 | Ga0501073_0009287 | 3300049589 | Bacteria | 7254 |
| 507 | Ga0501073_0123937 | 3300049589 | Bacteria | 1791 |
| 508 | Ga0501073_0297523 | 3300049589 | Bacteria | 1113 |
| 509 | Ga0501074_0001660 | 3300049590 | Bacteria | 15118 |
| 510 | Ga0501074_0095157 | 3300049590 | Bacteria | 2133 |
| 511 | Ga0501074_0124995 | 3300049590 | Bacteria | 1839 |
| 512 | Ga0501077_0085425 | 3300049593 | Bacteria | 2000 |
| 513 | Ga0501249_006802 | 3300049679 | Bacteria | 2356 |
| 514 | Ga0501079_0002074 | 3300049741 | Bacteria | 14370 |
| 515 | Ga0501079_0066502 | 3300049741 | Bacteria | 2781 |
| 516 | Ga0501079_0102868 | 3300049741 | Bacteria | 2215 |
| 517 | Ga0501079_0261600 | 3300049741 | Bacteria | 1352 |
| 518 | Ga0501080_0000366 | 3300049742 | Bacteria | 34958 |
| 519 | Ga0501080_0188883 | 3300049742 | Bacteria | 1893 |
| 520 | Ga0501080_0327634 | 3300049742 | Bacteria | 1385 |
| 521 | Ga0501081_0183426 | 3300049743 | Bacteria | 1514 |
| 522 | Ga0501083_0001873 | 3300049744 | Bacteria | 14449 |
| 523 | Ga0501035_0006816 | 3300049822 | Bacteria | 10673 |
| 524 | Ga0501035_0039552 | 3300049822 | Bacteria | 4267 |
| 525 | Ga0501044_0019366 | 3300049823 | Bacteria | 7283 |
| 526 | Ga0501044_0033137 | 3300049823 | Bacteria | 5429 |
| 527 | Ga0501044_0039259 | 3300049823 | Bacteria | 4939 |
| 528 | Ga0501044_0061340 | 3300049823 | Bacteria | 3847 |
| 529 | Ga0501044_0109480 | 3300049823 | Bacteria | 2771 |
| 530 | Ga0501044_0380390 | 3300049823 | Bacteria | 1327 |
| 531 | Ga0501045_0142982 | 3300049824 | Bacteria | 1779 |
| 532 | nmdc:mga0k408_44342_c1 | 3300050493 | Bacteria | 2564 |
| 533 | nmdc:mga0qj67_289663_c1 | 3300050509 | Bacteria | 1327 |
| 534 | nmdc:mga0n895_41051_c1 | 3300050512 | Bacteria | 4497 |
| 535 | nmdc:mga0rr50_5661_c1 | 3300050513 | Bacteria | 7482 |
| 536 | nmdc:mga08x19_123936_c1 | 3300050514 | Bacteria | 1734 |
| 537 | nmdc:mga08x19_50_c1 | 3300050514 | Bacteria | 129410 |
| 538 | Ga0500635_0028003 | 3300053080 | Bacteria | 1796 |
| 539 | Ga0500578_0000270 | 3300053086 | Bacteria | 64772 |
| 540 | Ga0500644_0000665 | 3300053088 | Bacteria | 12588 |
| 541 | Ga0500644_0000688 | 3300053088 | Bacteria | 12225 |
| 542 | Ga0500646_0039154 | 3300053090 | Bacteria | 1329 |
| 543 | Ga0500651_0058051 | 3300053093 | Bacteria | 2420 |
| 544 | Ga0500641_0015395 | 3300053096 | Bacteria | 2838 |
| 545 | Ga0500650_0192337 | 3300053098 | Bacteria | 932 |
| 546 | Ga0500554_007983 | 3300053102 | Bacteria | 2464 |
| 547 | Ga0500555_001311 | 3300053103 | Bacteria | 7856 |
| 548 | Ga0500556_0033045 | 3300053104 | Bacteria | 1772 |
| 549 | Ga0500562_001389 | 3300053108 | Bacteria | 5970 |
| 550 | Ga0500592_006958 | 3300053116 | Bacteria | 1800 |
| 551 | Ga0500594_0001228 | 3300053118 | Bacteria | 5537 |
| 552 | Ga0500608_000382 | 3300053122 | Bacteria | 17102 |
| 553 | Ga0500614_005558 | 3300053123 | Bacteria | 2645 |
| 554 | Ga0500618_000185 | 3300053125 | Bacteria | 51250 |
| 555 | Ga0500642_0086375 | 3300053130 | Bacteria | 1446 |
| 556 | Ga0500655_000052 | 3300053133 | Bacteria | 31493 |
| 557 | Ga0500658_0001423 | 3300053134 | Bacteria | 9627 |
| 558 | Ga0500559_0000056 | 3300053136 | Bacteria | 88545 |
| 559 | Ga0500559_0001893 | 3300053136 | Bacteria | 11341 |
| 560 | Ga0500559_0007037 | 3300053136 | Bacteria | 5025 |
| 561 | Ga0500559_0027225 | 3300053136 | Bacteria | 2439 |
| 562 | Ga0500564_000033 | 3300053138 | Bacteria | 39298 |
| 563 | Ga0500577_0001288 | 3300053142 | Bacteria | 6407 |
| 564 | Ga0500590_002752 | 3300053148 | Bacteria | 7924 |
| 565 | Ga0500619_054569 | 3300053154 | Bacteria | 1302 |
| 566 | Ga0500622_0000553 | 3300053156 | Bacteria | 34248 |
| 567 | Ga0500622_0008348 | 3300053156 | Bacteria | 5799 |
| 568 | Ga0500622_0012270 | 3300053156 | Bacteria | 4645 |
| 569 | Ga0500627_0000188 | 3300053158 | Bacteria | 18122 |
| 570 | Ga0500639_064582 | 3300053163 | Bacteria | 1880 |
| 571 | Ga0500636_0033294 | 3300053177 | Bacteria | 3052 |
| 572 | Ga0500637_0000212 | 3300053178 | Bacteria | 21766 |
| 573 | Ga0500570_000179 | 3300053724 | Bacteria | 19920 |
| 574 | Ga0501084_0002294 | 3300054114 | Bacteria | 15374 |
| 575 | Ga0501084_0010924 | 3300054114 | Bacteria | 7520 |
| 576 | Ga0501082_0008707 | 3300060353 | Bacteria | 8751 |
| 577 | Ga0501082_0212074 | 3300060353 | Bacteria | 1684 |
| 578 | Ga0530510_0075573 | 3300061734 | Bacteria | 2447 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100014668 | Ga0070659_1000146682 | 205 |
| 2 | 3300005563 | Ga0068855_100510747 | Ga0068855_1005107472 | 205 |
| 3 | 3300014968 | Ga0157379_10076482 | Ga0157379_100764823 | 213 |
| 4 | 3300046675 | Ga0495657_0203189 | Ga0495657_0203189_58_831 | 213 |
| 5 | 3300039450 | Ga0436363_0949804 | Ga0436363_0949804_1336_2109 | 219 |
| 6 | 3300053116 | Ga0500592_006958 | Ga0500592_006958_369_1142 | 221 |
| 7 | 3300005331 | Ga0070670_100080899 | Ga0070670_1000808992 | 222 |
| 8 | 3300025914 | Ga0207671_10411789 | Ga0207671_104117892 | 222 |
| 9 | 3300025925 | Ga0207650_10094945 | Ga0207650_100949452 | 222 |
| 10 | 3300048928 | Ga0496125_0051953 | Ga0496125_0051953_2557_3357 | 224 |
| 11 | 3300049568 | Ga0501031_0002125 | Ga0501031_0002125_4953_5726 | 224 |
| 12 | 3300049569 | Ga0501032_0115196 | Ga0501032_0115196_113_886 | 224 |
| 13 | 3300049571 | Ga0501034_0008881 | Ga0501034_0008881_4054_4827 | 224 |
| 14 | 3300049572 | Ga0501036_0002345 | Ga0501036_0002345_13609_14382 | 224 |
| 15 | 3300049573 | Ga0501037_0033298 | Ga0501037_0033298_2281_3054 | 224 |
| 16 | 3300049575 | Ga0501039_0003435 | Ga0501039_0003435_10509_11282 | 224 |
| 17 | 3300049578 | Ga0501042_0030314 | Ga0501042_0030314_2932_3705 | 224 |
| 18 | 3300049579 | Ga0501043_0003381 | Ga0501043_0003381_11408_12181 | 224 |
| 19 | 3300049580 | Ga0501046_0004299 | Ga0501046_0004299_11489_12262 | 224 |
| 20 | 3300049581 | Ga0501047_0132683 | Ga0501047_0132683_1403_2176 | 224 |
| 21 | 3300049583 | Ga0501067_0018443 | Ga0501067_0018443_714_1487 | 224 |
| 22 | 3300049584 | Ga0501068_0018923 | Ga0501068_0018923_545_1318 | 224 |
| 23 | 3300049586 | Ga0501070_0204270 | Ga0501070_0204270_45_818 | 224 |
| 24 | 3300049587 | Ga0501071_0062130 | Ga0501071_0062130_243_1016 | 224 |
| 25 | 3300049590 | Ga0501074_0001660 | Ga0501074_0001660_807_1580 | 224 |
| 26 | 3300049741 | Ga0501079_0002074 | Ga0501079_0002074_2190_2963 | 224 |
| 27 | 3300049742 | Ga0501080_0327634 | Ga0501080_0327634_67_840 | 224 |
| 28 | 3300049744 | Ga0501083_0001873 | Ga0501083_0001873_2378_3151 | 224 |
| 29 | 3300049824 | Ga0501045_0142982 | Ga0501045_0142982_194_967 | 224 |
| 30 | 3300054114 | Ga0501084_0002294 | Ga0501084_0002294_2849_3622 | 224 |
| 31 | 3300060353 | Ga0501082_0212074 | Ga0501082_0212074_115_888 | 224 |
| 32 | 3300005331 | Ga0070670_100000528 | Ga0070670_10000052830 | 225 |
| 33 | 3300005335 | Ga0070666_10179141 | Ga0070666_101791412 | 225 |
| 34 | 3300005347 | Ga0070668_100000007 | Ga0070668_100000007153 | 225 |
| 35 | 3300005355 | Ga0070671_100000388 | Ga0070671_1000003885 | 225 |
| 36 | 3300005367 | Ga0070667_100000003 | Ga0070667_100000003258 | 225 |
| 37 | 3300005548 | Ga0070665_100288687 | Ga0070665_1002886872 | 225 |
| 38 | 3300005617 | Ga0068859_100034906 | Ga0068859_1000349062 | 225 |
| 39 | 3300005842 | Ga0068858_100007133 | Ga0068858_1000071335 | 225 |
| 40 | 3300005843 | Ga0068860_100000045 | Ga0068860_10000004527 | 225 |
| 41 | 3300005844 | Ga0068862_100000989 | Ga0068862_1000009894 | 225 |
| 42 | 3300006195 | Ga0075366_10014001 | Ga0075366_100140013 | 225 |
| 43 | 3300006931 | Ga0097620_100034906 | Ga0097620_1000349062 | 225 |
| 44 | 3300006931 | Ga0097620_100118248 | Ga0097620_1001182482 | 225 |
| 45 | 3300009177 | Ga0105248_10025033 | Ga0105248_100250336 | 225 |
| 46 | 3300009177 | Ga0105248_10245859 | Ga0105248_102458593 | 225 |
| 47 | 3300025903 | Ga0207680_10136334 | Ga0207680_101363342 | 225 |
| 48 | 3300025923 | Ga0207681_10016173 | Ga0207681_100161735 | 225 |
| 49 | 3300025925 | Ga0207650_10004568 | Ga0207650_1000456813 | 225 |
| 50 | 3300025931 | Ga0207644_10000197 | Ga0207644_1000019739 | 225 |
| 51 | 3300025941 | Ga0207711_10060742 | Ga0207711_100607423 | 225 |
| 52 | 3300025972 | Ga0207668_10000026 | Ga0207668_10000026119 | 225 |
| 53 | 3300025986 | Ga0207658_10000002 | Ga0207658_100000021159 | 225 |
| 54 | 3300026023 | Ga0207677_10100711 | Ga0207677_101007113 | 225 |
| 55 | 3300026035 | Ga0207703_10000404 | Ga0207703_100004045 | 225 |
| 56 | 3300026116 | Ga0207674_10173973 | Ga0207674_101739731 | 225 |
| 57 | 3300028379 | Ga0268266_10244975 | Ga0268266_102449752 | 225 |
| 58 | 3300028380 | Ga0268265_10010756 | Ga0268265_100107564 | 225 |
| 59 | 3300028381 | Ga0268264_10000101 | Ga0268264_1000010129 | 225 |
| 60 | 3300031238 | Ga0265332_10068733 | Ga0265332_100687332 | 225 |
| 61 | 3300031241 | Ga0265325_10000325 | Ga0265325_1000032513 | 225 |
| 62 | 3300031344 | Ga0265316_10018163 | Ga0265316_100181633 | 225 |
| 63 | 3300031595 | Ga0265313_10033777 | Ga0265313_100337772 | 225 |
| 64 | 3300036401 | Ga0373937_0770556 | Ga0373937_0770556_64_837 | 225 |
| 65 | 3300037853 | Ga0436364_0184827 | Ga0436364_0184827_77705_78505 | 225 |
| 66 | 3300039450 | Ga0436363_0761268 | Ga0436363_0761268_1107_1904 | 225 |
| 67 | 3300046528 | Ga0495642_0016296 | Ga0495642_0016296_1128_1934 | 225 |
| 68 | 3300047472 | Ga0495686_0038809 | Ga0495686_0038809_1654_2451 | 225 |
| 69 | 3300049570 | Ga0501033_0042348 | Ga0501033_0042348_2600_3373 | 225 |
| 70 | 3300053177 | Ga0500636_0033294 | Ga0500636_0033294_70_864 | 225 |
| 71 | 3300005331 | Ga0070670_100402300 | Ga0070670_1004023001 | 226 |
| 72 | 3300005364 | Ga0070673_100168747 | Ga0070673_1001687472 | 226 |
| 73 | 3300005456 | Ga0070678_100060101 | Ga0070678_1000601013 | 226 |
| 74 | 3300005564 | Ga0070664_100094763 | Ga0070664_1000947633 | 226 |
| 75 | 3300005618 | Ga0068864_100028365 | Ga0068864_1000283654 | 226 |
| 76 | 3300005841 | Ga0068863_100199127 | Ga0068863_1001991272 | 226 |
| 77 | 3300006237 | Ga0097621_100210886 | Ga0097621_1002108862 | 226 |
| 78 | 3300009177 | Ga0105248_10064572 | Ga0105248_100645724 | 226 |
| 79 | 3300013296 | Ga0157374_10312794 | Ga0157374_103127942 | 226 |
| 80 | 3300013308 | Ga0157375_10046901 | Ga0157375_100469014 | 226 |
| 81 | 3300014325 | Ga0163163_10095807 | Ga0163163_100958072 | 226 |
| 82 | 3300014968 | Ga0157379_10030165 | Ga0157379_100301655 | 226 |
| 83 | 3300025925 | Ga0207650_10045113 | Ga0207650_100451132 | 226 |
| 84 | 3300025933 | Ga0207706_10018319 | Ga0207706_100183193 | 226 |
| 85 | 3300025941 | Ga0207711_10115718 | Ga0207711_101157184 | 226 |
| 86 | 3300025945 | Ga0207679_10098942 | Ga0207679_100989422 | 226 |
| 87 | 3300025981 | Ga0207640_10568880 | Ga0207640_105688802 | 226 |
| 88 | 3300026035 | Ga0207703_10076661 | Ga0207703_100766614 | 226 |
| 89 | 3300026095 | Ga0207676_10014784 | Ga0207676_100147844 | 226 |
| 90 | 3300026121 | Ga0207683_10105040 | Ga0207683_101050402 | 226 |
| 91 | 3300048905 | Ga0496102_0013985 | Ga0496102_0013985_3586_4389 | 226 |
| 92 | 3300048909 | Ga0496106_0329664 | Ga0496106_0329664_360_1163 | 226 |
| 93 | 3300048912 | Ga0496109_0024887 | Ga0496109_0024887_3767_4570 | 226 |
| 94 | 3300048913 | Ga0496110_0164263 | Ga0496110_0164263_614_1417 | 226 |
| 95 | 3300044659 | Ga0466973_0215919 | Ga0466973_0215919_209_991 | 227 |
| 96 | 3300049569 | Ga0501032_0016626 | Ga0501032_0016626_1952_2746 | 227 |
| 97 | 3300049580 | Ga0501046_0051216 | Ga0501046_0051216_1911_2705 | 227 |
| 98 | 3300049581 | Ga0501047_0000402 | Ga0501047_0000402_8814_9608 | 227 |
| 99 | 3300050493 | nmdc:mga0k408_44342_c1 | nmdc:mga0k408_44342_c1_685_1479 | 227 |
| 100 | 3300005436 | Ga0070713_100270279 | Ga0070713_1002702791 | 229 |
| 101 | 3300005455 | Ga0070663_100064034 | Ga0070663_1000640343 | 229 |
| 102 | 3300006175 | Ga0070712_100000494 | Ga0070712_1000004945 | 229 |
| 103 | 3300025915 | Ga0207693_10000295 | Ga0207693_1000029528 | 229 |
| 104 | 3300005577 | Ga0068857_100021236 | Ga0068857_1000212362 | 231 |
| 105 | 3300009093 | Ga0105240_10030255 | Ga0105240_100302552 | 231 |
| 106 | 3300025913 | Ga0207695_10025853 | Ga0207695_100258532 | 231 |
| 107 | 3300026116 | Ga0207674_10012052 | Ga0207674_100120528 | 231 |
| 108 | 3300049743 | Ga0501081_0183426 | Ga0501081_0183426_304_1089 | 231 |
| 109 | 3300046809 | Ga0495600_0433520 | Ga0495600_0433520_92_802 | 233 |
| 110 | 3300005577 | Ga0068857_100368811 | Ga0068857_1003688112 | 234 |
| 111 | 3300005578 | Ga0068854_100112409 | Ga0068854_1001124092 | 234 |
| 112 | 3300025981 | Ga0207640_10093632 | Ga0207640_100936322 | 234 |
| 113 | 3300026142 | Ga0207698_10172998 | Ga0207698_101729982 | 234 |
| 114 | 3300031711 | Ga0265314_10063482 | Ga0265314_100634822 | 234 |
| 115 | 3300003320 | rootH2_10058962 | rootH2_100589624 | 235 |
| 116 | 3300003320 | rootH2_10093856 | rootH2_100938562 | 235 |
| 117 | 3300003322 | rootL2_10021435 | rootL2_100214354 | 235 |
| 118 | 3300003781 | Ga0055536_1003093 | Ga0055536_10030936 | 235 |
| 119 | 3300003781 | Ga0055536_1003367 | Ga0055536_10033675 | 235 |
| 120 | 3300003791 | Ga0055530_10002805 | Ga0055530_100028054 | 235 |
| 121 | 3300003794 | Ga0055531_10000644 | Ga0055531_100006449 | 235 |
| 122 | 3300005262 | Ga0065165_1000499 | Ga0065165_100049943 | 235 |
| 123 | 3300005293 | Ga0065715_10097850 | Ga0065715_100978504 | 235 |
| 124 | 3300005327 | Ga0070658_10081439 | Ga0070658_100814393 | 235 |
| 125 | 3300005335 | Ga0070666_10009592 | Ga0070666_100095922 | 235 |
| 126 | 3300005336 | Ga0070680_100000201 | Ga0070680_10000020110 | 235 |
| 127 | 3300005336 | Ga0070680_100116041 | Ga0070680_1001160413 | 235 |
| 128 | 3300005339 | Ga0070660_100043403 | Ga0070660_1000434033 | 235 |
| 129 | 3300005341 | Ga0070691_10019410 | Ga0070691_100194102 | 235 |
| 130 | 3300005344 | Ga0070661_100011657 | Ga0070661_1000116575 | 235 |
| 131 | 3300005366 | Ga0070659_100069377 | Ga0070659_1000693772 | 235 |
| 132 | 3300005434 | Ga0070709_10042688 | Ga0070709_100426882 | 235 |
| 133 | 3300005435 | Ga0070714_100090017 | Ga0070714_1000900172 | 235 |
| 134 | 3300005435 | Ga0070714_100143203 | Ga0070714_1001432032 | 235 |
| 135 | 3300005435 | Ga0070714_100351234 | Ga0070714_1003512342 | 235 |
| 136 | 3300005436 | Ga0070713_100000003 | Ga0070713_100000003216 | 235 |
| 137 | 3300005439 | Ga0070711_100042521 | Ga0070711_1000425211 | 235 |
| 138 | 3300005439 | Ga0070711_100459064 | Ga0070711_1004590642 | 235 |
| 139 | 3300005445 | Ga0070708_100158845 | Ga0070708_1001588452 | 235 |
| 140 | 3300005458 | Ga0070681_10000005 | Ga0070681_10000005104 | 235 |
| 141 | 3300005458 | Ga0070681_10561538 | Ga0070681_105615382 | 235 |
| 142 | 3300005458 | Ga0070681_10701798 | Ga0070681_107017981 | 235 |
| 143 | 3300005468 | Ga0070707_100010180 | Ga0070707_1000101804 | 235 |
| 144 | 3300005471 | Ga0070698_100055153 | Ga0070698_1000551533 | 235 |
| 145 | 3300005530 | Ga0070679_100000293 | Ga0070679_10000029337 | 235 |
| 146 | 3300005530 | Ga0070679_100295020 | Ga0070679_1002950201 | 235 |
| 147 | 3300005535 | Ga0070684_100751794 | Ga0070684_1007517941 | 235 |
| 148 | 3300005539 | Ga0068853_100007775 | Ga0068853_1000077758 | 235 |
| 149 | 3300005539 | Ga0068853_100118929 | Ga0068853_1001189291 | 235 |
| 150 | 3300005547 | Ga0070693_100004688 | Ga0070693_1000046886 | 235 |
| 151 | 3300005548 | Ga0070665_100717359 | Ga0070665_1007173591 | 235 |
| 152 | 3300005563 | Ga0068855_100000063 | Ga0068855_1000000635 | 235 |
| 153 | 3300005563 | Ga0068855_100029600 | Ga0068855_1000296004 | 235 |
| 154 | 3300005563 | Ga0068855_100139809 | Ga0068855_1001398093 | 235 |
| 155 | 3300005577 | Ga0068857_100003278 | Ga0068857_10000327811 | 235 |
| 156 | 3300005578 | Ga0068854_100235853 | Ga0068854_1002358532 | 235 |
| 157 | 3300005578 | Ga0068854_100242838 | Ga0068854_1002428382 | 235 |
| 158 | 3300005614 | Ga0068856_100001293 | Ga0068856_10000129310 | 235 |
| 159 | 3300005614 | Ga0068856_100001833 | Ga0068856_10000183320 | 235 |
| 160 | 3300005614 | Ga0068856_101030720 | Ga0068856_1010307201 | 235 |
| 161 | 3300005616 | Ga0068852_100017052 | Ga0068852_1000170524 | 235 |
| 162 | 3300005616 | Ga0068852_100099572 | Ga0068852_1000995722 | 235 |
| 163 | 3300005616 | Ga0068852_100152567 | Ga0068852_1001525672 | 235 |
| 164 | 3300005618 | Ga0068864_100013485 | Ga0068864_1000134855 | 235 |
| 165 | 3300005618 | Ga0068864_100793852 | Ga0068864_1007938522 | 235 |
| 166 | 3300005841 | Ga0068863_100022726 | Ga0068863_1000227263 | 235 |
| 167 | 3300005844 | Ga0068862_100249580 | Ga0068862_1002495802 | 235 |
| 168 | 3300006173 | Ga0070716_100072663 | Ga0070716_1000726632 | 235 |
| 169 | 3300006175 | Ga0070712_100002914 | Ga0070712_1000029148 | 235 |
| 170 | 3300006175 | Ga0070712_100204858 | Ga0070712_1002048581 | 235 |
| 171 | 3300006195 | Ga0075366_10049220 | Ga0075366_100492203 | 235 |
| 172 | 3300006358 | Ga0068871_100131164 | Ga0068871_1001311642 | 235 |
| 173 | 3300006846 | Ga0075430_100303448 | Ga0075430_1003034481 | 235 |
| 174 | 3300006871 | Ga0075434_100233773 | Ga0075434_1002337732 | 235 |
| 175 | 3300006914 | Ga0075436_100000023 | Ga0075436_100000023103 | 235 |
| 176 | 3300006914 | Ga0075436_100035481 | Ga0075436_1000354813 | 235 |
| 177 | 3300006914 | Ga0075436_100170471 | Ga0075436_1001704712 | 235 |
| 178 | 3300007076 | Ga0075435_100028059 | Ga0075435_1000280592 | 235 |
| 179 | 3300009093 | Ga0105240_10001135 | Ga0105240_1000113523 | 235 |
| 180 | 3300009093 | Ga0105240_10007836 | Ga0105240_1000783611 | 235 |
| 181 | 3300009093 | Ga0105240_10015791 | Ga0105240_100157916 | 235 |
| 182 | 3300009093 | Ga0105240_10016423 | Ga0105240_100164234 | 235 |
| 183 | 3300009093 | Ga0105240_10333539 | Ga0105240_103335392 | 235 |
| 184 | 3300009093 | Ga0105240_10567118 | Ga0105240_105671182 | 235 |
| 185 | 3300009094 | Ga0111539_10062518 | Ga0111539_100625183 | 235 |
| 186 | 3300009098 | Ga0105245_10785887 | Ga0105245_107858872 | 235 |
| 187 | 3300009101 | Ga0105247_10055927 | Ga0105247_100559272 | 235 |
| 188 | 3300009101 | Ga0105247_10166255 | Ga0105247_101662552 | 235 |
| 189 | 3300009174 | Ga0105241_10049668 | Ga0105241_100496683 | 235 |
| 190 | 3300009174 | Ga0105241_10184456 | Ga0105241_101844561 | 235 |
| 191 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001208 | 235 |
| 192 | 3300009177 | Ga0105248_10086327 | Ga0105248_100863274 | 235 |
| 193 | 3300009545 | Ga0105237_10005796 | Ga0105237_100057965 | 235 |
| 194 | 3300009545 | Ga0105237_10139699 | Ga0105237_101396992 | 235 |
| 195 | 3300009545 | Ga0105237_10482958 | Ga0105237_104829582 | 235 |
| 196 | 3300009551 | Ga0105238_10005700 | Ga0105238_100057003 | 235 |
| 197 | 3300009551 | Ga0105238_10010958 | Ga0105238_100109584 | 235 |
| 198 | 3300009551 | Ga0105238_10134932 | Ga0105238_101349323 | 235 |
| 199 | 3300010375 | Ga0105239_10000513 | Ga0105239_1000051318 | 235 |
| 200 | 3300010375 | Ga0105239_10000694 | Ga0105239_1000069428 | 235 |
| 201 | 3300010375 | Ga0105239_10117421 | Ga0105239_101174213 | 235 |
| 202 | 3300010375 | Ga0105239_10175291 | Ga0105239_101752912 | 235 |
| 203 | 3300010375 | Ga0105239_10305171 | Ga0105239_103051712 | 235 |
| 204 | 3300010375 | Ga0105239_11035247 | Ga0105239_110352471 | 235 |
| 205 | 3300013100 | Ga0157373_10004385 | Ga0157373_100043858 | 235 |
| 206 | 3300013104 | Ga0157370_10004544 | Ga0157370_100045448 | 235 |
| 207 | 3300013104 | Ga0157370_10132969 | Ga0157370_101329692 | 235 |
| 208 | 3300013105 | Ga0157369_10005962 | Ga0157369_100059626 | 235 |
| 209 | 3300013105 | Ga0157369_10066992 | Ga0157369_100669924 | 235 |
| 210 | 3300013296 | Ga0157374_10082693 | Ga0157374_100826934 | 235 |
| 211 | 3300013297 | Ga0157378_10122125 | Ga0157378_101221254 | 235 |
| 212 | 3300013297 | Ga0157378_10138420 | Ga0157378_101384202 | 235 |
| 213 | 3300013306 | Ga0163162_10481030 | Ga0163162_104810302 | 235 |
| 214 | 3300013307 | Ga0157372_10045612 | Ga0157372_100456123 | 235 |
| 215 | 3300013307 | Ga0157372_10048189 | Ga0157372_100481895 | 235 |
| 216 | 3300013307 | Ga0157372_10052770 | Ga0157372_100527702 | 235 |
| 217 | 3300013307 | Ga0157372_10062892 | Ga0157372_100628924 | 235 |
| 218 | 3300014968 | Ga0157379_10001171 | Ga0157379_1000117112 | 235 |
| 219 | 3300014968 | Ga0157379_10002326 | Ga0157379_1000232610 | 235 |
| 220 | 3300014968 | Ga0157379_10267690 | Ga0157379_102676902 | 235 |
| 221 | 3300014968 | Ga0157379_10268329 | Ga0157379_102683292 | 235 |
| 222 | 3300017792 | Ga0163161_10393420 | Ga0163161_103934202 | 235 |
| 223 | 3300021384 | Ga0213876_10000469 | Ga0213876_100004696 | 235 |
| 224 | 3300021384 | Ga0213876_10000586 | Ga0213876_1000058617 | 235 |
| 225 | 3300025292 | Ga0209676_1000272 | Ga0209676_10002729 | 235 |
| 226 | 3300025292 | Ga0209676_1000899 | Ga0209676_100089911 | 235 |
| 227 | 3300025295 | Ga0209564_1002018 | Ga0209564_10020184 | 235 |
| 228 | 3300025295 | Ga0209564_1029307 | Ga0209564_10293072 | 235 |
| 229 | 3300025297 | Ga0209758_1004244 | Ga0209758_10042444 | 235 |
| 230 | 3300025298 | Ga0209050_1000344 | Ga0209050_100034492 | 235 |
| 231 | 3300025298 | Ga0209050_1002568 | Ga0209050_10025689 | 235 |
| 232 | 3300025299 | Ga0209256_1000666 | Ga0209256_10006664 | 235 |
| 233 | 3300025299 | Ga0209256_1010423 | Ga0209256_10104233 | 235 |
| 234 | 3300025303 | Ga0209051_1000743 | Ga0209051_100074317 | 235 |
| 235 | 3300025304 | Ga0209257_1000066 | Ga0209257_1000066324 | 235 |
| 236 | 3300025304 | Ga0209257_1000624 | Ga0209257_100062424 | 235 |
| 237 | 3300025304 | Ga0209257_1020404 | Ga0209257_10204043 | 235 |
| 238 | 3300025903 | Ga0207680_10001384 | Ga0207680_100013847 | 235 |
| 239 | 3300025906 | Ga0207699_10000126 | Ga0207699_1000012620 | 235 |
| 240 | 3300025909 | Ga0207705_10000263 | Ga0207705_1000026326 | 235 |
| 241 | 3300025911 | Ga0207654_10319422 | Ga0207654_103194222 | 235 |
| 242 | 3300025912 | Ga0207707_10000005 | Ga0207707_10000005262 | 235 |
| 243 | 3300025912 | Ga0207707_10028347 | Ga0207707_100283472 | 235 |
| 244 | 3300025913 | Ga0207695_10000003 | Ga0207695_100000031235 | 235 |
| 245 | 3300025913 | Ga0207695_10002114 | Ga0207695_1000211411 | 235 |
| 246 | 3300025913 | Ga0207695_10028954 | Ga0207695_100289545 | 235 |
| 247 | 3300025913 | Ga0207695_10139002 | Ga0207695_101390022 | 235 |
| 248 | 3300025913 | Ga0207695_10144956 | Ga0207695_101449563 | 235 |
| 249 | 3300025913 | Ga0207695_10266654 | Ga0207695_102666542 | 235 |
| 250 | 3300025914 | Ga0207671_10012710 | Ga0207671_100127105 | 235 |
| 251 | 3300025915 | Ga0207693_10002754 | Ga0207693_100027545 | 235 |
| 252 | 3300025915 | Ga0207693_10309015 | Ga0207693_103090152 | 235 |
| 253 | 3300025916 | Ga0207663_10345474 | Ga0207663_103454742 | 235 |
| 254 | 3300025916 | Ga0207663_10394660 | Ga0207663_103946602 | 235 |
| 255 | 3300025917 | Ga0207660_10004821 | Ga0207660_100048216 | 235 |
| 256 | 3300025917 | Ga0207660_10005434 | Ga0207660_100054348 | 235 |
| 257 | 3300025919 | Ga0207657_10000114 | Ga0207657_1000011437 | 235 |
| 258 | 3300025920 | Ga0207649_10009157 | Ga0207649_100091575 | 235 |
| 259 | 3300025921 | Ga0207652_10000320 | Ga0207652_1000032017 | 235 |
| 260 | 3300025921 | Ga0207652_10005507 | Ga0207652_100055073 | 235 |
| 261 | 3300025922 | Ga0207646_10029610 | Ga0207646_100296103 | 235 |
| 262 | 3300025924 | Ga0207694_10000005 | Ga0207694_10000005665 | 235 |
| 263 | 3300025924 | Ga0207694_10028078 | Ga0207694_100280784 | 235 |
| 264 | 3300025924 | Ga0207694_10095576 | Ga0207694_100955763 | 235 |
| 265 | 3300025928 | Ga0207700_10000010 | Ga0207700_10000010123 | 235 |
| 266 | 3300025929 | Ga0207664_10046955 | Ga0207664_100469554 | 235 |
| 267 | 3300025929 | Ga0207664_10191132 | Ga0207664_101911322 | 235 |
| 268 | 3300025931 | Ga0207644_10015582 | Ga0207644_100155823 | 235 |
| 269 | 3300025932 | Ga0207690_10151904 | Ga0207690_101519042 | 235 |
| 270 | 3300025939 | Ga0207665_10071107 | Ga0207665_100711072 | 235 |
| 271 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002909 | 235 |
| 272 | 3300025949 | Ga0207667_10000183 | Ga0207667_1000018327 | 235 |
| 273 | 3300025949 | Ga0207667_10018054 | Ga0207667_100180544 | 235 |
| 274 | 3300025981 | Ga0207640_10280436 | Ga0207640_102804362 | 235 |
| 275 | 3300026041 | Ga0207639_10013017 | Ga0207639_100130174 | 235 |
| 276 | 3300026041 | Ga0207639_10024671 | Ga0207639_100246712 | 235 |
| 277 | 3300026041 | Ga0207639_10601091 | Ga0207639_106010912 | 235 |
| 278 | 3300026067 | Ga0207678_10271332 | Ga0207678_102713322 | 235 |
| 279 | 3300026078 | Ga0207702_10000013 | Ga0207702_10000013164 | 235 |
| 280 | 3300026078 | Ga0207702_10001346 | Ga0207702_100013469 | 235 |
| 281 | 3300026088 | Ga0207641_10000277 | Ga0207641_1000027712 | 235 |
| 282 | 3300026088 | Ga0207641_10011325 | Ga0207641_100113253 | 235 |
| 283 | 3300026095 | Ga0207676_10000600 | Ga0207676_1000060027 | 235 |
| 284 | 3300026095 | Ga0207676_10228387 | Ga0207676_102283872 | 235 |
| 285 | 3300026116 | Ga0207674_10001730 | Ga0207674_1000173014 | 235 |
| 286 | 3300028379 | Ga0268266_10419396 | Ga0268266_104193962 | 235 |
| 287 | 3300028556 | Ga0265337_1003661 | Ga0265337_10036612 | 235 |
| 288 | 3300028573 | Ga0265334_10003731 | Ga0265334_100037315 | 235 |
| 289 | 3300028577 | Ga0265318_10000436 | Ga0265318_1000043626 | 235 |
| 290 | 3300028577 | Ga0265318_10046087 | Ga0265318_100460871 | 235 |
| 291 | 3300028794 | Ga0307515_10058728 | Ga0307515_100587283 | 235 |
| 292 | 3300028794 | Ga0307515_10105570 | Ga0307515_101055701 | 235 |
| 293 | 3300028800 | Ga0265338_10000006 | Ga0265338_1000000614 | 235 |
| 294 | 3300028800 | Ga0265338_10019953 | Ga0265338_100199537 | 235 |
| 295 | 3300028800 | Ga0265338_10031329 | Ga0265338_100313295 | 235 |
| 296 | 3300028800 | Ga0265338_10121670 | Ga0265338_101216702 | 235 |
| 297 | 3300031235 | Ga0265330_10007638 | Ga0265330_100076385 | 235 |
| 298 | 3300031238 | Ga0265332_10040969 | Ga0265332_100409692 | 235 |
| 299 | 3300031238 | Ga0265332_10119737 | Ga0265332_101197371 | 235 |
| 300 | 3300031240 | Ga0265320_10000807 | Ga0265320_1000080724 | 235 |
| 301 | 3300031241 | Ga0265325_10000007 | Ga0265325_1000000714 | 235 |
| 302 | 3300031242 | Ga0265329_10050804 | Ga0265329_100508042 | 235 |
| 303 | 3300031247 | Ga0265340_10000115 | Ga0265340_1000011542 | 235 |
| 304 | 3300031247 | Ga0265340_10000844 | Ga0265340_100008446 | 235 |
| 305 | 3300031247 | Ga0265340_10018845 | Ga0265340_100188453 | 235 |
| 306 | 3300031247 | Ga0265340_10032445 | Ga0265340_100324452 | 235 |
| 307 | 3300031247 | Ga0265340_10040327 | Ga0265340_100403272 | 235 |
| 308 | 3300031247 | Ga0265340_10107060 | Ga0265340_101070602 | 235 |
| 309 | 3300031249 | Ga0265339_10001769 | Ga0265339_100017695 | 235 |
| 310 | 3300031249 | Ga0265339_10053799 | Ga0265339_100537992 | 235 |
| 311 | 3300031249 | Ga0265339_10106389 | Ga0265339_101063892 | 235 |
| 312 | 3300031250 | Ga0265331_10000006 | Ga0265331_1000000612 | 235 |
| 313 | 3300031250 | Ga0265331_10002860 | Ga0265331_1000286010 | 235 |
| 314 | 3300031250 | Ga0265331_10006743 | Ga0265331_100067432 | 235 |
| 315 | 3300031250 | Ga0265331_10026162 | Ga0265331_100261623 | 235 |
| 316 | 3300031251 | Ga0265327_10000430 | Ga0265327_1000043039 | 235 |
| 317 | 3300031344 | Ga0265316_10014699 | Ga0265316_100146996 | 235 |
| 318 | 3300031344 | Ga0265316_10019198 | Ga0265316_100191985 | 235 |
| 319 | 3300031344 | Ga0265316_10052990 | Ga0265316_100529902 | 235 |
| 320 | 3300031344 | Ga0265316_10119102 | Ga0265316_101191022 | 235 |
| 321 | 3300031344 | Ga0265316_10184079 | Ga0265316_101840792 | 235 |
| 322 | 3300031344 | Ga0265316_10415230 | Ga0265316_104152301 | 235 |
| 323 | 3300031595 | Ga0265313_10002331 | Ga0265313_1000233117 | 235 |
| 324 | 3300031595 | Ga0265313_10020238 | Ga0265313_100202382 | 235 |
| 325 | 3300031595 | Ga0265313_10026131 | Ga0265313_100261312 | 235 |
| 326 | 3300031711 | Ga0265314_10004741 | Ga0265314_100047411 | 235 |
| 327 | 3300031711 | Ga0265314_10041163 | Ga0265314_100411633 | 235 |
| 328 | 3300031711 | Ga0265314_10148944 | Ga0265314_101489442 | 235 |
| 329 | 3300031712 | Ga0265342_10024454 | Ga0265342_100244543 | 235 |
| 330 | 3300031712 | Ga0265342_10036320 | Ga0265342_100363202 | 235 |
| 331 | 3300031712 | Ga0265342_10050131 | Ga0265342_100501311 | 235 |
| 332 | 3300031730 | Ga0307516_10013579 | Ga0307516_100135798 | 235 |
| 333 | 3300031901 | Ga0307406_10413477 | Ga0307406_104134772 | 235 |
| 334 | 3300032002 | Ga0307416_100348657 | Ga0307416_1003486572 | 235 |
| 335 | 3300035091 | Ga0373951_0089688 | Ga0373951_0089688_19_744 | 235 |
| 336 | 3300035118 | Ga0373954_0031633 | Ga0373954_0031633_1591_2391 | 235 |
| 337 | 3300035172 | Ga0373955_0067965 | Ga0373955_0067965_112_885 | 235 |
| 338 | 3300035207 | Ga0373942_0011104 | Ga0373942_0011104_813_1589 | 235 |
| 339 | 3300035691 | Ga0373931_0013868 | Ga0373931_0013868_1479_2252 | 235 |
| 340 | 3300035692 | Ga0373935_0010737 | Ga0373935_0010737_4300_5073 | 235 |
| 341 | 3300035692 | Ga0373935_0114475 | Ga0373935_0114475_868_1641 | 235 |
| 342 | 3300035695 | Ga0373927_0103654 | Ga0373927_0103654_439_1212 | 235 |
| 343 | 3300035724 | Ga0373933_0026091 | Ga0373933_0026091_1243_2016 | 235 |
| 344 | 3300035724 | Ga0373933_0028923 | Ga0373933_0028923_1492_2337 | 235 |
| 345 | 3300035724 | Ga0373933_0141973 | Ga0373933_0141973_389_1162 | 235 |
| 346 | 3300035725 | Ga0373947_0024952 | Ga0373947_0024952_797_1570 | 235 |
| 347 | 3300036401 | Ga0373937_0013134 | Ga0373937_0013134_5614_6387 | 235 |
| 348 | 3300036401 | Ga0373937_0024641 | Ga0373937_0024641_4591_5391 | 235 |
| 349 | 3300036401 | Ga0373937_0052403 | Ga0373937_0052403_981_1826 | 235 |
| 350 | 3300036401 | Ga0373937_0284310 | Ga0373937_0284310_229_1002 | 235 |
| 351 | 3300037068 | Ga0373925_0007893 | Ga0373925_0007893_507_1280 | 235 |
| 352 | 3300037068 | Ga0373925_0154626 | Ga0373925_0154626_952_1725 | 235 |
| 353 | 3300037068 | Ga0373925_0270492 | Ga0373925_0270492_375_1166 | 235 |
| 354 | 3300037471 | Ga0395905_0913943 | Ga0395905_0913943_17_730 | 235 |
| 355 | 3300039437 | Ga0436365_0073850 | Ga0436365_0073850_12048_12821 | 235 |
| 356 | 3300039437 | Ga0436365_0508484 | Ga0436365_0508484_79510_80286 | 235 |
| 357 | 3300039447 | Ga0436361_0858734 | Ga0436361_0858734_284_1090 | 235 |
| 358 | 3300039450 | Ga0436363_0405125 | Ga0436363_0405125_216_989 | 235 |
| 359 | 3300041512 | Ga0451853_2643851 | Ga0451853_2643851_1973_2779 | 235 |
| 360 | 3300042156 | Ga0439446_0064877 | Ga0439446_0064877_37_843 | 235 |
| 361 | 3300042461 | Ga0439460_0008844 | Ga0439460_0008844_1150_1944 | 235 |
| 362 | 3300046453 | Ga0495627_000751 | Ga0495627_000751_228_1034 | 235 |
| 363 | 3300046454 | Ga0495592_0114085 | Ga0495592_0114085_1058_1834 | 235 |
| 364 | 3300046455 | Ga0495603_0059861 | Ga0495603_0059861_1328_2104 | 235 |
| 365 | 3300046457 | Ga0495590_0003110 | Ga0495590_0003110_365_1150 | 235 |
| 366 | 3300046460 | Ga0495638_0000283 | Ga0495638_0000283_39744_40529 | 235 |
| 367 | 3300046460 | Ga0495638_0001944 | Ga0495638_0001944_15130_15936 | 235 |
| 368 | 3300046460 | Ga0495638_0002498 | Ga0495638_0002498_3554_4360 | 235 |
| 369 | 3300046460 | Ga0495638_0006034 | Ga0495638_0006034_6342_7148 | 235 |
| 370 | 3300046471 | Ga0495650_0024719 | Ga0495650_0024719_1979_2764 | 235 |
| 371 | 3300046473 | Ga0495582_0043843 | Ga0495582_0043843_50_823 | 235 |
| 372 | 3300046506 | Ga0495583_0000234 | Ga0495583_0000234_42212_43018 | 235 |
| 373 | 3300046512 | Ga0495610_0000158 | Ga0495610_0000158_50866_51672 | 235 |
| 374 | 3300046512 | Ga0495610_0001132 | Ga0495610_0001132_8766_9551 | 235 |
| 375 | 3300046512 | Ga0495610_0007739 | Ga0495610_0007739_2455_3261 | 235 |
| 376 | 3300046518 | Ga0495631_0007917 | Ga0495631_0007917_2324_3109 | 235 |
| 377 | 3300046518 | Ga0495631_0046806 | Ga0495631_0046806_889_1695 | 235 |
| 378 | 3300046519 | Ga0495632_0046359 | Ga0495632_0046359_615_1421 | 235 |
| 379 | 3300046520 | Ga0495637_0051691 | Ga0495637_0051691_145_930 | 235 |
| 380 | 3300046522 | Ga0495643_0077621 | Ga0495643_0077621_574_1383 | 235 |
| 381 | 3300046522 | Ga0495643_0151891 | Ga0495643_0151891_322_1128 | 235 |
| 382 | 3300046524 | Ga0495648_0000098 | Ga0495648_0000098_78745_79551 | 235 |
| 383 | 3300046530 | Ga0495654_0046723 | Ga0495654_0046723_694_1479 | 235 |
| 384 | 3300046531 | Ga0495665_0068846 | Ga0495665_0068846_128_901 | 235 |
| 385 | 3300046543 | Ga0495645_0015164 | Ga0495645_0015164_1987_2763 | 235 |
| 386 | 3300046557 | Ga0495622_0011314 | Ga0495622_0011314_356_1132 | 235 |
| 387 | 3300046558 | Ga0495633_0094799 | Ga0495633_0094799_376_1197 | 235 |
| 388 | 3300046616 | Ga0495668_0000389 | Ga0495668_0000389_46292_47101 | 235 |
| 389 | 3300046616 | Ga0495668_0003334 | Ga0495668_0003334_3933_4718 | 235 |
| 390 | 3300046616 | Ga0495668_0006115 | Ga0495668_0006115_7143_7952 | 235 |
| 391 | 3300046642 | Ga0495634_0349436 | Ga0495634_0349436_64_840 | 235 |
| 392 | 3300046660 | Ga0495625_0000058 | Ga0495625_0000058_43957_44763 | 235 |
| 393 | 3300046660 | Ga0495625_0000864 | Ga0495625_0000864_20218_21024 | 235 |
| 394 | 3300046660 | Ga0495625_0001132 | Ga0495625_0001132_2016_2822 | 235 |
| 395 | 3300046660 | Ga0495625_0030943 | Ga0495625_0030943_1327_2136 | 235 |
| 396 | 3300046660 | Ga0495625_0146420 | Ga0495625_0146420_515_1321 | 235 |
| 397 | 3300046678 | Ga0495599_0049698 | Ga0495599_0049698_929_1705 | 235 |
| 398 | 3300046683 | Ga0495658_0001976 | Ga0495658_0001976_1014_1787 | 235 |
| 399 | 3300046683 | Ga0495658_0063530 | Ga0495658_0063530_930_1706 | 235 |
| 400 | 3300046689 | Ga0495613_0047071 | Ga0495613_0047071_333_1106 | 235 |
| 401 | 3300046692 | Ga0495671_0106929 | Ga0495671_0106929_396_1181 | 235 |
| 402 | 3300046794 | Ga0495589_0039090 | Ga0495589_0039090_896_1702 | 235 |
| 403 | 3300047320 | Ga0495672_0024447 | Ga0495672_0024447_2246_3052 | 235 |
| 404 | 3300047444 | Ga0495675_0013756 | Ga0495675_0013756_3630_4406 | 235 |
| 405 | 3300047446 | Ga0495679_021927 | Ga0495679_021927_1056_1862 | 235 |
| 406 | 3300047469 | Ga0495673_0000428 | Ga0495673_0000428_39721_40527 | 235 |
| 407 | 3300047469 | Ga0495673_0000492 | Ga0495673_0000492_18178_18963 | 235 |
| 408 | 3300047472 | Ga0495686_0000863 | Ga0495686_0000863_13900_14685 | 235 |
| 409 | 3300047472 | Ga0495686_0009487 | Ga0495686_0009487_6100_6906 | 235 |
| 410 | 3300048088 | Ga0495602_0243771 | Ga0495602_0243771_202_975 | 235 |
| 411 | 3300048909 | Ga0496106_0011902 | Ga0496106_0011902_2298_3104 | 235 |
| 412 | 3300048910 | Ga0496107_0000067 | Ga0496107_0000067_34964_35770 | 235 |
| 413 | 3300048924 | Ga0496121_0000266 | Ga0496121_0000266_19668_20474 | 235 |
| 414 | 3300048924 | Ga0496121_0003464 | Ga0496121_0003464_4589_5386 | 235 |
| 415 | 3300048924 | Ga0496121_0075693 | Ga0496121_0075693_332_1144 | 235 |
| 416 | 3300048927 | Ga0496124_0028058 | Ga0496124_0028058_2405_3226 | 235 |
| 417 | 3300048928 | Ga0496125_0072951 | Ga0496125_0072951_752_1561 | 235 |
| 418 | 3300048929 | Ga0496126_0000542 | Ga0496126_0000542_29313_30089 | 235 |
| 419 | 3300048929 | Ga0496126_0009144 | Ga0496126_0009144_2728_3537 | 235 |
| 420 | 3300048929 | Ga0496126_0236153 | Ga0496126_0236153_226_1023 | 235 |
| 421 | 3300049459 | Ga0495678_009454 | Ga0495678_009454_215_1000 | 235 |
| 422 | 3300049460 | Ga0495682_0059023 | Ga0495682_0059023_199_975 | 235 |
| 423 | 3300049568 | Ga0501031_0190838 | Ga0501031_0190838_23_796 | 235 |
| 424 | 3300049570 | Ga0501033_0014156 | Ga0501033_0014156_2866_3639 | 235 |
| 425 | 3300049570 | Ga0501033_0082811 | Ga0501033_0082811_515_1288 | 235 |
| 426 | 3300049571 | Ga0501034_0029743 | Ga0501034_0029743_3390_4163 | 235 |
| 427 | 3300049571 | Ga0501034_0111134 | Ga0501034_0111134_390_1220 | 235 |
| 428 | 3300049572 | Ga0501036_0039405 | Ga0501036_0039405_1894_2619 | 235 |
| 429 | 3300049572 | Ga0501036_0057057 | Ga0501036_0057057_2523_3296 | 235 |
| 430 | 3300049573 | Ga0501037_0447845 | Ga0501037_0447845_46_819 | 235 |
| 431 | 3300049574 | Ga0501038_0053264 | Ga0501038_0053264_1630_2403 | 235 |
| 432 | 3300049574 | Ga0501038_0079962 | Ga0501038_0079962_1619_2392 | 235 |
| 433 | 3300049576 | Ga0501040_0006325 | Ga0501040_0006325_4584_5309 | 235 |
| 434 | 3300049577 | Ga0501041_0026403 | Ga0501041_0026403_1113_1838 | 235 |
| 435 | 3300049578 | Ga0501042_0200924 | Ga0501042_0200924_432_1157 | 235 |
| 436 | 3300049579 | Ga0501043_0288346 | Ga0501043_0288346_281_1054 | 235 |
| 437 | 3300049579 | Ga0501043_0617511 | Ga0501043_0617511_26_751 | 235 |
| 438 | 3300049580 | Ga0501046_0013015 | Ga0501046_0013015_4578_5303 | 235 |
| 439 | 3300049580 | Ga0501046_0379608 | Ga0501046_0379608_15_788 | 235 |
| 440 | 3300049581 | Ga0501047_0006146 | Ga0501047_0006146_1548_2321 | 235 |
| 441 | 3300049581 | Ga0501047_0304684 | Ga0501047_0304684_25_798 | 235 |
| 442 | 3300049582 | Ga0501048_0125885 | Ga0501048_0125885_46_771 | 235 |
| 443 | 3300049583 | Ga0501067_0007275 | Ga0501067_0007275_2173_2946 | 235 |
| 444 | 3300049583 | Ga0501067_0035034 | Ga0501067_0035034_244_1017 | 235 |
| 445 | 3300049584 | Ga0501068_0161264 | Ga0501068_0161264_245_1018 | 235 |
| 446 | 3300049586 | Ga0501070_0000047 | Ga0501070_0000047_82328_83101 | 235 |
| 447 | 3300049586 | Ga0501070_0003346 | Ga0501070_0003346_9663_10436 | 235 |
| 448 | 3300049586 | Ga0501070_0435401 | Ga0501070_0435401_127_903 | 235 |
| 449 | 3300049587 | Ga0501071_0346469 | Ga0501071_0346469_31_828 | 235 |
| 450 | 3300049588 | Ga0501072_0238499 | Ga0501072_0238499_412_1137 | 235 |
| 451 | 3300049589 | Ga0501073_0009287 | Ga0501073_0009287_184_957 | 235 |
| 452 | 3300049589 | Ga0501073_0123937 | Ga0501073_0123937_559_1335 | 235 |
| 453 | 3300049589 | Ga0501073_0297523 | Ga0501073_0297523_166_939 | 235 |
| 454 | 3300049590 | Ga0501074_0095157 | Ga0501074_0095157_425_1198 | 235 |
| 455 | 3300049590 | Ga0501074_0124995 | Ga0501074_0124995_72_845 | 235 |
| 456 | 3300049593 | Ga0501077_0085425 | Ga0501077_0085425_682_1407 | 235 |
| 457 | 3300049741 | Ga0501079_0066502 | Ga0501079_0066502_2044_2769 | 235 |
| 458 | 3300049741 | Ga0501079_0102868 | Ga0501079_0102868_803_1576 | 235 |
| 459 | 3300049741 | Ga0501079_0261600 | Ga0501079_0261600_337_1110 | 235 |
| 460 | 3300049742 | Ga0501080_0000366 | Ga0501080_0000366_14689_15462 | 235 |
| 461 | 3300049742 | Ga0501080_0188883 | Ga0501080_0188883_53_826 | 235 |
| 462 | 3300049822 | Ga0501035_0006816 | Ga0501035_0006816_8693_9466 | 235 |
| 463 | 3300049822 | Ga0501035_0039552 | Ga0501035_0039552_2966_3739 | 235 |
| 464 | 3300049823 | Ga0501044_0019366 | Ga0501044_0019366_3024_3797 | 235 |
| 465 | 3300049823 | Ga0501044_0033137 | Ga0501044_0033137_1391_2164 | 235 |
| 466 | 3300049823 | Ga0501044_0039259 | Ga0501044_0039259_1372_2145 | 235 |
| 467 | 3300049823 | Ga0501044_0109480 | Ga0501044_0109480_110_883 | 235 |
| 468 | 3300049823 | Ga0501044_0380390 | Ga0501044_0380390_70_843 | 235 |
| 469 | 3300050509 | nmdc:mga0qj67_289663_c1 | nmdc:mga0qj67_289663_c1_18_764 | 235 |
| 470 | 3300050512 | nmdc:mga0n895_41051_c1 | nmdc:mga0n895_41051_c1_3082_3855 | 235 |
| 471 | 3300050513 | nmdc:mga0rr50_5661_c1 | nmdc:mga0rr50_5661_c1_3540_4313 | 235 |
| 472 | 3300050514 | nmdc:mga08x19_123936_c1 | nmdc:mga08x19_123936_c1_405_1178 | 235 |
| 473 | 3300050514 | nmdc:mga08x19_50_c1 | nmdc:mga08x19_50_c1_28976_29749 | 235 |
| 474 | 3300053080 | Ga0500635_0028003 | Ga0500635_0028003_772_1548 | 235 |
| 475 | 3300053086 | Ga0500578_0000270 | Ga0500578_0000270_18214_18999 | 235 |
| 476 | 3300053088 | Ga0500644_0000665 | Ga0500644_0000665_6412_7233 | 235 |
| 477 | 3300053088 | Ga0500644_0000688 | Ga0500644_0000688_6317_7102 | 235 |
| 478 | 3300053090 | Ga0500646_0039154 | Ga0500646_0039154_30_806 | 235 |
| 479 | 3300053102 | Ga0500554_007983 | Ga0500554_007983_644_1450 | 235 |
| 480 | 3300053103 | Ga0500555_001311 | Ga0500555_001311_622_1395 | 235 |
| 481 | 3300053104 | Ga0500556_0033045 | Ga0500556_0033045_317_1102 | 235 |
| 482 | 3300053108 | Ga0500562_001389 | Ga0500562_001389_1113_1898 | 235 |
| 483 | 3300053118 | Ga0500594_0001228 | Ga0500594_0001228_1767_2552 | 235 |
| 484 | 3300053122 | Ga0500608_000382 | Ga0500608_000382_2117_2929 | 235 |
| 485 | 3300053123 | Ga0500614_005558 | Ga0500614_005558_766_1572 | 235 |
| 486 | 3300053125 | Ga0500618_000185 | Ga0500618_000185_42731_43537 | 235 |
| 487 | 3300053134 | Ga0500658_0001423 | Ga0500658_0001423_3273_4079 | 235 |
| 488 | 3300053136 | Ga0500559_0000056 | Ga0500559_0000056_52369_53175 | 235 |
| 489 | 3300053136 | Ga0500559_0001893 | Ga0500559_0001893_8837_9649 | 235 |
| 490 | 3300053138 | Ga0500564_000033 | Ga0500564_000033_8243_9028 | 235 |
| 491 | 3300053142 | Ga0500577_0001288 | Ga0500577_0001288_3279_4088 | 235 |
| 492 | 3300053154 | Ga0500619_054569 | Ga0500619_054569_248_1024 | 235 |
| 493 | 3300053156 | Ga0500622_0000553 | Ga0500622_0000553_1260_2045 | 235 |
| 494 | 3300053156 | Ga0500622_0012270 | Ga0500622_0012270_1172_1981 | 235 |
| 495 | 3300053178 | Ga0500637_0000212 | Ga0500637_0000212_19117_19893 | 235 |
| 496 | 3300054114 | Ga0501084_0010924 | Ga0501084_0010924_1681_2406 | 235 |
| 497 | 3300060353 | Ga0501082_0008707 | Ga0501082_0008707_3775_4500 | 235 |
| 498 | 3300061734 | Ga0530510_0075573 | Ga0530510_0075573_84_809 | 235 |
| 499 | iso_pu_bacteria | 2582581279 | 2585149712 | 235 |
| 500 | iso_pu_bacteria | 2582581280 | 2585154934 | 235 |
| 501 | iso_pu_bacteria | 2585428106 | 2587915768 | 235 |
| 502 | iso_pu_bacteria | 2643221640 | 2644223319 | 235 |
| 503 | iso_pu_bacteria | 2643221642 | 2644236411 | 235 |
| 504 | iso_pu_bacteria | 2849560528 | 2849563895 | 235 |
| 505 | iso_pu_bacteria | 2849573788 | 2849578740 | 235 |
| 506 | iso_pu_bacteria | 2857504554 | 2857505695 | 235 |
| 507 | iso_pu_bacteria | 2884960567 | 2884965512 | 235 |
| 508 | iso_pu_bacteria | 2928531327 | 2928532202 | 235 |
| 509 | 3300001989 | JGI24739J22299_10003190 | JGI24739J22299_100031906 | 236 |
| 510 | 3300001989 | JGI24739J22299_10038795 | JGI24739J22299_100387952 | 236 |
| 511 | 3300005295 | Ga0065707_10082679 | Ga0065707_100826795 | 236 |
| 512 | 3300005295 | Ga0065707_10086182 | Ga0065707_100861822 | 236 |
| 513 | 3300005331 | Ga0070670_100000005 | Ga0070670_100000005120 | 236 |
| 514 | 3300005347 | Ga0070668_100166645 | Ga0070668_1001666452 | 236 |
| 515 | 3300005353 | Ga0070669_100000195 | Ga0070669_10000019530 | 236 |
| 516 | 3300005367 | Ga0070667_100001850 | Ga0070667_10000185015 | 236 |
| 517 | 3300005539 | Ga0068853_100011500 | Ga0068853_1000115005 | 236 |
| 518 | 3300005577 | Ga0068857_100142709 | Ga0068857_1001427092 | 236 |
| 519 | 3300005616 | Ga0068852_100317212 | Ga0068852_1003172121 | 236 |
| 520 | 3300005617 | Ga0068859_100010247 | Ga0068859_1000102475 | 236 |
| 521 | 3300005618 | Ga0068864_100000011 | Ga0068864_100000011119 | 236 |
| 522 | 3300005719 | Ga0068861_100034416 | Ga0068861_1000344164 | 236 |
| 523 | 3300005841 | Ga0068863_100053251 | Ga0068863_1000532514 | 236 |
| 524 | 3300005844 | Ga0068862_100000011 | Ga0068862_100000011117 | 236 |
| 525 | 3300006931 | Ga0097620_100010246 | Ga0097620_1000102465 | 236 |
| 526 | 3300009177 | Ga0105248_10000069 | Ga0105248_1000006991 | 236 |
| 527 | 3300009545 | Ga0105237_10018738 | Ga0105237_100187382 | 236 |
| 528 | 3300009551 | Ga0105238_10038976 | Ga0105238_100389762 | 236 |
| 529 | 3300012513 | Ga0157326_1000424 | Ga0157326_10004245 | 236 |
| 530 | 3300014325 | Ga0163163_10059627 | Ga0163163_100596272 | 236 |
| 531 | 3300014326 | Ga0157380_10003531 | Ga0157380_1000353111 | 236 |
| 532 | 3300021384 | Ga0213876_10026209 | Ga0213876_100262093 | 236 |
| 533 | 3300025914 | Ga0207671_10004851 | Ga0207671_1000485110 | 236 |
| 534 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001540 | 236 |
| 535 | 3300025924 | Ga0207694_10047323 | Ga0207694_100473234 | 236 |
| 536 | 3300025925 | Ga0207650_10000018 | Ga0207650_10000018120 | 236 |
| 537 | 3300025933 | Ga0207706_10002602 | Ga0207706_100026023 | 236 |
| 538 | 3300025972 | Ga0207668_10071530 | Ga0207668_100715302 | 236 |
| 539 | 3300025981 | Ga0207640_10077579 | Ga0207640_100775792 | 236 |
| 540 | 3300025986 | Ga0207658_10000902 | Ga0207658_100009029 | 236 |
| 541 | 3300026041 | Ga0207639_10004074 | Ga0207639_100040747 | 236 |
| 542 | 3300026088 | Ga0207641_10041166 | Ga0207641_100411664 | 236 |
| 543 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004513 | 236 |
| 544 | 3300026116 | Ga0207674_10077154 | Ga0207674_100771543 | 236 |
| 545 | 3300026118 | Ga0207675_100004115 | Ga0207675_10000411512 | 236 |
| 546 | 3300026142 | Ga0207698_10101748 | Ga0207698_101017482 | 236 |
| 547 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002557 | 236 |
| 548 | 3300031901 | Ga0307406_10021598 | Ga0307406_100215985 | 236 |
| 549 | 3300031911 | Ga0307412_10028714 | Ga0307412_100287143 | 236 |
| 550 | 3300032002 | Ga0307416_100313733 | Ga0307416_1003137332 | 236 |
| 551 | 3300035695 | Ga0373927_0056036 | Ga0373927_0056036_572_1366 | 236 |
| 552 | 3300035725 | Ga0373947_0149494 | Ga0373947_0149494_196_990 | 236 |
| 553 | 3300039437 | Ga0436365_1535986 | Ga0436365_1535986_1481_2260 | 236 |
| 554 | 3300046460 | Ga0495638_0044711 | Ga0495638_0044711_1295_2092 | 236 |
| 555 | 3300046522 | Ga0495643_0058055 | Ga0495643_0058055_206_1000 | 236 |
| 556 | 3300046522 | Ga0495643_0079090 | Ga0495643_0079090_94_888 | 236 |
| 557 | 3300046530 | Ga0495654_0000264 | Ga0495654_0000264_27763_28503 | 236 |
| 558 | 3300046539 | Ga0495621_0043406 | Ga0495621_0043406_135_929 | 236 |
| 559 | 3300046616 | Ga0495668_0000984 | Ga0495668_0000984_17984_18724 | 236 |
| 560 | 3300046660 | Ga0495625_0154451 | Ga0495625_0154451_279_1073 | 236 |
| 561 | 3300047472 | Ga0495686_0000201 | Ga0495686_0000201_73137_73934 | 236 |
| 562 | 3300047472 | Ga0495686_0001890 | Ga0495686_0001890_13172_13969 | 236 |
| 563 | 3300047472 | Ga0495686_0021547 | Ga0495686_0021547_1353_2150 | 236 |
| 564 | 3300048906 | Ga0496103_0000173 | Ga0496103_0000173_37806_38606 | 236 |
| 565 | 3300048919 | Ga0496116_0000566 | Ga0496116_0000566_29036_29836 | 236 |
| 566 | 3300048920 | Ga0496117_0000485 | Ga0496117_0000485_28004_28804 | 236 |
| 567 | 3300048920 | Ga0496117_0021462 | Ga0496117_0021462_2580_3377 | 236 |
| 568 | 3300048921 | Ga0496118_0000190 | Ga0496118_0000190_28004_28804 | 236 |
| 569 | 3300048921 | Ga0496118_0013898 | Ga0496118_0013898_5031_5828 | 236 |
| 570 | 3300048922 | Ga0496119_0112936 | Ga0496119_0112936_36_833 | 236 |
| 571 | 3300048923 | Ga0496120_0023669 | Ga0496120_0023669_2169_2969 | 236 |
| 572 | 3300048924 | Ga0496121_0008737 | Ga0496121_0008737_4709_5506 | 236 |
| 573 | 3300048924 | Ga0496121_0061195 | Ga0496121_0061195_1835_2632 | 236 |
| 574 | 3300048927 | Ga0496124_0000546 | Ga0496124_0000546_34821_35621 | 236 |
| 575 | 3300049679 | Ga0501249_006802 | Ga0501249_006802_694_1476 | 236 |
| 576 | 3300049823 | Ga0501044_0061340 | Ga0501044_0061340_1419_2216 | 236 |
| 577 | 3300053093 | Ga0500651_0058051 | Ga0500651_0058051_849_1643 | 236 |
| 578 | 3300053096 | Ga0500641_0015395 | Ga0500641_0015395_943_1737 | 236 |
| 579 | 3300053098 | Ga0500650_0192337 | Ga0500650_0192337_11_805 | 236 |
| 580 | 3300053130 | Ga0500642_0086375 | Ga0500642_0086375_370_1164 | 236 |
| 581 | 3300053133 | Ga0500655_000052 | Ga0500655_000052_23447_24241 | 236 |
| 582 | 3300053136 | Ga0500559_0007037 | Ga0500559_0007037_3225_4022 | 236 |
| 583 | 3300053136 | Ga0500559_0027225 | Ga0500559_0027225_1181_1978 | 236 |
| 584 | 3300053148 | Ga0500590_002752 | Ga0500590_002752_950_1744 | 236 |
| 585 | 3300053156 | Ga0500622_0008348 | Ga0500622_0008348_716_1510 | 236 |
| 586 | 3300053158 | Ga0500627_0000188 | Ga0500627_0000188_194_934 | 236 |
| 587 | 3300053163 | Ga0500639_064582 | Ga0500639_064582_1069_1863 | 236 |
| 588 | 3300053724 | Ga0500570_000179 | Ga0500570_000179_7521_8315 | 236 |
| 589 | iso_pu_bacteria | 2582581305 | 2585263237 | 236 |
| 590 | iso_pu_bacteria | 2643221541 | 2643730537 | 236 |
| 591 | iso_pu_bacteria | 2643221605 | 2644037513 | 236 |
| 592 | iso_pu_bacteria | 2643221606 | 2644043706 | 236 |
| 593 | iso_pu_bacteria | 2643221671 | 2644393865 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fee-assembly1.cif.gz_I | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.9539 | 2 | 233 |
| 7d06-assembly1.cif.gz_D | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.9447 | 2 | 236 |
| 7d06-assembly1.cif.gz_D | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.937 | 2 | 236 |
| 8fee-assembly1.cif.gz_I | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.9345 | 2 | 233 |
| 6z5u-assembly1.cif.gz_B | cryo-em structure of the a. baumannii mlabdef complex bound to appnhp | 0.9336 | 2 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DBB5_96_268_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.4414 | 35 | 232 | 1.10.357.20 |
| af_Q9V3Y4_23_306_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.4246 | 75 | 227 | 1.50.40.10 |
| af_Q4DBB5_96_268_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.4181 | 35 | 232 | 1.10.357.20 |
| af_A0A0P0X1Q4_273_431_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4156 | 37 | 224 | 1.20.1250.20 |
| af_A0A1D6PYN6_84_244_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.4101 | 37 | 231 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0U5EW34-F1-model_v4 | ABC transporter permease | 0.9858 | 2 | 235 |
GO:0005548
GO:0043190 |
| AF-A0A7Y3GYF9-F1-model_v4 | ABC transporter permease | 0.9849 | 2 | 232 |
GO:0005548
GO:0043190 |
| AF-A0A2A4G292-F1-model_v4 | ABC transporter permease | 0.9841 | 2 | 236 |
GO:0005548
GO:0043190 |
| AF-A0A2Z5ZGC0-F1-model_v4 | ABC transporter | 0.9841 | 2 | 235 |
GO:0005548
GO:0043190 |
| AF-A0A2K8L6D9-F1-model_v4 | Phospholipid/cholesterol/gamma-HCH transport system permease protein | 0.9819 | 2 | 236 |
GO:0005548
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar