F467194

General Info

Members Datasets Scaffolds Average Seq Length
593 313 578 256

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100064034|Ga0070663_1000640343
Length 283
Sequence MNIFASVGRLFLLFLAEXXXXTRFTVSAVSSIVRPPVYWRLLLQQIMRIGWFSLPVVGLTAFFTGGALALQIFIGGNRYGAEAIVPQIVVLGITRELGPVIAGLMVAGRVAAAIAAEIGTMRVTEQIDALTTLSTNPVKYLVVPRLIAAVLTMPILVAIADSIGVFGGYIVATKSLGFNGAVYLKNTADFVTSHDVMSGLVKAAVFGFVIALMGCYSGFNSKGGAQGVGRATTNAVVSCRSSFSPPTIFSPRSCSRARPWTPRSNCRASRNGSARRSCWTASI

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221640 Caulobacter sp. Root342 Isolate Unclassified
9 2643221642 Caulobacter sp. Root343 Isolate Unclassified
10 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
11 2849560528 Caulobacter zeae 410 Isolate Unclassified
12 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
13 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
14 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
15 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
284 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
287 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
288 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
293 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
294 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
295 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
302 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
303 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
304 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
307 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
308 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
309 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
310 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.61
Nodule 0
Rhizoplane 1.18
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003190 3300001989 Bacteria 6254
2 JGI24739J22299_10038795 3300001989 Bacteria 1599
3 rootH2_10058962 3300003320 Bacteria 2975
4 rootH2_10093856 3300003320 Bacteria 4620
5 rootL2_10021435 3300003322 Bacteria 6513
6 Ga0055536_1003093 3300003781 Bacteria 9056
7 Ga0055536_1003367 3300003781 Bacteria 8625
8 Ga0055530_10002805 3300003791 Bacteria 10721
9 Ga0055531_10000644 3300003794 Bacteria 30161
10 Ga0065165_1000499 3300005262 Bacteria 60740
11 Ga0065715_10097850 3300005293 Bacteria 3641
12 Ga0065707_10082679 3300005295 Bacteria 12785
13 Ga0065707_10086182 3300005295 Bacteria 5613
14 Ga0070658_10081439 3300005327 Bacteria 2659
15 Ga0070670_100000005 3300005331 Bacteria 351569
16 Ga0070670_100000528 3300005331 Bacteria 30641
17 Ga0070670_100080899 3300005331 Bacteria 2792
18 Ga0070670_100402300 3300005331 Bacteria 1209
19 Ga0070666_10009592 3300005335 Bacteria 6042
20 Ga0070666_10179141 3300005335 Bacteria 1486
21 Ga0070680_100000201 3300005336 Bacteria 38933
22 Ga0070680_100116041 3300005336 Bacteria 2231
23 Ga0070660_100043403 3300005339 Bacteria 3436
24 Ga0070691_10019410 3300005341 Bacteria 3137
25 Ga0070661_100011657 3300005344 Bacteria 6130
26 Ga0070668_100000007 3300005347 Bacteria 150621
27 Ga0070668_100166645 3300005347 Bacteria 1791
28 Ga0070669_100000195 3300005353 Bacteria 53791
29 Ga0070671_100000388 3300005355 Bacteria 30256
30 Ga0070673_100168747 3300005364 Bacteria 1866
31 Ga0070659_100014668 3300005366 Bacteria 5859
32 Ga0070659_100069377 3300005366 Bacteria 2798
33 Ga0070667_100000003 3300005367 Bacteria 447715
34 Ga0070667_100001850 3300005367 Bacteria 18783
35 Ga0070709_10042688 3300005434 Bacteria 2802
36 Ga0070714_100090017 3300005435 Bacteria 2687
37 Ga0070714_100143203 3300005435 Bacteria 2148
38 Ga0070714_100351234 3300005435 Bacteria 1385
39 Ga0070713_100000003 3300005436 Bacteria 245840
40 Ga0070713_100270279 3300005436 Unclassified 1556
41 Ga0070711_100042521 3300005439 Bacteria 3072
42 Ga0070711_100459064 3300005439 Bacteria 1044
43 Ga0070708_100158845 3300005445 Bacteria 2106
44 Ga0070663_100064034 3300005455 Bacteria 2657
45 Ga0070678_100060101 3300005456 Bacteria 2796
46 Ga0070681_10000005 3300005458 Bacteria 183053
47 Ga0070681_10561538 3300005458 Bacteria 1055
48 Ga0070681_10701798 3300005458 Bacteria 927
49 Ga0070707_100010180 3300005468 Bacteria 8753
50 Ga0070698_100055153 3300005471 Bacteria 4032
51 Ga0070679_100000293 3300005530 Bacteria 42433
52 Ga0070679_100295020 3300005530 Bacteria 1572
53 Ga0070684_100751794 3300005535 Bacteria 910
54 Ga0068853_100007775 3300005539 Bacteria 8597
55 Ga0068853_100011500 3300005539 Bacteria 7195
56 Ga0068853_100118929 3300005539 Bacteria 2355
57 Ga0070693_100004688 3300005547 Bacteria 6495
58 Ga0070665_100288687 3300005548 Bacteria 1643
59 Ga0070665_100717359 3300005548 Bacteria 1013
60 Ga0068855_100000063 3300005563 Bacteria 131058
61 Ga0068855_100029600 3300005563 Bacteria 6545
62 Ga0068855_100139809 3300005563 Bacteria 2761
63 Ga0068855_100510747 3300005563 Bacteria 1305
64 Ga0070664_100094763 3300005564 Bacteria 2589
65 Ga0068857_100003278 3300005577 Bacteria 13448
66 Ga0068857_100021236 3300005577 Bacteria 5713
67 Ga0068857_100142709 3300005577 Bacteria 2165
68 Ga0068857_100368811 3300005577 Bacteria 1332
69 Ga0068854_100112409 3300005578 Bacteria 2056
70 Ga0068854_100235853 3300005578 Bacteria 1454
71 Ga0068854_100242838 3300005578 Bacteria 1435
72 Ga0068856_100001293 3300005614 Bacteria 26357
73 Ga0068856_100001833 3300005614 Bacteria 22244
74 Ga0068856_101030720 3300005614 Bacteria 841
75 Ga0068852_100017052 3300005616 Bacteria 5688
76 Ga0068852_100099572 3300005616 Bacteria 2620
77 Ga0068852_100152567 3300005616 Bacteria 2150
78 Ga0068852_100317212 3300005616 Bacteria 1513
79 Ga0068859_100010247 3300005617 Bacteria 9433
80 Ga0068859_100034906 3300005617 Bacteria 5046
81 Ga0068864_100000011 3300005618 Bacteria 350056
82 Ga0068864_100013485 3300005618 Bacteria 6776
83 Ga0068864_100028365 3300005618 Bacteria 4730
84 Ga0068864_100793852 3300005618 Bacteria 930
85 Ga0068861_100034416 3300005719 Bacteria 3746
86 Ga0068863_100022726 3300005841 Bacteria 5990
87 Ga0068863_100053251 3300005841 Bacteria 3835
88 Ga0068863_100199127 3300005841 Bacteria 1926
89 Ga0068858_100007133 3300005842 Bacteria 10854
90 Ga0068860_100000045 3300005843 Bacteria 223252
91 Ga0068862_100000011 3300005844 Bacteria 270105
92 Ga0068862_100000989 3300005844 Bacteria 27179
93 Ga0068862_100249580 3300005844 Bacteria 1617
94 Ga0070716_100072663 3300006173 Bacteria 2026
95 Ga0070712_100000494 3300006175 Bacteria 22527
96 Ga0070712_100002914 3300006175 Bacteria 10604
97 Ga0070712_100204858 3300006175 Bacteria 1552
98 Ga0075366_10014001 3300006195 Bacteria 4574
99 Ga0075366_10049220 3300006195 Bacteria 2501
100 Ga0097621_100210886 3300006237 Bacteria 1690
101 Ga0068871_100131164 3300006358 Bacteria 2125
102 Ga0075430_100303448 3300006846 Bacteria 1321
103 Ga0075434_100233773 3300006871 Bacteria 1858
104 Ga0075436_100000023 3300006914 Bacteria 116796
105 Ga0075436_100035481 3300006914 Bacteria 3440
106 Ga0075436_100170471 3300006914 Bacteria 1537
107 Ga0097620_100010246 3300006931 Bacteria 9433
108 Ga0097620_100034906 3300006931 Bacteria 5046
109 Ga0097620_100118248 3300006931 Bacteria 2716
110 Ga0075435_100028059 3300007076 Bacteria 4412
111 Ga0105240_10001135 3300009093 Bacteria 46650
112 Ga0105240_10007836 3300009093 Bacteria 15413
113 Ga0105240_10015791 3300009093 Bacteria 10245
114 Ga0105240_10016423 3300009093 Bacteria 10022
115 Ga0105240_10030255 3300009093 Bacteria 7038
116 Ga0105240_10333539 3300009093 Bacteria 1725
117 Ga0105240_10567118 3300009093 Bacteria 1254
118 Ga0111539_10062518 3300009094 Bacteria 4407
119 Ga0105245_10785887 3300009098 Bacteria 989
120 Ga0105247_10055927 3300009101 Bacteria 2436
121 Ga0105247_10166255 3300009101 Bacteria 1464
122 Ga0105241_10049668 3300009174 Bacteria 3195
123 Ga0105241_10184456 3300009174 Bacteria 1733
124 Ga0105248_10000001 3300009177 Bacteria 1881304
125 Ga0105248_10000069 3300009177 Bacteria 120989
126 Ga0105248_10025033 3300009177 Bacteria 6635
127 Ga0105248_10064572 3300009177 Bacteria 4109
128 Ga0105248_10086327 3300009177 Bacteria 3531
129 Ga0105248_10245859 3300009177 Bacteria 2014
130 Ga0105237_10005796 3300009545 Bacteria 13860
131 Ga0105237_10018738 3300009545 Bacteria 7157
132 Ga0105237_10139699 3300009545 Bacteria 2416
133 Ga0105237_10482958 3300009545 Bacteria 1245
134 Ga0105238_10005700 3300009551 Bacteria 12311
135 Ga0105238_10010958 3300009551 Bacteria 9118
136 Ga0105238_10038976 3300009551 Bacteria 4822
137 Ga0105238_10134932 3300009551 Bacteria 2446
138 Ga0105239_10000513 3300010375 Bacteria 55836
139 Ga0105239_10000694 3300010375 Bacteria 47928
140 Ga0105239_10117421 3300010375 Bacteria 2952
141 Ga0105239_10175291 3300010375 Bacteria 2398
142 Ga0105239_10305171 3300010375 Bacteria 1793
143 Ga0105239_11035247 3300010375 Bacteria 944
144 Ga0157326_1000424 3300012513 Bacteria 5015
145 Ga0157373_10004385 3300013100 Bacteria 10638
146 Ga0157370_10004544 3300013104 Bacteria 15891
147 Ga0157370_10132969 3300013104 Bacteria 2320
148 Ga0157369_10005962 3300013105 Bacteria 14151
149 Ga0157369_10066992 3300013105 Bacteria 3862
150 Ga0157374_10082693 3300013296 Bacteria 3049
151 Ga0157374_10312794 3300013296 Bacteria 1555
152 Ga0157378_10122125 3300013297 Bacteria 2402
153 Ga0157378_10138420 3300013297 Bacteria 2259
154 Ga0163162_10481030 3300013306 Bacteria 1373
155 Ga0157372_10045612 3300013307 Bacteria 4864
156 Ga0157372_10048189 3300013307 Bacteria 4736
157 Ga0157372_10052770 3300013307 Bacteria 4529
158 Ga0157372_10062892 3300013307 Bacteria 4159
159 Ga0157375_10046901 3300013308 Bacteria 4216
160 Ga0163163_10059627 3300014325 Bacteria 3776
161 Ga0163163_10095807 3300014325 Bacteria 2988
162 Ga0157380_10003531 3300014326 Bacteria 10746
163 Ga0157379_10001171 3300014968 Bacteria 21362
164 Ga0157379_10002326 3300014968 Bacteria 15840
165 Ga0157379_10030165 3300014968 Bacteria 4824
166 Ga0157379_10076482 3300014968 Bacteria 2997
167 Ga0157379_10267690 3300014968 Bacteria 1553
168 Ga0157379_10268329 3300014968 Bacteria 1552
169 Ga0163161_10393420 3300017792 Bacteria 1110
170 Ga0213876_10000469 3300021384 Bacteria 32156
171 Ga0213876_10000586 3300021384 Bacteria 27090
172 Ga0213876_10026209 3300021384 Bacteria 3075
173 Ga0209676_1000272 3300025292 Bacteria 107765
174 Ga0209676_1000899 3300025292 Bacteria 37563
175 Ga0209564_1002018 3300025295 Bacteria 17672
176 Ga0209564_1029307 3300025295 Bacteria 1735
177 Ga0209758_1004244 3300025297 Bacteria 12126
178 Ga0209050_1000344 3300025298 Bacteria 92033
179 Ga0209050_1002568 3300025298 Bacteria 15109
180 Ga0209256_1000666 3300025299 Bacteria 46480
181 Ga0209256_1010423 3300025299 Bacteria 3895
182 Ga0209051_1000743 3300025303 Bacteria 35022
183 Ga0209257_1000066 3300025304 Bacteria 344166
184 Ga0209257_1000624 3300025304 Bacteria 56974
185 Ga0209257_1020404 3300025304 Bacteria 2451
186 Ga0207680_10001384 3300025903 Bacteria 11457
187 Ga0207680_10136334 3300025903 Bacteria 1623
188 Ga0207699_10000126 3300025906 Bacteria 53299
189 Ga0207705_10000263 3300025909 Bacteria 50599
190 Ga0207654_10319422 3300025911 Bacteria 1061
191 Ga0207707_10000005 3300025912 Bacteria 382024
192 Ga0207707_10028347 3300025912 Bacteria 4894
193 Ga0207695_10000003 3300025913 Bacteria 1368691
194 Ga0207695_10002114 3300025913 Bacteria 30152
195 Ga0207695_10025853 3300025913 Bacteria 6561
196 Ga0207695_10028954 3300025913 Bacteria 6130
197 Ga0207695_10139002 3300025913 Bacteria 2380
198 Ga0207695_10144956 3300025913 Bacteria 2320
199 Ga0207695_10266654 3300025913 Bacteria 1609
200 Ga0207671_10004851 3300025914 Bacteria 12657
201 Ga0207671_10012710 3300025914 Bacteria 6753
202 Ga0207671_10411789 3300025914 Bacteria 1075
203 Ga0207693_10000295 3300025915 Bacteria 46423
204 Ga0207693_10002754 3300025915 Bacteria 15224
205 Ga0207693_10309015 3300025915 Bacteria 1238
206 Ga0207663_10345474 3300025916 Bacteria 1125
207 Ga0207663_10394660 3300025916 Bacteria 1057
208 Ga0207660_10004821 3300025917 Bacteria 8779
209 Ga0207660_10005434 3300025917 Bacteria 8269
210 Ga0207657_10000114 3300025919 Bacteria 79120
211 Ga0207649_10009157 3300025920 Bacteria 5414
212 Ga0207652_10000320 3300025921 Bacteria 49730
213 Ga0207652_10005507 3300025921 Bacteria 10269
214 Ga0207646_10029610 3300025922 Bacteria 4972
215 Ga0207681_10000001 3300025923 Bacteria 1105841
216 Ga0207681_10016173 3300025923 Bacteria 4661
217 Ga0207694_10000005 3300025924 Bacteria 823704
218 Ga0207694_10028078 3300025924 Bacteria 4289
219 Ga0207694_10047323 3300025924 Bacteria 3327
220 Ga0207694_10095576 3300025924 Bacteria 2349
221 Ga0207650_10000018 3300025925 Bacteria 352120
222 Ga0207650_10004568 3300025925 Bacteria 9467
223 Ga0207650_10045113 3300025925 Bacteria 3243
224 Ga0207650_10094945 3300025925 Bacteria 2285
225 Ga0207700_10000010 3300025928 Bacteria 298473
226 Ga0207664_10046955 3300025929 Bacteria 3391
227 Ga0207664_10191132 3300025929 Bacteria 1762
228 Ga0207644_10000197 3300025931 Bacteria 42679
229 Ga0207644_10015582 3300025931 Bacteria 5104
230 Ga0207690_10151904 3300025932 Bacteria 1717
231 Ga0207706_10002602 3300025933 Bacteria 17565
232 Ga0207706_10018319 3300025933 Bacteria 6301
233 Ga0207665_10071107 3300025939 Bacteria 2375
234 Ga0207711_10000002 3300025941 Bacteria 1228676
235 Ga0207711_10060742 3300025941 Bacteria 3257
236 Ga0207711_10115718 3300025941 Bacteria 2390
237 Ga0207679_10098942 3300025945 Bacteria 2276
238 Ga0207667_10000183 3300025949 Bacteria 91183
239 Ga0207667_10018054 3300025949 Bacteria 7922
240 Ga0207668_10000026 3300025972 Bacteria 128309
241 Ga0207668_10071530 3300025972 Bacteria 2478
242 Ga0207640_10077579 3300025981 Bacteria 2259
243 Ga0207640_10093632 3300025981 Bacteria 2088
244 Ga0207640_10280436 3300025981 Bacteria 1309
245 Ga0207640_10568880 3300025981 Bacteria 955
246 Ga0207658_10000002 3300025986 Bacteria 1364188
247 Ga0207658_10000902 3300025986 Bacteria 24720
248 Ga0207677_10100711 3300026023 Bacteria 2125
249 Ga0207703_10000404 3300026035 Bacteria 46297
250 Ga0207703_10076661 3300026035 Bacteria 2774
251 Ga0207639_10004074 3300026041 Bacteria 9859
252 Ga0207639_10013017 3300026041 Bacteria 5808
253 Ga0207639_10024671 3300026041 Bacteria 4355
254 Ga0207639_10601091 3300026041 Bacteria 1014
255 Ga0207678_10271332 3300026067 Bacteria 1455
256 Ga0207702_10000013 3300026078 Bacteria 257468
257 Ga0207702_10001346 3300026078 Bacteria 24513
258 Ga0207641_10000277 3300026088 Bacteria 64441
259 Ga0207641_10011325 3300026088 Bacteria 7320
260 Ga0207641_10041166 3300026088 Bacteria 3871
261 Ga0207676_10000004 3300026095 Bacteria 725417
262 Ga0207676_10000600 3300026095 Bacteria 29522
263 Ga0207676_10014784 3300026095 Bacteria 5622
264 Ga0207676_10228387 3300026095 Bacteria 1662
265 Ga0207674_10001730 3300026116 Bacteria 27883
266 Ga0207674_10012052 3300026116 Bacteria 9684
267 Ga0207674_10077154 3300026116 Bacteria 3338
268 Ga0207674_10173973 3300026116 Bacteria 2106
269 Ga0207675_100004115 3300026118 Bacteria 14077
270 Ga0207683_10105040 3300026121 Bacteria 2524
271 Ga0207698_10101748 3300026142 Bacteria 2384
272 Ga0207698_10172998 3300026142 Bacteria 1904
273 Ga0268266_10244975 3300028379 Bacteria 1656
274 Ga0268266_10419396 3300028379 Bacteria 1268
275 Ga0268265_10000002 3300028380 Bacteria 1035381
276 Ga0268265_10010756 3300028380 Bacteria 6178
277 Ga0268264_10000101 3300028381 Bacteria 225109
278 Ga0265337_1003661 3300028556 Bacteria 6589
279 Ga0265334_10003731 3300028573 Bacteria 6889
280 Ga0265318_10000436 3300028577 Bacteria 31719
281 Ga0265318_10046087 3300028577 Bacteria 1647
282 Ga0307515_10058728 3300028794 Bacteria 5532
283 Ga0307515_10105570 3300028794 Bacteria 3352
284 Ga0265338_10000006 3300028800 Bacteria 570804
285 Ga0265338_10019953 3300028800 Bacteria 7077
286 Ga0265338_10031329 3300028800 Bacteria 5216
287 Ga0265338_10121670 3300028800 Bacteria 2079
288 Ga0265330_10007638 3300031235 Bacteria 5255
289 Ga0265332_10040969 3300031238 Bacteria 2004
290 Ga0265332_10068733 3300031238 Bacteria 1510
291 Ga0265332_10119737 3300031238 Bacteria 1106
292 Ga0265320_10000807 3300031240 Bacteria 23799
293 Ga0265325_10000007 3300031241 Bacteria 208874
294 Ga0265325_10000325 3300031241 Bacteria 33683
295 Ga0265329_10050804 3300031242 Bacteria 1321
296 Ga0265340_10000115 3300031247 Bacteria 39225
297 Ga0265340_10000844 3300031247 Bacteria 17423
298 Ga0265340_10018845 3300031247 Bacteria 3556
299 Ga0265340_10032445 3300031247 Bacteria 2607
300 Ga0265340_10040327 3300031247 Bacteria 2300
301 Ga0265340_10107060 3300031247 Bacteria 1295
302 Ga0265339_10001769 3300031249 Bacteria 15891
303 Ga0265339_10053799 3300031249 Bacteria 2188
304 Ga0265339_10106389 3300031249 Bacteria 1455
305 Ga0265331_10000006 3300031250 Bacteria 418907
306 Ga0265331_10002860 3300031250 Bacteria 11427
307 Ga0265331_10006743 3300031250 Bacteria 6730
308 Ga0265331_10026162 3300031250 Bacteria 2937
309 Ga0265327_10000430 3300031251 Bacteria 76023
310 Ga0265316_10014699 3300031344 Bacteria 6875
311 Ga0265316_10018163 3300031344 Bacteria 6053
312 Ga0265316_10019198 3300031344 Bacteria 5853
313 Ga0265316_10052990 3300031344 Bacteria 3180
314 Ga0265316_10119102 3300031344 Bacteria 1995
315 Ga0265316_10184079 3300031344 Bacteria 1554
316 Ga0265316_10415230 3300031344 Bacteria 968
317 Ga0265313_10002331 3300031595 Bacteria 16628
318 Ga0265313_10020238 3300031595 Bacteria 3676
319 Ga0265313_10026131 3300031595 Bacteria 3082
320 Ga0265313_10033777 3300031595 Bacteria 2595
321 Ga0265314_10004741 3300031711 Bacteria 12463
322 Ga0265314_10041163 3300031711 Bacteria 3310
323 Ga0265314_10063482 3300031711 Bacteria 2505
324 Ga0265314_10148944 3300031711 Bacteria 1437
325 Ga0265342_10024454 3300031712 Bacteria 3812
326 Ga0265342_10036320 3300031712 Bacteria 3010
327 Ga0265342_10050131 3300031712 Bacteria 2495
328 Ga0307516_10013579 3300031730 Bacteria 8660
329 Ga0307406_10021598 3300031901 Bacteria 3810
330 Ga0307406_10413477 3300031901 Bacteria 1073
331 Ga0307412_10028714 3300031911 Bacteria 3484
332 Ga0307416_100313733 3300032002 Bacteria 1566
333 Ga0307416_100348657 3300032002 Bacteria 1497
334 Ga0373951_0089688 3300035091 Bacteria 805
335 Ga0373954_0031633 3300035118 Bacteria 2444
336 Ga0373955_0067965 3300035172 Bacteria 1985
337 Ga0373942_0011104 3300035207 Bacteria 2130
338 Ga0373931_0013868 3300035691 Bacteria 3932
339 Ga0373935_0010737 3300035692 Bacteria 5502
340 Ga0373935_0114475 3300035692 Bacteria 1794
341 Ga0373927_0056036 3300035695 Bacteria 2548
342 Ga0373927_0103654 3300035695 Bacteria 1851
343 Ga0373933_0026091 3300035724 Bacteria 3353
344 Ga0373933_0028923 3300035724 Bacteria 3200
345 Ga0373933_0141973 3300035724 Bacteria 1517
346 Ga0373947_0024952 3300035725 Bacteria 3486
347 Ga0373947_0149494 3300035725 Bacteria 1503
348 Ga0373937_0013134 3300036401 Bacteria 7292
349 Ga0373937_0024641 3300036401 Bacteria 5429
350 Ga0373937_0052403 3300036401 Bacteria 3741
351 Ga0373937_0284310 3300036401 Bacteria 1562
352 Ga0373937_0770556 3300036401 Bacteria 910
353 Ga0373925_0007893 3300037068 Bacteria 7751
354 Ga0373925_0154626 3300037068 Bacteria 1803
355 Ga0373925_0270492 3300037068 Bacteria 1367
356 Ga0395905_0913943 3300037471 Bacteria 781
357 Ga0436364_0184827 3300037853 Bacteria 146498
358 Ga0436365_0073850 3300039437 Bacteria 40161
359 Ga0436365_0508484 3300039437 Bacteria 190091
360 Ga0436365_1535986 3300039437 Bacteria 4481
361 Ga0436361_0858734 3300039447 Bacteria 1465
362 Ga0436363_0405125 3300039450 Bacteria 7901
363 Ga0436363_0761268 3300039450 Bacteria 4157
364 Ga0436363_0949804 3300039450 Bacteria 2668
365 Ga0451853_2643851 3300041512 Bacteria 2832
366 Ga0439446_0064877 3300042156 Bacteria 1109
367 Ga0439460_0008844 3300042461 Bacteria 2545
368 Ga0466973_0215919 3300044659 Bacteria 1401
369 Ga0495627_000751 3300046453 Bacteria 24156
370 Ga0495592_0114085 3300046454 Bacteria 1909
371 Ga0495603_0059861 3300046455 Bacteria 2251
372 Ga0495590_0003110 3300046457 Bacteria 6786
373 Ga0495638_0000283 3300046460 Bacteria 67742
374 Ga0495638_0001944 3300046460 Bacteria 17720
375 Ga0495638_0002498 3300046460 Bacteria 14971
376 Ga0495638_0006034 3300046460 Bacteria 8869
377 Ga0495638_0044711 3300046460 Bacteria 2789
378 Ga0495650_0024719 3300046471 Bacteria 2832
379 Ga0495582_0043843 3300046473 Bacteria 2463
380 Ga0495583_0000234 3300046506 Bacteria 92118
381 Ga0495610_0000158 3300046512 Bacteria 75123
382 Ga0495610_0001132 3300046512 Bacteria 24265
383 Ga0495610_0007739 3300046512 Bacteria 7091
384 Ga0495631_0007917 3300046518 Bacteria 5380
385 Ga0495631_0046806 3300046518 Bacteria 1901
386 Ga0495632_0046359 3300046519 Bacteria 2160
387 Ga0495637_0051691 3300046520 Bacteria 1718
388 Ga0495643_0058055 3300046522 Bacteria 2060
389 Ga0495643_0077621 3300046522 Bacteria 1735
390 Ga0495643_0079090 3300046522 Bacteria 1715
391 Ga0495643_0151891 3300046522 Bacteria 1146
392 Ga0495648_0000098 3300046524 Bacteria 109074
393 Ga0495642_0016296 3300046528 Bacteria 2895
394 Ga0495654_0000264 3300046530 Bacteria 47686
395 Ga0495654_0046723 3300046530 Bacteria 2131
396 Ga0495665_0068846 3300046531 Bacteria 1866
397 Ga0495621_0043406 3300046539 Bacteria 1586
398 Ga0495645_0015164 3300046543 Bacteria 5479
399 Ga0495622_0011314 3300046557 Bacteria 4121
400 Ga0495633_0094799 3300046558 Bacteria 1387
401 Ga0495668_0000389 3300046616 Bacteria 57953
402 Ga0495668_0000984 3300046616 Bacteria 31110
403 Ga0495668_0003334 3300046616 Bacteria 12109
404 Ga0495668_0006115 3300046616 Bacteria 7971
405 Ga0495634_0349436 3300046642 Bacteria 886
406 Ga0495625_0000058 3300046660 Bacteria 180863
407 Ga0495625_0000864 3300046660 Bacteria 41204
408 Ga0495625_0001132 3300046660 Bacteria 34469
409 Ga0495625_0030943 3300046660 Bacteria 3986
410 Ga0495625_0146420 3300046660 Bacteria 1590
411 Ga0495625_0154451 3300046660 Bacteria 1541
412 Ga0495657_0203189 3300046675 Bacteria 1207
413 Ga0495599_0049698 3300046678 Bacteria 2629
414 Ga0495658_0001976 3300046683 Bacteria 10451
415 Ga0495658_0063530 3300046683 Bacteria 2125
416 Ga0495613_0047071 3300046689 Bacteria 3186
417 Ga0495671_0106929 3300046692 Bacteria 1366
418 Ga0495589_0039090 3300046794 Bacteria 2372
419 Ga0495600_0433520 3300046809 Bacteria 815
420 Ga0495672_0024447 3300047320 Bacteria 3891
421 Ga0495675_0013756 3300047444 Bacteria 5114
422 Ga0495679_021927 3300047446 Bacteria 2195
423 Ga0495673_0000428 3300047469 Bacteria 47721
424 Ga0495673_0000492 3300047469 Bacteria 42153
425 Ga0495686_0000201 3300047472 Bacteria 110982
426 Ga0495686_0000863 3300047472 Bacteria 38854
427 Ga0495686_0001890 3300047472 Bacteria 20941
428 Ga0495686_0009487 3300047472 Bacteria 7001
429 Ga0495686_0021547 3300047472 Bacteria 4277
430 Ga0495686_0038809 3300047472 Bacteria 3045
431 Ga0495602_0243771 3300048088 Bacteria 1343
432 Ga0496102_0013985 3300048905 Bacteria 6968
433 Ga0496103_0000173 3300048906 Bacteria 67412
434 Ga0496106_0011902 3300048909 Bacteria 6423
435 Ga0496106_0329664 3300048909 Bacteria 1225
436 Ga0496107_0000067 3300048910 Bacteria 52195
437 Ga0496109_0024887 3300048912 Bacteria 5329
438 Ga0496110_0164263 3300048913 Bacteria 2013
439 Ga0496116_0000566 3300048919 Bacteria 49509
440 Ga0496117_0000485 3300048920 Bacteria 65840
441 Ga0496117_0021462 3300048920 Bacteria 5222
442 Ga0496118_0000190 3300048921 Bacteria 108017
443 Ga0496118_0013898 3300048921 Bacteria 7572
444 Ga0496119_0112936 3300048922 Bacteria 1505
445 Ga0496120_0023669 3300048923 Bacteria 3841
446 Ga0496121_0000266 3300048924 Bacteria 109208
447 Ga0496121_0003464 3300048924 Bacteria 22491
448 Ga0496121_0008737 3300048924 Bacteria 11819
449 Ga0496121_0061195 3300048924 Bacteria 3091
450 Ga0496121_0075693 3300048924 Bacteria 2688
451 Ga0496124_0000546 3300048927 Bacteria 63624
452 Ga0496124_0028058 3300048927 Bacteria 5039
453 Ga0496125_0051953 3300048928 Bacteria 3375
454 Ga0496125_0072951 3300048928 Bacteria 2672
455 Ga0496126_0000542 3300048929 Bacteria 73066
456 Ga0496126_0009144 3300048929 Bacteria 10575
457 Ga0496126_0236153 3300048929 Bacteria 1529
458 Ga0495678_009454 3300049459 Bacteria 4820
459 Ga0495682_0059023 3300049460 Bacteria 1387
460 Ga0501031_0002125 3300049568 Bacteria 12501
461 Ga0501031_0190838 3300049568 Bacteria 1338
462 Ga0501032_0016626 3300049569 Bacteria 5172
463 Ga0501032_0115196 3300049569 Bacteria 1777
464 Ga0501033_0014156 3300049570 Bacteria 6064
465 Ga0501033_0042348 3300049570 Bacteria 3395
466 Ga0501033_0082811 3300049570 Bacteria 2352
467 Ga0501034_0008881 3300049571 Bacteria 10566
468 Ga0501034_0029743 3300049571 Bacteria 5553
469 Ga0501034_0111134 3300049571 Bacteria 2731
470 Ga0501036_0002345 3300049572 Bacteria 14799
471 Ga0501036_0039405 3300049572 Bacteria 3998
472 Ga0501036_0057057 3300049572 Bacteria 3308
473 Ga0501037_0033298 3300049573 Bacteria 3806
474 Ga0501037_0447845 3300049573 Bacteria 881
475 Ga0501038_0053264 3300049574 Bacteria 3484
476 Ga0501038_0079962 3300049574 Bacteria 2756
477 Ga0501039_0003435 3300049575 Bacteria 11827
478 Ga0501040_0006325 3300049576 Bacteria 7688
479 Ga0501041_0026403 3300049577 Bacteria 3494
480 Ga0501042_0030314 3300049578 Bacteria 3819
481 Ga0501042_0200924 3300049578 Bacteria 1437
482 Ga0501043_0003381 3300049579 Bacteria 13137
483 Ga0501043_0288346 3300049579 Bacteria 1257
484 Ga0501043_0617511 3300049579 Bacteria 799
485 Ga0501046_0004299 3300049580 Bacteria 12964
486 Ga0501046_0013015 3300049580 Bacteria 7061
487 Ga0501046_0051216 3300049580 Bacteria 3259
488 Ga0501046_0379608 3300049580 Bacteria 1023
489 Ga0501047_0000402 3300049581 Bacteria 48648
490 Ga0501047_0006146 3300049581 Bacteria 11288
491 Ga0501047_0132683 3300049581 Bacteria 2370
492 Ga0501047_0304684 3300049581 Bacteria 1435
493 Ga0501048_0125885 3300049582 Bacteria 1811
494 Ga0501067_0007275 3300049583 Bacteria 6146
495 Ga0501067_0018443 3300049583 Bacteria 3865
496 Ga0501067_0035034 3300049583 Bacteria 2786
497 Ga0501068_0018923 3300049584 Bacteria 3992
498 Ga0501068_0161264 3300049584 Bacteria 1413
499 Ga0501070_0000047 3300049586 Bacteria 107704
500 Ga0501070_0003346 3300049586 Bacteria 13920
501 Ga0501070_0204270 3300049586 Bacteria 1622
502 Ga0501070_0435401 3300049586 Bacteria 1058
503 Ga0501071_0062130 3300049587 Bacteria 2706
504 Ga0501071_0346469 3300049587 Bacteria 1130
505 Ga0501072_0238499 3300049588 Bacteria 1448
506 Ga0501073_0009287 3300049589 Bacteria 7254
507 Ga0501073_0123937 3300049589 Bacteria 1791
508 Ga0501073_0297523 3300049589 Bacteria 1113
509 Ga0501074_0001660 3300049590 Bacteria 15118
510 Ga0501074_0095157 3300049590 Bacteria 2133
511 Ga0501074_0124995 3300049590 Bacteria 1839
512 Ga0501077_0085425 3300049593 Bacteria 2000
513 Ga0501249_006802 3300049679 Bacteria 2356
514 Ga0501079_0002074 3300049741 Bacteria 14370
515 Ga0501079_0066502 3300049741 Bacteria 2781
516 Ga0501079_0102868 3300049741 Bacteria 2215
517 Ga0501079_0261600 3300049741 Bacteria 1352
518 Ga0501080_0000366 3300049742 Bacteria 34958
519 Ga0501080_0188883 3300049742 Bacteria 1893
520 Ga0501080_0327634 3300049742 Bacteria 1385
521 Ga0501081_0183426 3300049743 Bacteria 1514
522 Ga0501083_0001873 3300049744 Bacteria 14449
523 Ga0501035_0006816 3300049822 Bacteria 10673
524 Ga0501035_0039552 3300049822 Bacteria 4267
525 Ga0501044_0019366 3300049823 Bacteria 7283
526 Ga0501044_0033137 3300049823 Bacteria 5429
527 Ga0501044_0039259 3300049823 Bacteria 4939
528 Ga0501044_0061340 3300049823 Bacteria 3847
529 Ga0501044_0109480 3300049823 Bacteria 2771
530 Ga0501044_0380390 3300049823 Bacteria 1327
531 Ga0501045_0142982 3300049824 Bacteria 1779
532 nmdc:mga0k408_44342_c1 3300050493 Bacteria 2564
533 nmdc:mga0qj67_289663_c1 3300050509 Bacteria 1327
534 nmdc:mga0n895_41051_c1 3300050512 Bacteria 4497
535 nmdc:mga0rr50_5661_c1 3300050513 Bacteria 7482
536 nmdc:mga08x19_123936_c1 3300050514 Bacteria 1734
537 nmdc:mga08x19_50_c1 3300050514 Bacteria 129410
538 Ga0500635_0028003 3300053080 Bacteria 1796
539 Ga0500578_0000270 3300053086 Bacteria 64772
540 Ga0500644_0000665 3300053088 Bacteria 12588
541 Ga0500644_0000688 3300053088 Bacteria 12225
542 Ga0500646_0039154 3300053090 Bacteria 1329
543 Ga0500651_0058051 3300053093 Bacteria 2420
544 Ga0500641_0015395 3300053096 Bacteria 2838
545 Ga0500650_0192337 3300053098 Bacteria 932
546 Ga0500554_007983 3300053102 Bacteria 2464
547 Ga0500555_001311 3300053103 Bacteria 7856
548 Ga0500556_0033045 3300053104 Bacteria 1772
549 Ga0500562_001389 3300053108 Bacteria 5970
550 Ga0500592_006958 3300053116 Bacteria 1800
551 Ga0500594_0001228 3300053118 Bacteria 5537
552 Ga0500608_000382 3300053122 Bacteria 17102
553 Ga0500614_005558 3300053123 Bacteria 2645
554 Ga0500618_000185 3300053125 Bacteria 51250
555 Ga0500642_0086375 3300053130 Bacteria 1446
556 Ga0500655_000052 3300053133 Bacteria 31493
557 Ga0500658_0001423 3300053134 Bacteria 9627
558 Ga0500559_0000056 3300053136 Bacteria 88545
559 Ga0500559_0001893 3300053136 Bacteria 11341
560 Ga0500559_0007037 3300053136 Bacteria 5025
561 Ga0500559_0027225 3300053136 Bacteria 2439
562 Ga0500564_000033 3300053138 Bacteria 39298
563 Ga0500577_0001288 3300053142 Bacteria 6407
564 Ga0500590_002752 3300053148 Bacteria 7924
565 Ga0500619_054569 3300053154 Bacteria 1302
566 Ga0500622_0000553 3300053156 Bacteria 34248
567 Ga0500622_0008348 3300053156 Bacteria 5799
568 Ga0500622_0012270 3300053156 Bacteria 4645
569 Ga0500627_0000188 3300053158 Bacteria 18122
570 Ga0500639_064582 3300053163 Bacteria 1880
571 Ga0500636_0033294 3300053177 Bacteria 3052
572 Ga0500637_0000212 3300053178 Bacteria 21766
573 Ga0500570_000179 3300053724 Bacteria 19920
574 Ga0501084_0002294 3300054114 Bacteria 15374
575 Ga0501084_0010924 3300054114 Bacteria 7520
576 Ga0501082_0008707 3300060353 Bacteria 8751
577 Ga0501082_0212074 3300060353 Bacteria 1684
578 Ga0530510_0075573 3300061734 Bacteria 2447

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100014668 Ga0070659_1000146682 205
2 3300005563 Ga0068855_100510747 Ga0068855_1005107472 205
3 3300014968 Ga0157379_10076482 Ga0157379_100764823 213
4 3300046675 Ga0495657_0203189 Ga0495657_0203189_58_831 213
5 3300039450 Ga0436363_0949804 Ga0436363_0949804_1336_2109 219
6 3300053116 Ga0500592_006958 Ga0500592_006958_369_1142 221
7 3300005331 Ga0070670_100080899 Ga0070670_1000808992 222
8 3300025914 Ga0207671_10411789 Ga0207671_104117892 222
9 3300025925 Ga0207650_10094945 Ga0207650_100949452 222
10 3300048928 Ga0496125_0051953 Ga0496125_0051953_2557_3357 224
11 3300049568 Ga0501031_0002125 Ga0501031_0002125_4953_5726 224
12 3300049569 Ga0501032_0115196 Ga0501032_0115196_113_886 224
13 3300049571 Ga0501034_0008881 Ga0501034_0008881_4054_4827 224
14 3300049572 Ga0501036_0002345 Ga0501036_0002345_13609_14382 224
15 3300049573 Ga0501037_0033298 Ga0501037_0033298_2281_3054 224
16 3300049575 Ga0501039_0003435 Ga0501039_0003435_10509_11282 224
17 3300049578 Ga0501042_0030314 Ga0501042_0030314_2932_3705 224
18 3300049579 Ga0501043_0003381 Ga0501043_0003381_11408_12181 224
19 3300049580 Ga0501046_0004299 Ga0501046_0004299_11489_12262 224
20 3300049581 Ga0501047_0132683 Ga0501047_0132683_1403_2176 224
21 3300049583 Ga0501067_0018443 Ga0501067_0018443_714_1487 224
22 3300049584 Ga0501068_0018923 Ga0501068_0018923_545_1318 224
23 3300049586 Ga0501070_0204270 Ga0501070_0204270_45_818 224
24 3300049587 Ga0501071_0062130 Ga0501071_0062130_243_1016 224
25 3300049590 Ga0501074_0001660 Ga0501074_0001660_807_1580 224
26 3300049741 Ga0501079_0002074 Ga0501079_0002074_2190_2963 224
27 3300049742 Ga0501080_0327634 Ga0501080_0327634_67_840 224
28 3300049744 Ga0501083_0001873 Ga0501083_0001873_2378_3151 224
29 3300049824 Ga0501045_0142982 Ga0501045_0142982_194_967 224
30 3300054114 Ga0501084_0002294 Ga0501084_0002294_2849_3622 224
31 3300060353 Ga0501082_0212074 Ga0501082_0212074_115_888 224
32 3300005331 Ga0070670_100000528 Ga0070670_10000052830 225
33 3300005335 Ga0070666_10179141 Ga0070666_101791412 225
34 3300005347 Ga0070668_100000007 Ga0070668_100000007153 225
35 3300005355 Ga0070671_100000388 Ga0070671_1000003885 225
36 3300005367 Ga0070667_100000003 Ga0070667_100000003258 225
37 3300005548 Ga0070665_100288687 Ga0070665_1002886872 225
38 3300005617 Ga0068859_100034906 Ga0068859_1000349062 225
39 3300005842 Ga0068858_100007133 Ga0068858_1000071335 225
40 3300005843 Ga0068860_100000045 Ga0068860_10000004527 225
41 3300005844 Ga0068862_100000989 Ga0068862_1000009894 225
42 3300006195 Ga0075366_10014001 Ga0075366_100140013 225
43 3300006931 Ga0097620_100034906 Ga0097620_1000349062 225
44 3300006931 Ga0097620_100118248 Ga0097620_1001182482 225
45 3300009177 Ga0105248_10025033 Ga0105248_100250336 225
46 3300009177 Ga0105248_10245859 Ga0105248_102458593 225
47 3300025903 Ga0207680_10136334 Ga0207680_101363342 225
48 3300025923 Ga0207681_10016173 Ga0207681_100161735 225
49 3300025925 Ga0207650_10004568 Ga0207650_1000456813 225
50 3300025931 Ga0207644_10000197 Ga0207644_1000019739 225
51 3300025941 Ga0207711_10060742 Ga0207711_100607423 225
52 3300025972 Ga0207668_10000026 Ga0207668_10000026119 225
53 3300025986 Ga0207658_10000002 Ga0207658_100000021159 225
54 3300026023 Ga0207677_10100711 Ga0207677_101007113 225
55 3300026035 Ga0207703_10000404 Ga0207703_100004045 225
56 3300026116 Ga0207674_10173973 Ga0207674_101739731 225
57 3300028379 Ga0268266_10244975 Ga0268266_102449752 225
58 3300028380 Ga0268265_10010756 Ga0268265_100107564 225
59 3300028381 Ga0268264_10000101 Ga0268264_1000010129 225
60 3300031238 Ga0265332_10068733 Ga0265332_100687332 225
61 3300031241 Ga0265325_10000325 Ga0265325_1000032513 225
62 3300031344 Ga0265316_10018163 Ga0265316_100181633 225
63 3300031595 Ga0265313_10033777 Ga0265313_100337772 225
64 3300036401 Ga0373937_0770556 Ga0373937_0770556_64_837 225
65 3300037853 Ga0436364_0184827 Ga0436364_0184827_77705_78505 225
66 3300039450 Ga0436363_0761268 Ga0436363_0761268_1107_1904 225
67 3300046528 Ga0495642_0016296 Ga0495642_0016296_1128_1934 225
68 3300047472 Ga0495686_0038809 Ga0495686_0038809_1654_2451 225
69 3300049570 Ga0501033_0042348 Ga0501033_0042348_2600_3373 225
70 3300053177 Ga0500636_0033294 Ga0500636_0033294_70_864 225
71 3300005331 Ga0070670_100402300 Ga0070670_1004023001 226
72 3300005364 Ga0070673_100168747 Ga0070673_1001687472 226
73 3300005456 Ga0070678_100060101 Ga0070678_1000601013 226
74 3300005564 Ga0070664_100094763 Ga0070664_1000947633 226
75 3300005618 Ga0068864_100028365 Ga0068864_1000283654 226
76 3300005841 Ga0068863_100199127 Ga0068863_1001991272 226
77 3300006237 Ga0097621_100210886 Ga0097621_1002108862 226
78 3300009177 Ga0105248_10064572 Ga0105248_100645724 226
79 3300013296 Ga0157374_10312794 Ga0157374_103127942 226
80 3300013308 Ga0157375_10046901 Ga0157375_100469014 226
81 3300014325 Ga0163163_10095807 Ga0163163_100958072 226
82 3300014968 Ga0157379_10030165 Ga0157379_100301655 226
83 3300025925 Ga0207650_10045113 Ga0207650_100451132 226
84 3300025933 Ga0207706_10018319 Ga0207706_100183193 226
85 3300025941 Ga0207711_10115718 Ga0207711_101157184 226
86 3300025945 Ga0207679_10098942 Ga0207679_100989422 226
87 3300025981 Ga0207640_10568880 Ga0207640_105688802 226
88 3300026035 Ga0207703_10076661 Ga0207703_100766614 226
89 3300026095 Ga0207676_10014784 Ga0207676_100147844 226
90 3300026121 Ga0207683_10105040 Ga0207683_101050402 226
91 3300048905 Ga0496102_0013985 Ga0496102_0013985_3586_4389 226
92 3300048909 Ga0496106_0329664 Ga0496106_0329664_360_1163 226
93 3300048912 Ga0496109_0024887 Ga0496109_0024887_3767_4570 226
94 3300048913 Ga0496110_0164263 Ga0496110_0164263_614_1417 226
95 3300044659 Ga0466973_0215919 Ga0466973_0215919_209_991 227
96 3300049569 Ga0501032_0016626 Ga0501032_0016626_1952_2746 227
97 3300049580 Ga0501046_0051216 Ga0501046_0051216_1911_2705 227
98 3300049581 Ga0501047_0000402 Ga0501047_0000402_8814_9608 227
99 3300050493 nmdc:mga0k408_44342_c1 nmdc:mga0k408_44342_c1_685_1479 227
100 3300005436 Ga0070713_100270279 Ga0070713_1002702791 229
101 3300005455 Ga0070663_100064034 Ga0070663_1000640343 229
102 3300006175 Ga0070712_100000494 Ga0070712_1000004945 229
103 3300025915 Ga0207693_10000295 Ga0207693_1000029528 229
104 3300005577 Ga0068857_100021236 Ga0068857_1000212362 231
105 3300009093 Ga0105240_10030255 Ga0105240_100302552 231
106 3300025913 Ga0207695_10025853 Ga0207695_100258532 231
107 3300026116 Ga0207674_10012052 Ga0207674_100120528 231
108 3300049743 Ga0501081_0183426 Ga0501081_0183426_304_1089 231
109 3300046809 Ga0495600_0433520 Ga0495600_0433520_92_802 233
110 3300005577 Ga0068857_100368811 Ga0068857_1003688112 234
111 3300005578 Ga0068854_100112409 Ga0068854_1001124092 234
112 3300025981 Ga0207640_10093632 Ga0207640_100936322 234
113 3300026142 Ga0207698_10172998 Ga0207698_101729982 234
114 3300031711 Ga0265314_10063482 Ga0265314_100634822 234
115 3300003320 rootH2_10058962 rootH2_100589624 235
116 3300003320 rootH2_10093856 rootH2_100938562 235
117 3300003322 rootL2_10021435 rootL2_100214354 235
118 3300003781 Ga0055536_1003093 Ga0055536_10030936 235
119 3300003781 Ga0055536_1003367 Ga0055536_10033675 235
120 3300003791 Ga0055530_10002805 Ga0055530_100028054 235
121 3300003794 Ga0055531_10000644 Ga0055531_100006449 235
122 3300005262 Ga0065165_1000499 Ga0065165_100049943 235
123 3300005293 Ga0065715_10097850 Ga0065715_100978504 235
124 3300005327 Ga0070658_10081439 Ga0070658_100814393 235
125 3300005335 Ga0070666_10009592 Ga0070666_100095922 235
126 3300005336 Ga0070680_100000201 Ga0070680_10000020110 235
127 3300005336 Ga0070680_100116041 Ga0070680_1001160413 235
128 3300005339 Ga0070660_100043403 Ga0070660_1000434033 235
129 3300005341 Ga0070691_10019410 Ga0070691_100194102 235
130 3300005344 Ga0070661_100011657 Ga0070661_1000116575 235
131 3300005366 Ga0070659_100069377 Ga0070659_1000693772 235
132 3300005434 Ga0070709_10042688 Ga0070709_100426882 235
133 3300005435 Ga0070714_100090017 Ga0070714_1000900172 235
134 3300005435 Ga0070714_100143203 Ga0070714_1001432032 235
135 3300005435 Ga0070714_100351234 Ga0070714_1003512342 235
136 3300005436 Ga0070713_100000003 Ga0070713_100000003216 235
137 3300005439 Ga0070711_100042521 Ga0070711_1000425211 235
138 3300005439 Ga0070711_100459064 Ga0070711_1004590642 235
139 3300005445 Ga0070708_100158845 Ga0070708_1001588452 235
140 3300005458 Ga0070681_10000005 Ga0070681_10000005104 235
141 3300005458 Ga0070681_10561538 Ga0070681_105615382 235
142 3300005458 Ga0070681_10701798 Ga0070681_107017981 235
143 3300005468 Ga0070707_100010180 Ga0070707_1000101804 235
144 3300005471 Ga0070698_100055153 Ga0070698_1000551533 235
145 3300005530 Ga0070679_100000293 Ga0070679_10000029337 235
146 3300005530 Ga0070679_100295020 Ga0070679_1002950201 235
147 3300005535 Ga0070684_100751794 Ga0070684_1007517941 235
148 3300005539 Ga0068853_100007775 Ga0068853_1000077758 235
149 3300005539 Ga0068853_100118929 Ga0068853_1001189291 235
150 3300005547 Ga0070693_100004688 Ga0070693_1000046886 235
151 3300005548 Ga0070665_100717359 Ga0070665_1007173591 235
152 3300005563 Ga0068855_100000063 Ga0068855_1000000635 235
153 3300005563 Ga0068855_100029600 Ga0068855_1000296004 235
154 3300005563 Ga0068855_100139809 Ga0068855_1001398093 235
155 3300005577 Ga0068857_100003278 Ga0068857_10000327811 235
156 3300005578 Ga0068854_100235853 Ga0068854_1002358532 235
157 3300005578 Ga0068854_100242838 Ga0068854_1002428382 235
158 3300005614 Ga0068856_100001293 Ga0068856_10000129310 235
159 3300005614 Ga0068856_100001833 Ga0068856_10000183320 235
160 3300005614 Ga0068856_101030720 Ga0068856_1010307201 235
161 3300005616 Ga0068852_100017052 Ga0068852_1000170524 235
162 3300005616 Ga0068852_100099572 Ga0068852_1000995722 235
163 3300005616 Ga0068852_100152567 Ga0068852_1001525672 235
164 3300005618 Ga0068864_100013485 Ga0068864_1000134855 235
165 3300005618 Ga0068864_100793852 Ga0068864_1007938522 235
166 3300005841 Ga0068863_100022726 Ga0068863_1000227263 235
167 3300005844 Ga0068862_100249580 Ga0068862_1002495802 235
168 3300006173 Ga0070716_100072663 Ga0070716_1000726632 235
169 3300006175 Ga0070712_100002914 Ga0070712_1000029148 235
170 3300006175 Ga0070712_100204858 Ga0070712_1002048581 235
171 3300006195 Ga0075366_10049220 Ga0075366_100492203 235
172 3300006358 Ga0068871_100131164 Ga0068871_1001311642 235
173 3300006846 Ga0075430_100303448 Ga0075430_1003034481 235
174 3300006871 Ga0075434_100233773 Ga0075434_1002337732 235
175 3300006914 Ga0075436_100000023 Ga0075436_100000023103 235
176 3300006914 Ga0075436_100035481 Ga0075436_1000354813 235
177 3300006914 Ga0075436_100170471 Ga0075436_1001704712 235
178 3300007076 Ga0075435_100028059 Ga0075435_1000280592 235
179 3300009093 Ga0105240_10001135 Ga0105240_1000113523 235
180 3300009093 Ga0105240_10007836 Ga0105240_1000783611 235
181 3300009093 Ga0105240_10015791 Ga0105240_100157916 235
182 3300009093 Ga0105240_10016423 Ga0105240_100164234 235
183 3300009093 Ga0105240_10333539 Ga0105240_103335392 235
184 3300009093 Ga0105240_10567118 Ga0105240_105671182 235
185 3300009094 Ga0111539_10062518 Ga0111539_100625183 235
186 3300009098 Ga0105245_10785887 Ga0105245_107858872 235
187 3300009101 Ga0105247_10055927 Ga0105247_100559272 235
188 3300009101 Ga0105247_10166255 Ga0105247_101662552 235
189 3300009174 Ga0105241_10049668 Ga0105241_100496683 235
190 3300009174 Ga0105241_10184456 Ga0105241_101844561 235
191 3300009177 Ga0105248_10000001 Ga0105248_10000001208 235
192 3300009177 Ga0105248_10086327 Ga0105248_100863274 235
193 3300009545 Ga0105237_10005796 Ga0105237_100057965 235
194 3300009545 Ga0105237_10139699 Ga0105237_101396992 235
195 3300009545 Ga0105237_10482958 Ga0105237_104829582 235
196 3300009551 Ga0105238_10005700 Ga0105238_100057003 235
197 3300009551 Ga0105238_10010958 Ga0105238_100109584 235
198 3300009551 Ga0105238_10134932 Ga0105238_101349323 235
199 3300010375 Ga0105239_10000513 Ga0105239_1000051318 235
200 3300010375 Ga0105239_10000694 Ga0105239_1000069428 235
201 3300010375 Ga0105239_10117421 Ga0105239_101174213 235
202 3300010375 Ga0105239_10175291 Ga0105239_101752912 235
203 3300010375 Ga0105239_10305171 Ga0105239_103051712 235
204 3300010375 Ga0105239_11035247 Ga0105239_110352471 235
205 3300013100 Ga0157373_10004385 Ga0157373_100043858 235
206 3300013104 Ga0157370_10004544 Ga0157370_100045448 235
207 3300013104 Ga0157370_10132969 Ga0157370_101329692 235
208 3300013105 Ga0157369_10005962 Ga0157369_100059626 235
209 3300013105 Ga0157369_10066992 Ga0157369_100669924 235
210 3300013296 Ga0157374_10082693 Ga0157374_100826934 235
211 3300013297 Ga0157378_10122125 Ga0157378_101221254 235
212 3300013297 Ga0157378_10138420 Ga0157378_101384202 235
213 3300013306 Ga0163162_10481030 Ga0163162_104810302 235
214 3300013307 Ga0157372_10045612 Ga0157372_100456123 235
215 3300013307 Ga0157372_10048189 Ga0157372_100481895 235
216 3300013307 Ga0157372_10052770 Ga0157372_100527702 235
217 3300013307 Ga0157372_10062892 Ga0157372_100628924 235
218 3300014968 Ga0157379_10001171 Ga0157379_1000117112 235
219 3300014968 Ga0157379_10002326 Ga0157379_1000232610 235
220 3300014968 Ga0157379_10267690 Ga0157379_102676902 235
221 3300014968 Ga0157379_10268329 Ga0157379_102683292 235
222 3300017792 Ga0163161_10393420 Ga0163161_103934202 235
223 3300021384 Ga0213876_10000469 Ga0213876_100004696 235
224 3300021384 Ga0213876_10000586 Ga0213876_1000058617 235
225 3300025292 Ga0209676_1000272 Ga0209676_10002729 235
226 3300025292 Ga0209676_1000899 Ga0209676_100089911 235
227 3300025295 Ga0209564_1002018 Ga0209564_10020184 235
228 3300025295 Ga0209564_1029307 Ga0209564_10293072 235
229 3300025297 Ga0209758_1004244 Ga0209758_10042444 235
230 3300025298 Ga0209050_1000344 Ga0209050_100034492 235
231 3300025298 Ga0209050_1002568 Ga0209050_10025689 235
232 3300025299 Ga0209256_1000666 Ga0209256_10006664 235
233 3300025299 Ga0209256_1010423 Ga0209256_10104233 235
234 3300025303 Ga0209051_1000743 Ga0209051_100074317 235
235 3300025304 Ga0209257_1000066 Ga0209257_1000066324 235
236 3300025304 Ga0209257_1000624 Ga0209257_100062424 235
237 3300025304 Ga0209257_1020404 Ga0209257_10204043 235
238 3300025903 Ga0207680_10001384 Ga0207680_100013847 235
239 3300025906 Ga0207699_10000126 Ga0207699_1000012620 235
240 3300025909 Ga0207705_10000263 Ga0207705_1000026326 235
241 3300025911 Ga0207654_10319422 Ga0207654_103194222 235
242 3300025912 Ga0207707_10000005 Ga0207707_10000005262 235
243 3300025912 Ga0207707_10028347 Ga0207707_100283472 235
244 3300025913 Ga0207695_10000003 Ga0207695_100000031235 235
245 3300025913 Ga0207695_10002114 Ga0207695_1000211411 235
246 3300025913 Ga0207695_10028954 Ga0207695_100289545 235
247 3300025913 Ga0207695_10139002 Ga0207695_101390022 235
248 3300025913 Ga0207695_10144956 Ga0207695_101449563 235
249 3300025913 Ga0207695_10266654 Ga0207695_102666542 235
250 3300025914 Ga0207671_10012710 Ga0207671_100127105 235
251 3300025915 Ga0207693_10002754 Ga0207693_100027545 235
252 3300025915 Ga0207693_10309015 Ga0207693_103090152 235
253 3300025916 Ga0207663_10345474 Ga0207663_103454742 235
254 3300025916 Ga0207663_10394660 Ga0207663_103946602 235
255 3300025917 Ga0207660_10004821 Ga0207660_100048216 235
256 3300025917 Ga0207660_10005434 Ga0207660_100054348 235
257 3300025919 Ga0207657_10000114 Ga0207657_1000011437 235
258 3300025920 Ga0207649_10009157 Ga0207649_100091575 235
259 3300025921 Ga0207652_10000320 Ga0207652_1000032017 235
260 3300025921 Ga0207652_10005507 Ga0207652_100055073 235
261 3300025922 Ga0207646_10029610 Ga0207646_100296103 235
262 3300025924 Ga0207694_10000005 Ga0207694_10000005665 235
263 3300025924 Ga0207694_10028078 Ga0207694_100280784 235
264 3300025924 Ga0207694_10095576 Ga0207694_100955763 235
265 3300025928 Ga0207700_10000010 Ga0207700_10000010123 235
266 3300025929 Ga0207664_10046955 Ga0207664_100469554 235
267 3300025929 Ga0207664_10191132 Ga0207664_101911322 235
268 3300025931 Ga0207644_10015582 Ga0207644_100155823 235
269 3300025932 Ga0207690_10151904 Ga0207690_101519042 235
270 3300025939 Ga0207665_10071107 Ga0207665_100711072 235
271 3300025941 Ga0207711_10000002 Ga0207711_10000002909 235
272 3300025949 Ga0207667_10000183 Ga0207667_1000018327 235
273 3300025949 Ga0207667_10018054 Ga0207667_100180544 235
274 3300025981 Ga0207640_10280436 Ga0207640_102804362 235
275 3300026041 Ga0207639_10013017 Ga0207639_100130174 235
276 3300026041 Ga0207639_10024671 Ga0207639_100246712 235
277 3300026041 Ga0207639_10601091 Ga0207639_106010912 235
278 3300026067 Ga0207678_10271332 Ga0207678_102713322 235
279 3300026078 Ga0207702_10000013 Ga0207702_10000013164 235
280 3300026078 Ga0207702_10001346 Ga0207702_100013469 235
281 3300026088 Ga0207641_10000277 Ga0207641_1000027712 235
282 3300026088 Ga0207641_10011325 Ga0207641_100113253 235
283 3300026095 Ga0207676_10000600 Ga0207676_1000060027 235
284 3300026095 Ga0207676_10228387 Ga0207676_102283872 235
285 3300026116 Ga0207674_10001730 Ga0207674_1000173014 235
286 3300028379 Ga0268266_10419396 Ga0268266_104193962 235
287 3300028556 Ga0265337_1003661 Ga0265337_10036612 235
288 3300028573 Ga0265334_10003731 Ga0265334_100037315 235
289 3300028577 Ga0265318_10000436 Ga0265318_1000043626 235
290 3300028577 Ga0265318_10046087 Ga0265318_100460871 235
291 3300028794 Ga0307515_10058728 Ga0307515_100587283 235
292 3300028794 Ga0307515_10105570 Ga0307515_101055701 235
293 3300028800 Ga0265338_10000006 Ga0265338_1000000614 235
294 3300028800 Ga0265338_10019953 Ga0265338_100199537 235
295 3300028800 Ga0265338_10031329 Ga0265338_100313295 235
296 3300028800 Ga0265338_10121670 Ga0265338_101216702 235
297 3300031235 Ga0265330_10007638 Ga0265330_100076385 235
298 3300031238 Ga0265332_10040969 Ga0265332_100409692 235
299 3300031238 Ga0265332_10119737 Ga0265332_101197371 235
300 3300031240 Ga0265320_10000807 Ga0265320_1000080724 235
301 3300031241 Ga0265325_10000007 Ga0265325_1000000714 235
302 3300031242 Ga0265329_10050804 Ga0265329_100508042 235
303 3300031247 Ga0265340_10000115 Ga0265340_1000011542 235
304 3300031247 Ga0265340_10000844 Ga0265340_100008446 235
305 3300031247 Ga0265340_10018845 Ga0265340_100188453 235
306 3300031247 Ga0265340_10032445 Ga0265340_100324452 235
307 3300031247 Ga0265340_10040327 Ga0265340_100403272 235
308 3300031247 Ga0265340_10107060 Ga0265340_101070602 235
309 3300031249 Ga0265339_10001769 Ga0265339_100017695 235
310 3300031249 Ga0265339_10053799 Ga0265339_100537992 235
311 3300031249 Ga0265339_10106389 Ga0265339_101063892 235
312 3300031250 Ga0265331_10000006 Ga0265331_1000000612 235
313 3300031250 Ga0265331_10002860 Ga0265331_1000286010 235
314 3300031250 Ga0265331_10006743 Ga0265331_100067432 235
315 3300031250 Ga0265331_10026162 Ga0265331_100261623 235
316 3300031251 Ga0265327_10000430 Ga0265327_1000043039 235
317 3300031344 Ga0265316_10014699 Ga0265316_100146996 235
318 3300031344 Ga0265316_10019198 Ga0265316_100191985 235
319 3300031344 Ga0265316_10052990 Ga0265316_100529902 235
320 3300031344 Ga0265316_10119102 Ga0265316_101191022 235
321 3300031344 Ga0265316_10184079 Ga0265316_101840792 235
322 3300031344 Ga0265316_10415230 Ga0265316_104152301 235
323 3300031595 Ga0265313_10002331 Ga0265313_1000233117 235
324 3300031595 Ga0265313_10020238 Ga0265313_100202382 235
325 3300031595 Ga0265313_10026131 Ga0265313_100261312 235
326 3300031711 Ga0265314_10004741 Ga0265314_100047411 235
327 3300031711 Ga0265314_10041163 Ga0265314_100411633 235
328 3300031711 Ga0265314_10148944 Ga0265314_101489442 235
329 3300031712 Ga0265342_10024454 Ga0265342_100244543 235
330 3300031712 Ga0265342_10036320 Ga0265342_100363202 235
331 3300031712 Ga0265342_10050131 Ga0265342_100501311 235
332 3300031730 Ga0307516_10013579 Ga0307516_100135798 235
333 3300031901 Ga0307406_10413477 Ga0307406_104134772 235
334 3300032002 Ga0307416_100348657 Ga0307416_1003486572 235
335 3300035091 Ga0373951_0089688 Ga0373951_0089688_19_744 235
336 3300035118 Ga0373954_0031633 Ga0373954_0031633_1591_2391 235
337 3300035172 Ga0373955_0067965 Ga0373955_0067965_112_885 235
338 3300035207 Ga0373942_0011104 Ga0373942_0011104_813_1589 235
339 3300035691 Ga0373931_0013868 Ga0373931_0013868_1479_2252 235
340 3300035692 Ga0373935_0010737 Ga0373935_0010737_4300_5073 235
341 3300035692 Ga0373935_0114475 Ga0373935_0114475_868_1641 235
342 3300035695 Ga0373927_0103654 Ga0373927_0103654_439_1212 235
343 3300035724 Ga0373933_0026091 Ga0373933_0026091_1243_2016 235
344 3300035724 Ga0373933_0028923 Ga0373933_0028923_1492_2337 235
345 3300035724 Ga0373933_0141973 Ga0373933_0141973_389_1162 235
346 3300035725 Ga0373947_0024952 Ga0373947_0024952_797_1570 235
347 3300036401 Ga0373937_0013134 Ga0373937_0013134_5614_6387 235
348 3300036401 Ga0373937_0024641 Ga0373937_0024641_4591_5391 235
349 3300036401 Ga0373937_0052403 Ga0373937_0052403_981_1826 235
350 3300036401 Ga0373937_0284310 Ga0373937_0284310_229_1002 235
351 3300037068 Ga0373925_0007893 Ga0373925_0007893_507_1280 235
352 3300037068 Ga0373925_0154626 Ga0373925_0154626_952_1725 235
353 3300037068 Ga0373925_0270492 Ga0373925_0270492_375_1166 235
354 3300037471 Ga0395905_0913943 Ga0395905_0913943_17_730 235
355 3300039437 Ga0436365_0073850 Ga0436365_0073850_12048_12821 235
356 3300039437 Ga0436365_0508484 Ga0436365_0508484_79510_80286 235
357 3300039447 Ga0436361_0858734 Ga0436361_0858734_284_1090 235
358 3300039450 Ga0436363_0405125 Ga0436363_0405125_216_989 235
359 3300041512 Ga0451853_2643851 Ga0451853_2643851_1973_2779 235
360 3300042156 Ga0439446_0064877 Ga0439446_0064877_37_843 235
361 3300042461 Ga0439460_0008844 Ga0439460_0008844_1150_1944 235
362 3300046453 Ga0495627_000751 Ga0495627_000751_228_1034 235
363 3300046454 Ga0495592_0114085 Ga0495592_0114085_1058_1834 235
364 3300046455 Ga0495603_0059861 Ga0495603_0059861_1328_2104 235
365 3300046457 Ga0495590_0003110 Ga0495590_0003110_365_1150 235
366 3300046460 Ga0495638_0000283 Ga0495638_0000283_39744_40529 235
367 3300046460 Ga0495638_0001944 Ga0495638_0001944_15130_15936 235
368 3300046460 Ga0495638_0002498 Ga0495638_0002498_3554_4360 235
369 3300046460 Ga0495638_0006034 Ga0495638_0006034_6342_7148 235
370 3300046471 Ga0495650_0024719 Ga0495650_0024719_1979_2764 235
371 3300046473 Ga0495582_0043843 Ga0495582_0043843_50_823 235
372 3300046506 Ga0495583_0000234 Ga0495583_0000234_42212_43018 235
373 3300046512 Ga0495610_0000158 Ga0495610_0000158_50866_51672 235
374 3300046512 Ga0495610_0001132 Ga0495610_0001132_8766_9551 235
375 3300046512 Ga0495610_0007739 Ga0495610_0007739_2455_3261 235
376 3300046518 Ga0495631_0007917 Ga0495631_0007917_2324_3109 235
377 3300046518 Ga0495631_0046806 Ga0495631_0046806_889_1695 235
378 3300046519 Ga0495632_0046359 Ga0495632_0046359_615_1421 235
379 3300046520 Ga0495637_0051691 Ga0495637_0051691_145_930 235
380 3300046522 Ga0495643_0077621 Ga0495643_0077621_574_1383 235
381 3300046522 Ga0495643_0151891 Ga0495643_0151891_322_1128 235
382 3300046524 Ga0495648_0000098 Ga0495648_0000098_78745_79551 235
383 3300046530 Ga0495654_0046723 Ga0495654_0046723_694_1479 235
384 3300046531 Ga0495665_0068846 Ga0495665_0068846_128_901 235
385 3300046543 Ga0495645_0015164 Ga0495645_0015164_1987_2763 235
386 3300046557 Ga0495622_0011314 Ga0495622_0011314_356_1132 235
387 3300046558 Ga0495633_0094799 Ga0495633_0094799_376_1197 235
388 3300046616 Ga0495668_0000389 Ga0495668_0000389_46292_47101 235
389 3300046616 Ga0495668_0003334 Ga0495668_0003334_3933_4718 235
390 3300046616 Ga0495668_0006115 Ga0495668_0006115_7143_7952 235
391 3300046642 Ga0495634_0349436 Ga0495634_0349436_64_840 235
392 3300046660 Ga0495625_0000058 Ga0495625_0000058_43957_44763 235
393 3300046660 Ga0495625_0000864 Ga0495625_0000864_20218_21024 235
394 3300046660 Ga0495625_0001132 Ga0495625_0001132_2016_2822 235
395 3300046660 Ga0495625_0030943 Ga0495625_0030943_1327_2136 235
396 3300046660 Ga0495625_0146420 Ga0495625_0146420_515_1321 235
397 3300046678 Ga0495599_0049698 Ga0495599_0049698_929_1705 235
398 3300046683 Ga0495658_0001976 Ga0495658_0001976_1014_1787 235
399 3300046683 Ga0495658_0063530 Ga0495658_0063530_930_1706 235
400 3300046689 Ga0495613_0047071 Ga0495613_0047071_333_1106 235
401 3300046692 Ga0495671_0106929 Ga0495671_0106929_396_1181 235
402 3300046794 Ga0495589_0039090 Ga0495589_0039090_896_1702 235
403 3300047320 Ga0495672_0024447 Ga0495672_0024447_2246_3052 235
404 3300047444 Ga0495675_0013756 Ga0495675_0013756_3630_4406 235
405 3300047446 Ga0495679_021927 Ga0495679_021927_1056_1862 235
406 3300047469 Ga0495673_0000428 Ga0495673_0000428_39721_40527 235
407 3300047469 Ga0495673_0000492 Ga0495673_0000492_18178_18963 235
408 3300047472 Ga0495686_0000863 Ga0495686_0000863_13900_14685 235
409 3300047472 Ga0495686_0009487 Ga0495686_0009487_6100_6906 235
410 3300048088 Ga0495602_0243771 Ga0495602_0243771_202_975 235
411 3300048909 Ga0496106_0011902 Ga0496106_0011902_2298_3104 235
412 3300048910 Ga0496107_0000067 Ga0496107_0000067_34964_35770 235
413 3300048924 Ga0496121_0000266 Ga0496121_0000266_19668_20474 235
414 3300048924 Ga0496121_0003464 Ga0496121_0003464_4589_5386 235
415 3300048924 Ga0496121_0075693 Ga0496121_0075693_332_1144 235
416 3300048927 Ga0496124_0028058 Ga0496124_0028058_2405_3226 235
417 3300048928 Ga0496125_0072951 Ga0496125_0072951_752_1561 235
418 3300048929 Ga0496126_0000542 Ga0496126_0000542_29313_30089 235
419 3300048929 Ga0496126_0009144 Ga0496126_0009144_2728_3537 235
420 3300048929 Ga0496126_0236153 Ga0496126_0236153_226_1023 235
421 3300049459 Ga0495678_009454 Ga0495678_009454_215_1000 235
422 3300049460 Ga0495682_0059023 Ga0495682_0059023_199_975 235
423 3300049568 Ga0501031_0190838 Ga0501031_0190838_23_796 235
424 3300049570 Ga0501033_0014156 Ga0501033_0014156_2866_3639 235
425 3300049570 Ga0501033_0082811 Ga0501033_0082811_515_1288 235
426 3300049571 Ga0501034_0029743 Ga0501034_0029743_3390_4163 235
427 3300049571 Ga0501034_0111134 Ga0501034_0111134_390_1220 235
428 3300049572 Ga0501036_0039405 Ga0501036_0039405_1894_2619 235
429 3300049572 Ga0501036_0057057 Ga0501036_0057057_2523_3296 235
430 3300049573 Ga0501037_0447845 Ga0501037_0447845_46_819 235
431 3300049574 Ga0501038_0053264 Ga0501038_0053264_1630_2403 235
432 3300049574 Ga0501038_0079962 Ga0501038_0079962_1619_2392 235
433 3300049576 Ga0501040_0006325 Ga0501040_0006325_4584_5309 235
434 3300049577 Ga0501041_0026403 Ga0501041_0026403_1113_1838 235
435 3300049578 Ga0501042_0200924 Ga0501042_0200924_432_1157 235
436 3300049579 Ga0501043_0288346 Ga0501043_0288346_281_1054 235
437 3300049579 Ga0501043_0617511 Ga0501043_0617511_26_751 235
438 3300049580 Ga0501046_0013015 Ga0501046_0013015_4578_5303 235
439 3300049580 Ga0501046_0379608 Ga0501046_0379608_15_788 235
440 3300049581 Ga0501047_0006146 Ga0501047_0006146_1548_2321 235
441 3300049581 Ga0501047_0304684 Ga0501047_0304684_25_798 235
442 3300049582 Ga0501048_0125885 Ga0501048_0125885_46_771 235
443 3300049583 Ga0501067_0007275 Ga0501067_0007275_2173_2946 235
444 3300049583 Ga0501067_0035034 Ga0501067_0035034_244_1017 235
445 3300049584 Ga0501068_0161264 Ga0501068_0161264_245_1018 235
446 3300049586 Ga0501070_0000047 Ga0501070_0000047_82328_83101 235
447 3300049586 Ga0501070_0003346 Ga0501070_0003346_9663_10436 235
448 3300049586 Ga0501070_0435401 Ga0501070_0435401_127_903 235
449 3300049587 Ga0501071_0346469 Ga0501071_0346469_31_828 235
450 3300049588 Ga0501072_0238499 Ga0501072_0238499_412_1137 235
451 3300049589 Ga0501073_0009287 Ga0501073_0009287_184_957 235
452 3300049589 Ga0501073_0123937 Ga0501073_0123937_559_1335 235
453 3300049589 Ga0501073_0297523 Ga0501073_0297523_166_939 235
454 3300049590 Ga0501074_0095157 Ga0501074_0095157_425_1198 235
455 3300049590 Ga0501074_0124995 Ga0501074_0124995_72_845 235
456 3300049593 Ga0501077_0085425 Ga0501077_0085425_682_1407 235
457 3300049741 Ga0501079_0066502 Ga0501079_0066502_2044_2769 235
458 3300049741 Ga0501079_0102868 Ga0501079_0102868_803_1576 235
459 3300049741 Ga0501079_0261600 Ga0501079_0261600_337_1110 235
460 3300049742 Ga0501080_0000366 Ga0501080_0000366_14689_15462 235
461 3300049742 Ga0501080_0188883 Ga0501080_0188883_53_826 235
462 3300049822 Ga0501035_0006816 Ga0501035_0006816_8693_9466 235
463 3300049822 Ga0501035_0039552 Ga0501035_0039552_2966_3739 235
464 3300049823 Ga0501044_0019366 Ga0501044_0019366_3024_3797 235
465 3300049823 Ga0501044_0033137 Ga0501044_0033137_1391_2164 235
466 3300049823 Ga0501044_0039259 Ga0501044_0039259_1372_2145 235
467 3300049823 Ga0501044_0109480 Ga0501044_0109480_110_883 235
468 3300049823 Ga0501044_0380390 Ga0501044_0380390_70_843 235
469 3300050509 nmdc:mga0qj67_289663_c1 nmdc:mga0qj67_289663_c1_18_764 235
470 3300050512 nmdc:mga0n895_41051_c1 nmdc:mga0n895_41051_c1_3082_3855 235
471 3300050513 nmdc:mga0rr50_5661_c1 nmdc:mga0rr50_5661_c1_3540_4313 235
472 3300050514 nmdc:mga08x19_123936_c1 nmdc:mga08x19_123936_c1_405_1178 235
473 3300050514 nmdc:mga08x19_50_c1 nmdc:mga08x19_50_c1_28976_29749 235
474 3300053080 Ga0500635_0028003 Ga0500635_0028003_772_1548 235
475 3300053086 Ga0500578_0000270 Ga0500578_0000270_18214_18999 235
476 3300053088 Ga0500644_0000665 Ga0500644_0000665_6412_7233 235
477 3300053088 Ga0500644_0000688 Ga0500644_0000688_6317_7102 235
478 3300053090 Ga0500646_0039154 Ga0500646_0039154_30_806 235
479 3300053102 Ga0500554_007983 Ga0500554_007983_644_1450 235
480 3300053103 Ga0500555_001311 Ga0500555_001311_622_1395 235
481 3300053104 Ga0500556_0033045 Ga0500556_0033045_317_1102 235
482 3300053108 Ga0500562_001389 Ga0500562_001389_1113_1898 235
483 3300053118 Ga0500594_0001228 Ga0500594_0001228_1767_2552 235
484 3300053122 Ga0500608_000382 Ga0500608_000382_2117_2929 235
485 3300053123 Ga0500614_005558 Ga0500614_005558_766_1572 235
486 3300053125 Ga0500618_000185 Ga0500618_000185_42731_43537 235
487 3300053134 Ga0500658_0001423 Ga0500658_0001423_3273_4079 235
488 3300053136 Ga0500559_0000056 Ga0500559_0000056_52369_53175 235
489 3300053136 Ga0500559_0001893 Ga0500559_0001893_8837_9649 235
490 3300053138 Ga0500564_000033 Ga0500564_000033_8243_9028 235
491 3300053142 Ga0500577_0001288 Ga0500577_0001288_3279_4088 235
492 3300053154 Ga0500619_054569 Ga0500619_054569_248_1024 235
493 3300053156 Ga0500622_0000553 Ga0500622_0000553_1260_2045 235
494 3300053156 Ga0500622_0012270 Ga0500622_0012270_1172_1981 235
495 3300053178 Ga0500637_0000212 Ga0500637_0000212_19117_19893 235
496 3300054114 Ga0501084_0010924 Ga0501084_0010924_1681_2406 235
497 3300060353 Ga0501082_0008707 Ga0501082_0008707_3775_4500 235
498 3300061734 Ga0530510_0075573 Ga0530510_0075573_84_809 235
499 iso_pu_bacteria 2582581279 2585149712 235
500 iso_pu_bacteria 2582581280 2585154934 235
501 iso_pu_bacteria 2585428106 2587915768 235
502 iso_pu_bacteria 2643221640 2644223319 235
503 iso_pu_bacteria 2643221642 2644236411 235
504 iso_pu_bacteria 2849560528 2849563895 235
505 iso_pu_bacteria 2849573788 2849578740 235
506 iso_pu_bacteria 2857504554 2857505695 235
507 iso_pu_bacteria 2884960567 2884965512 235
508 iso_pu_bacteria 2928531327 2928532202 235
509 3300001989 JGI24739J22299_10003190 JGI24739J22299_100031906 236
510 3300001989 JGI24739J22299_10038795 JGI24739J22299_100387952 236
511 3300005295 Ga0065707_10082679 Ga0065707_100826795 236
512 3300005295 Ga0065707_10086182 Ga0065707_100861822 236
513 3300005331 Ga0070670_100000005 Ga0070670_100000005120 236
514 3300005347 Ga0070668_100166645 Ga0070668_1001666452 236
515 3300005353 Ga0070669_100000195 Ga0070669_10000019530 236
516 3300005367 Ga0070667_100001850 Ga0070667_10000185015 236
517 3300005539 Ga0068853_100011500 Ga0068853_1000115005 236
518 3300005577 Ga0068857_100142709 Ga0068857_1001427092 236
519 3300005616 Ga0068852_100317212 Ga0068852_1003172121 236
520 3300005617 Ga0068859_100010247 Ga0068859_1000102475 236
521 3300005618 Ga0068864_100000011 Ga0068864_100000011119 236
522 3300005719 Ga0068861_100034416 Ga0068861_1000344164 236
523 3300005841 Ga0068863_100053251 Ga0068863_1000532514 236
524 3300005844 Ga0068862_100000011 Ga0068862_100000011117 236
525 3300006931 Ga0097620_100010246 Ga0097620_1000102465 236
526 3300009177 Ga0105248_10000069 Ga0105248_1000006991 236
527 3300009545 Ga0105237_10018738 Ga0105237_100187382 236
528 3300009551 Ga0105238_10038976 Ga0105238_100389762 236
529 3300012513 Ga0157326_1000424 Ga0157326_10004245 236
530 3300014325 Ga0163163_10059627 Ga0163163_100596272 236
531 3300014326 Ga0157380_10003531 Ga0157380_1000353111 236
532 3300021384 Ga0213876_10026209 Ga0213876_100262093 236
533 3300025914 Ga0207671_10004851 Ga0207671_1000485110 236
534 3300025923 Ga0207681_10000001 Ga0207681_10000001540 236
535 3300025924 Ga0207694_10047323 Ga0207694_100473234 236
536 3300025925 Ga0207650_10000018 Ga0207650_10000018120 236
537 3300025933 Ga0207706_10002602 Ga0207706_100026023 236
538 3300025972 Ga0207668_10071530 Ga0207668_100715302 236
539 3300025981 Ga0207640_10077579 Ga0207640_100775792 236
540 3300025986 Ga0207658_10000902 Ga0207658_100009029 236
541 3300026041 Ga0207639_10004074 Ga0207639_100040747 236
542 3300026088 Ga0207641_10041166 Ga0207641_100411664 236
543 3300026095 Ga0207676_10000004 Ga0207676_10000004513 236
544 3300026116 Ga0207674_10077154 Ga0207674_100771543 236
545 3300026118 Ga0207675_100004115 Ga0207675_10000411512 236
546 3300026142 Ga0207698_10101748 Ga0207698_101017482 236
547 3300028380 Ga0268265_10000002 Ga0268265_10000002557 236
548 3300031901 Ga0307406_10021598 Ga0307406_100215985 236
549 3300031911 Ga0307412_10028714 Ga0307412_100287143 236
550 3300032002 Ga0307416_100313733 Ga0307416_1003137332 236
551 3300035695 Ga0373927_0056036 Ga0373927_0056036_572_1366 236
552 3300035725 Ga0373947_0149494 Ga0373947_0149494_196_990 236
553 3300039437 Ga0436365_1535986 Ga0436365_1535986_1481_2260 236
554 3300046460 Ga0495638_0044711 Ga0495638_0044711_1295_2092 236
555 3300046522 Ga0495643_0058055 Ga0495643_0058055_206_1000 236
556 3300046522 Ga0495643_0079090 Ga0495643_0079090_94_888 236
557 3300046530 Ga0495654_0000264 Ga0495654_0000264_27763_28503 236
558 3300046539 Ga0495621_0043406 Ga0495621_0043406_135_929 236
559 3300046616 Ga0495668_0000984 Ga0495668_0000984_17984_18724 236
560 3300046660 Ga0495625_0154451 Ga0495625_0154451_279_1073 236
561 3300047472 Ga0495686_0000201 Ga0495686_0000201_73137_73934 236
562 3300047472 Ga0495686_0001890 Ga0495686_0001890_13172_13969 236
563 3300047472 Ga0495686_0021547 Ga0495686_0021547_1353_2150 236
564 3300048906 Ga0496103_0000173 Ga0496103_0000173_37806_38606 236
565 3300048919 Ga0496116_0000566 Ga0496116_0000566_29036_29836 236
566 3300048920 Ga0496117_0000485 Ga0496117_0000485_28004_28804 236
567 3300048920 Ga0496117_0021462 Ga0496117_0021462_2580_3377 236
568 3300048921 Ga0496118_0000190 Ga0496118_0000190_28004_28804 236
569 3300048921 Ga0496118_0013898 Ga0496118_0013898_5031_5828 236
570 3300048922 Ga0496119_0112936 Ga0496119_0112936_36_833 236
571 3300048923 Ga0496120_0023669 Ga0496120_0023669_2169_2969 236
572 3300048924 Ga0496121_0008737 Ga0496121_0008737_4709_5506 236
573 3300048924 Ga0496121_0061195 Ga0496121_0061195_1835_2632 236
574 3300048927 Ga0496124_0000546 Ga0496124_0000546_34821_35621 236
575 3300049679 Ga0501249_006802 Ga0501249_006802_694_1476 236
576 3300049823 Ga0501044_0061340 Ga0501044_0061340_1419_2216 236
577 3300053093 Ga0500651_0058051 Ga0500651_0058051_849_1643 236
578 3300053096 Ga0500641_0015395 Ga0500641_0015395_943_1737 236
579 3300053098 Ga0500650_0192337 Ga0500650_0192337_11_805 236
580 3300053130 Ga0500642_0086375 Ga0500642_0086375_370_1164 236
581 3300053133 Ga0500655_000052 Ga0500655_000052_23447_24241 236
582 3300053136 Ga0500559_0007037 Ga0500559_0007037_3225_4022 236
583 3300053136 Ga0500559_0027225 Ga0500559_0027225_1181_1978 236
584 3300053148 Ga0500590_002752 Ga0500590_002752_950_1744 236
585 3300053156 Ga0500622_0008348 Ga0500622_0008348_716_1510 236
586 3300053158 Ga0500627_0000188 Ga0500627_0000188_194_934 236
587 3300053163 Ga0500639_064582 Ga0500639_064582_1069_1863 236
588 3300053724 Ga0500570_000179 Ga0500570_000179_7521_8315 236
589 iso_pu_bacteria 2582581305 2585263237 236
590 iso_pu_bacteria 2643221541 2643730537 236
591 iso_pu_bacteria 2643221605 2644037513 236
592 iso_pu_bacteria 2643221606 2644043706 236
593 iso_pu_bacteria 2643221671 2644393865 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

42

242

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9539 2 233
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9447 2 236
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.937 2 236
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9345 2 233
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.9336 2 236
ID Description Score Start End Superfamily
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4414 35 232 1.10.357.20
af_Q9V3Y4_23_306_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4246 75 227 1.50.40.10
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4181 35 232 1.10.357.20
af_A0A0P0X1Q4_273_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4156 37 224 1.20.1250.20
af_A0A1D6PYN6_84_244_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4101 37 231 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A0U5EW34-F1-model_v4 ABC transporter permease 0.9858 2 235 GO:0005548
GO:0043190
AF-A0A7Y3GYF9-F1-model_v4 ABC transporter permease 0.9849 2 232 GO:0005548
GO:0043190
AF-A0A2A4G292-F1-model_v4 ABC transporter permease 0.9841 2 236 GO:0005548
GO:0043190
AF-A0A2Z5ZGC0-F1-model_v4 ABC transporter 0.9841 2 235 GO:0005548
GO:0043190
AF-A0A2K8L6D9-F1-model_v4 Phospholipid/cholesterol/gamma-HCH transport system permease protein 0.9819 2 236 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
90.25 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map