F466981
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 260 | 590 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0423399|Ga0373925_0423399_481_1005 |
| Length | 147 |
| Sequence | VGVLDRSQAEGRERHDATAHDGGLGSASTADARDDAMTIIPTVLLLVCSNLFMTIAWYAHLKNLADRPWYVAAIVSWGIALFEYLLQVPANRIGFHVVSLAQLKIIQEIITLAVFVPFAVFYMRQPVTWNFLWAGVCLMGAVYFMFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 83 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 180 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 181 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 182 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 183 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 184 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 185 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 186 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 187 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 188 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 189 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 190 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 191 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 230 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 231 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 232 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 233 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 237 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 239 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 241 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 242 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 244 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 245 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 246 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 247 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 248 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 250 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 256 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 257 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 258 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 259 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 260 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.17 |
| Nodule | 0.17 |
| Rhizoplane | 4.24 |
| Rhizosphere | 82.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1001665 | 3300002773 | Bacteria | 9215 |
| 2 | JGI25150J39212_1026233 | 3300002774 | Bacteria | 844 |
| 3 | JGI25153J46596_10007026 | 3300003215 | Bacteria | 5605 |
| 4 | rootL2_10071287 | 3300003322 | Bacteria | 2448 |
| 5 | Ga0055526_1006007 | 3300003771 | Bacteria | 6741 |
| 6 | Ga0055526_1010196 | 3300003771 | Bacteria | 4403 |
| 7 | Ga0055528_1073289 | 3300003790 | Bacteria | 614 |
| 8 | Ga0055543_1003721 | 3300004625 | Bacteria | 4365 |
| 9 | Ga0065165_1000151 | 3300005262 | Bacteria | 120917 |
| 10 | Ga0065165_1000166 | 3300005262 | Bacteria | 115866 |
| 11 | Ga0065165_1003633 | 3300005262 | Bacteria | 10560 |
| 12 | Ga0070658_10452234 | 3300005327 | Bacteria | 1107 |
| 13 | Ga0070658_10494048 | 3300005327 | Bacteria | 1056 |
| 14 | Ga0070676_10241457 | 3300005328 | Bacteria | 1202 |
| 15 | Ga0070676_10471206 | 3300005328 | Bacteria | 887 |
| 16 | Ga0070670_100020576 | 3300005331 | Bacteria | 5675 |
| 17 | Ga0070670_100087630 | 3300005331 | Bacteria | 2675 |
| 18 | Ga0070670_100163454 | 3300005331 | Bacteria | 1930 |
| 19 | Ga0070670_100492426 | 3300005331 | Bacteria | 1089 |
| 20 | Ga0070677_10007318 | 3300005333 | Bacteria | 3683 |
| 21 | Ga0070677_10036866 | 3300005333 | Bacteria | 1905 |
| 22 | Ga0070677_10171988 | 3300005333 | Bacteria | 1025 |
| 23 | Ga0068869_100008578 | 3300005334 | Bacteria | 6598 |
| 24 | Ga0068869_100009021 | 3300005334 | Bacteria | 6463 |
| 25 | Ga0068869_100489138 | 3300005334 | Bacteria | 1026 |
| 26 | Ga0070666_10008568 | 3300005335 | Bacteria | 6353 |
| 27 | Ga0070666_10042193 | 3300005335 | Bacteria | 3051 |
| 28 | Ga0070666_10549998 | 3300005335 | Bacteria | 839 |
| 29 | Ga0070666_11313381 | 3300005335 | Bacteria | 540 |
| 30 | Ga0068868_100016008 | 3300005338 | Bacteria | 5561 |
| 31 | Ga0068868_100088171 | 3300005338 | Bacteria | 2497 |
| 32 | Ga0068868_100329161 | 3300005338 | Bacteria | 1303 |
| 33 | Ga0068868_100573405 | 3300005338 | Bacteria | 997 |
| 34 | Ga0068868_101182042 | 3300005338 | Bacteria | 707 |
| 35 | Ga0070660_100323247 | 3300005339 | Bacteria | 1268 |
| 36 | Ga0070689_100005848 | 3300005340 | Bacteria | 8451 |
| 37 | Ga0070689_100117669 | 3300005340 | Bacteria | 2120 |
| 38 | Ga0070687_100027854 | 3300005343 | Bacteria | 2735 |
| 39 | Ga0070687_100045233 | 3300005343 | Bacteria | 2247 |
| 40 | Ga0070661_100061882 | 3300005344 | Bacteria | 2748 |
| 41 | Ga0070661_100074410 | 3300005344 | Bacteria | 2501 |
| 42 | Ga0070661_100201255 | 3300005344 | Bacteria | 1522 |
| 43 | Ga0070661_101195980 | 3300005344 | Bacteria | 636 |
| 44 | Ga0070668_100007130 | 3300005347 | Bacteria | 8283 |
| 45 | Ga0070668_100556649 | 3300005347 | Bacteria | 999 |
| 46 | Ga0070669_100001340 | 3300005353 | Bacteria | 17754 |
| 47 | Ga0070669_100298297 | 3300005353 | Bacteria | 1295 |
| 48 | Ga0070675_100014979 | 3300005354 | Bacteria | 6124 |
| 49 | Ga0070675_100024515 | 3300005354 | Bacteria | 4831 |
| 50 | Ga0070675_100079931 | 3300005354 | Bacteria | 2725 |
| 51 | Ga0070675_100116471 | 3300005354 | Bacteria | 2267 |
| 52 | Ga0070675_100176442 | 3300005354 | Bacteria | 1845 |
| 53 | Ga0070671_100009693 | 3300005355 | Bacteria | 7738 |
| 54 | Ga0070671_100066889 | 3300005355 | Bacteria | 2995 |
| 55 | Ga0070671_100099617 | 3300005355 | Bacteria | 2438 |
| 56 | Ga0070671_100313041 | 3300005355 | Bacteria | 1337 |
| 57 | Ga0070671_100406523 | 3300005355 | Bacteria | 1165 |
| 58 | Ga0070671_100711509 | 3300005355 | Bacteria | 872 |
| 59 | Ga0070674_100013491 | 3300005356 | Bacteria | 5053 |
| 60 | Ga0070674_100134822 | 3300005356 | Bacteria | 1846 |
| 61 | Ga0070674_100272725 | 3300005356 | Bacteria | 1338 |
| 62 | Ga0070674_100448932 | 3300005356 | Bacteria | 1064 |
| 63 | Ga0070674_101137331 | 3300005356 | Bacteria | 691 |
| 64 | Ga0070673_100000512 | 3300005364 | Bacteria | 20784 |
| 65 | Ga0070673_100007311 | 3300005364 | Bacteria | 7271 |
| 66 | Ga0070673_100026611 | 3300005364 | Bacteria | 4275 |
| 67 | Ga0070673_100113770 | 3300005364 | Bacteria | 2247 |
| 68 | Ga0070673_100115213 | 3300005364 | Bacteria | 2235 |
| 69 | Ga0070673_100586547 | 3300005364 | Bacteria | 1016 |
| 70 | Ga0070673_100848584 | 3300005364 | Bacteria | 845 |
| 71 | Ga0070688_100024768 | 3300005365 | Bacteria | 3546 |
| 72 | Ga0070688_101045358 | 3300005365 | Bacteria | 651 |
| 73 | Ga0070659_100352647 | 3300005366 | Bacteria | 1235 |
| 74 | Ga0070667_100001703 | 3300005367 | Bacteria | 19670 |
| 75 | Ga0070667_100004388 | 3300005367 | Bacteria | 11903 |
| 76 | Ga0070667_100006263 | 3300005367 | Bacteria | 9893 |
| 77 | Ga0070667_100321402 | 3300005367 | Bacteria | 1396 |
| 78 | Ga0070667_100456592 | 3300005367 | Bacteria | 1168 |
| 79 | Ga0070701_10093410 | 3300005438 | Bacteria | 1653 |
| 80 | Ga0070701_10367515 | 3300005438 | Bacteria | 903 |
| 81 | Ga0070708_101509850 | 3300005445 | Bacteria | 626 |
| 82 | Ga0070663_101094223 | 3300005455 | Bacteria | 696 |
| 83 | Ga0070678_100004036 | 3300005456 | Bacteria | 8264 |
| 84 | Ga0070678_100010301 | 3300005456 | Bacteria | 5702 |
| 85 | Ga0070678_100197655 | 3300005456 | Bacteria | 1657 |
| 86 | Ga0070678_100494027 | 3300005456 | Bacteria | 1079 |
| 87 | Ga0070678_100684634 | 3300005456 | Bacteria | 922 |
| 88 | Ga0070678_100719893 | 3300005456 | Bacteria | 900 |
| 89 | Ga0070678_100900932 | 3300005456 | Bacteria | 808 |
| 90 | Ga0070662_100008433 | 3300005457 | Bacteria | 6718 |
| 91 | Ga0070662_100134873 | 3300005457 | Bacteria | 1908 |
| 92 | Ga0070662_100411919 | 3300005457 | Bacteria | 1117 |
| 93 | Ga0070662_101233076 | 3300005457 | Bacteria | 643 |
| 94 | Ga0070662_101672335 | 3300005457 | Bacteria | 550 |
| 95 | Ga0068867_100011339 | 3300005459 | Bacteria | 6288 |
| 96 | Ga0068867_100015106 | 3300005459 | Bacteria | 5475 |
| 97 | Ga0068867_100792975 | 3300005459 | Bacteria | 844 |
| 98 | Ga0068867_101724872 | 3300005459 | Bacteria | 588 |
| 99 | Ga0070685_10191425 | 3300005466 | Bacteria | 1324 |
| 100 | Ga0070685_10828728 | 3300005466 | Bacteria | 684 |
| 101 | Ga0070706_100073795 | 3300005467 | Bacteria | 3158 |
| 102 | Ga0070684_101042671 | 3300005535 | Bacteria | 768 |
| 103 | Ga0068853_101496454 | 3300005539 | Bacteria | 653 |
| 104 | Ga0070672_100002366 | 3300005543 | Bacteria | 11936 |
| 105 | Ga0070672_100056785 | 3300005543 | Bacteria | 3071 |
| 106 | Ga0070672_100119912 | 3300005543 | Bacteria | 2152 |
| 107 | Ga0070672_100187342 | 3300005543 | Bacteria | 1726 |
| 108 | Ga0070672_100264018 | 3300005543 | Bacteria | 1452 |
| 109 | Ga0070672_100750413 | 3300005543 | Bacteria | 856 |
| 110 | Ga0070686_100038385 | 3300005544 | Bacteria | 2977 |
| 111 | Ga0070686_100114604 | 3300005544 | Bacteria | 1842 |
| 112 | Ga0070693_100229928 | 3300005547 | Bacteria | 1219 |
| 113 | Ga0070693_100738002 | 3300005547 | Bacteria | 724 |
| 114 | Ga0070693_100957826 | 3300005547 | Bacteria | 645 |
| 115 | Ga0070665_101470701 | 3300005548 | Bacteria | 690 |
| 116 | Ga0068855_101531396 | 3300005563 | Bacteria | 684 |
| 117 | Ga0070664_100102998 | 3300005564 | Bacteria | 2484 |
| 118 | Ga0070664_100592439 | 3300005564 | Bacteria | 1028 |
| 119 | Ga0070664_100928461 | 3300005564 | Bacteria | 816 |
| 120 | Ga0070664_100998784 | 3300005564 | Bacteria | 786 |
| 121 | Ga0070664_101665317 | 3300005564 | Bacteria | 604 |
| 122 | Ga0068857_100124261 | 3300005577 | Bacteria | 2325 |
| 123 | Ga0068854_100014237 | 3300005578 | Bacteria | 5238 |
| 124 | Ga0068854_100411192 | 3300005578 | Bacteria | 1122 |
| 125 | Ga0068854_100648290 | 3300005578 | Bacteria | 906 |
| 126 | Ga0068854_101999974 | 3300005578 | Bacteria | 534 |
| 127 | Ga0070702_100402597 | 3300005615 | Bacteria | 979 |
| 128 | Ga0068852_100009488 | 3300005616 | Bacteria | 7230 |
| 129 | Ga0068852_100064088 | 3300005616 | Bacteria | 3202 |
| 130 | Ga0068852_100269320 | 3300005616 | Bacteria | 1638 |
| 131 | Ga0068852_100394861 | 3300005616 | Bacteria | 1359 |
| 132 | Ga0068852_100684070 | 3300005616 | Bacteria | 1035 |
| 133 | Ga0068852_100935289 | 3300005616 | Bacteria | 885 |
| 134 | Ga0068859_100032866 | 3300005617 | Bacteria | 5212 |
| 135 | Ga0068859_100790279 | 3300005617 | Bacteria | 1037 |
| 136 | Ga0068864_100009050 | 3300005618 | Bacteria | 8209 |
| 137 | Ga0068864_100015458 | 3300005618 | Bacteria | 6346 |
| 138 | Ga0068864_100016929 | 3300005618 | Bacteria | 6074 |
| 139 | Ga0068864_100055318 | 3300005618 | Bacteria | 3425 |
| 140 | Ga0068864_100401503 | 3300005618 | Bacteria | 1302 |
| 141 | Ga0068864_100945142 | 3300005618 | Bacteria | 853 |
| 142 | Ga0068866_10004159 | 3300005718 | Bacteria | 5934 |
| 143 | Ga0068866_10080870 | 3300005718 | Bacteria | 1744 |
| 144 | Ga0068866_10112833 | 3300005718 | Bacteria | 1520 |
| 145 | Ga0068866_10873095 | 3300005718 | Bacteria | 631 |
| 146 | Ga0068866_11005305 | 3300005718 | Bacteria | 593 |
| 147 | Ga0068861_100016694 | 3300005719 | Bacteria | 5200 |
| 148 | Ga0068861_100055084 | 3300005719 | Bacteria | 3031 |
| 149 | Ga0068861_100170880 | 3300005719 | Bacteria | 1801 |
| 150 | Ga0068861_100844326 | 3300005719 | Bacteria | 863 |
| 151 | Ga0068851_10003950 | 3300005834 | Bacteria | 6636 |
| 152 | Ga0068851_10012597 | 3300005834 | Bacteria | 3990 |
| 153 | Ga0068851_10074372 | 3300005834 | Bacteria | 1764 |
| 154 | Ga0068851_10398179 | 3300005834 | Bacteria | 810 |
| 155 | Ga0068851_10420542 | 3300005834 | Bacteria | 789 |
| 156 | Ga0068851_10457232 | 3300005834 | Bacteria | 759 |
| 157 | Ga0068870_10300549 | 3300005840 | Bacteria | 1013 |
| 158 | Ga0068863_100000585 | 3300005841 | Bacteria | 37128 |
| 159 | Ga0068863_100030558 | 3300005841 | Bacteria | 5143 |
| 160 | Ga0068863_100084167 | 3300005841 | Bacteria | 3014 |
| 161 | Ga0068858_100003791 | 3300005842 | Bacteria | 14951 |
| 162 | Ga0068858_100004338 | 3300005842 | Bacteria | 13920 |
| 163 | Ga0068858_100040761 | 3300005842 | Bacteria | 4307 |
| 164 | Ga0068858_100425474 | 3300005842 | Bacteria | 1277 |
| 165 | Ga0068860_100009426 | 3300005843 | Bacteria | 9703 |
| 166 | Ga0068860_100143651 | 3300005843 | Bacteria | 2295 |
| 167 | Ga0068860_100739390 | 3300005843 | Bacteria | 995 |
| 168 | Ga0068862_100007774 | 3300005844 | Bacteria | 8866 |
| 169 | Ga0068862_100017376 | 3300005844 | Bacteria | 5990 |
| 170 | Ga0068862_100092044 | 3300005844 | Bacteria | 2642 |
| 171 | Ga0068862_100237248 | 3300005844 | Bacteria | 1657 |
| 172 | Ga0075363_100046109 | 3300006048 | Bacteria | 2312 |
| 173 | Ga0075363_100092249 | 3300006048 | Bacteria | 1668 |
| 174 | Ga0075363_100135254 | 3300006048 | Bacteria | 1385 |
| 175 | Ga0075364_11106488 | 3300006051 | Bacteria | 538 |
| 176 | Ga0075432_10119778 | 3300006058 | Bacteria | 988 |
| 177 | Ga0070715_10060047 | 3300006163 | Bacteria | 1666 |
| 178 | Ga0075362_10149782 | 3300006177 | Bacteria | 1119 |
| 179 | Ga0075362_10286403 | 3300006177 | Bacteria | 816 |
| 180 | Ga0075362_10547334 | 3300006177 | Bacteria | 595 |
| 181 | Ga0075367_10010079 | 3300006178 | Bacteria | 4955 |
| 182 | Ga0075367_10072398 | 3300006178 | Bacteria | 2075 |
| 183 | Ga0075367_10476319 | 3300006178 | Bacteria | 791 |
| 184 | Ga0075367_10792718 | 3300006178 | Bacteria | 603 |
| 185 | Ga0075369_10082140 | 3300006186 | Bacteria | 1430 |
| 186 | Ga0075366_10004561 | 3300006195 | Bacteria | 7441 |
| 187 | Ga0075366_10041399 | 3300006195 | Bacteria | 2728 |
| 188 | Ga0075366_10060820 | 3300006195 | Bacteria | 2244 |
| 189 | Ga0075366_10074317 | 3300006195 | Bacteria | 2027 |
| 190 | Ga0075366_10095318 | 3300006195 | Bacteria | 1784 |
| 191 | Ga0075366_10111637 | 3300006195 | Bacteria | 1644 |
| 192 | Ga0075366_10212218 | 3300006195 | Bacteria | 1178 |
| 193 | Ga0075366_10262354 | 3300006195 | Bacteria | 1054 |
| 194 | Ga0075366_10269222 | 3300006195 | Bacteria | 1040 |
| 195 | Ga0075366_10288838 | 3300006195 | Bacteria | 1003 |
| 196 | Ga0075366_10302268 | 3300006195 | Bacteria | 979 |
| 197 | Ga0075366_10335030 | 3300006195 | Bacteria | 928 |
| 198 | Ga0075366_10670885 | 3300006195 | Bacteria | 643 |
| 199 | Ga0097621_100029626 | 3300006237 | Bacteria | 4325 |
| 200 | Ga0097621_100046754 | 3300006237 | Bacteria | 3503 |
| 201 | Ga0097621_100070577 | 3300006237 | Bacteria | 2885 |
| 202 | Ga0097621_100103028 | 3300006237 | Bacteria | 2403 |
| 203 | Ga0097621_100275565 | 3300006237 | Bacteria | 1479 |
| 204 | Ga0097621_100397941 | 3300006237 | Bacteria | 1233 |
| 205 | Ga0097621_100908038 | 3300006237 | Bacteria | 821 |
| 206 | Ga0075370_10000538 | 3300006353 | Bacteria | 14505 |
| 207 | Ga0075370_10004004 | 3300006353 | Bacteria | 7081 |
| 208 | Ga0075370_10007898 | 3300006353 | Bacteria | 5445 |
| 209 | Ga0075370_10057411 | 3300006353 | Bacteria | 2212 |
| 210 | Ga0075370_10087471 | 3300006353 | Bacteria | 1795 |
| 211 | Ga0075370_10100191 | 3300006353 | Bacteria | 1676 |
| 212 | Ga0075370_10155526 | 3300006353 | Bacteria | 1341 |
| 213 | Ga0075370_10570672 | 3300006353 | Bacteria | 685 |
| 214 | Ga0075370_10616875 | 3300006353 | Bacteria | 657 |
| 215 | Ga0068871_100101626 | 3300006358 | Bacteria | 2409 |
| 216 | Ga0068871_100165350 | 3300006358 | Bacteria | 1894 |
| 217 | Ga0068871_100184978 | 3300006358 | Bacteria | 1792 |
| 218 | Ga0068871_100255127 | 3300006358 | Bacteria | 1528 |
| 219 | Ga0068871_100478652 | 3300006358 | Bacteria | 1119 |
| 220 | Ga0068871_100736002 | 3300006358 | Bacteria | 906 |
| 221 | Ga0068865_100095849 | 3300006881 | Bacteria | 2162 |
| 222 | Ga0068865_100440218 | 3300006881 | Bacteria | 1075 |
| 223 | Ga0068865_100608154 | 3300006881 | Bacteria | 925 |
| 224 | Ga0097620_100032866 | 3300006931 | Bacteria | 5212 |
| 225 | Ga0097620_100790373 | 3300006931 | Bacteria | 1037 |
| 226 | Ga0097620_101672697 | 3300006931 | Bacteria | 703 |
| 227 | Ga0079104_1066484 | 3300006946 | Bacteria | 765 |
| 228 | Ga0111539_12071301 | 3300009094 | Bacteria | 660 |
| 229 | Ga0105243_10089500 | 3300009148 | Bacteria | 2531 |
| 230 | Ga0105243_10350273 | 3300009148 | Bacteria | 1356 |
| 231 | Ga0105243_10464194 | 3300009148 | Bacteria | 1191 |
| 232 | Ga0105243_10488986 | 3300009148 | Bacteria | 1163 |
| 233 | Ga0105241_12092215 | 3300009174 | Bacteria | 559 |
| 234 | Ga0105242_10051786 | 3300009176 | Bacteria | 3347 |
| 235 | Ga0105242_10373544 | 3300009176 | Bacteria | 1323 |
| 236 | Ga0105248_10069620 | 3300009177 | Bacteria | 3950 |
| 237 | Ga0105248_10072235 | 3300009177 | Bacteria | 3878 |
| 238 | Ga0105248_10155186 | 3300009177 | Bacteria | 2583 |
| 239 | Ga0105248_10193938 | 3300009177 | Bacteria | 2289 |
| 240 | Ga0105248_10216600 | 3300009177 | Bacteria | 2156 |
| 241 | Ga0105248_10665881 | 3300009177 | Bacteria | 1174 |
| 242 | Ga0105248_11118411 | 3300009177 | Bacteria | 890 |
| 243 | Ga0105248_11211900 | 3300009177 | Bacteria | 853 |
| 244 | Ga0105248_11686089 | 3300009177 | Bacteria | 718 |
| 245 | Ga0105237_10910577 | 3300009545 | Bacteria | 886 |
| 246 | Ga0105238_10380034 | 3300009551 | Bacteria | 1404 |
| 247 | Ga0105238_10425409 | 3300009551 | Bacteria | 1323 |
| 248 | Ga0105249_10029308 | 3300009553 | Bacteria | 4970 |
| 249 | Ga0105249_10048014 | 3300009553 | Bacteria | 3892 |
| 250 | Ga0105249_10087076 | 3300009553 | Bacteria | 2914 |
| 251 | Ga0105249_10533196 | 3300009553 | Bacteria | 1223 |
| 252 | Ga0105249_11053954 | 3300009553 | Bacteria | 883 |
| 253 | Ga0105239_12035610 | 3300010375 | Bacteria | 667 |
| 254 | Ga0157327_1080636 | 3300012512 | Bacteria | 523 |
| 255 | Ga0157326_1038424 | 3300012513 | Bacteria | 662 |
| 256 | Ga0157371_10740009 | 3300013102 | Bacteria | 738 |
| 257 | Ga0157370_10165329 | 3300013104 | Bacteria | 2058 |
| 258 | Ga0157369_10752850 | 3300013105 | Bacteria | 1002 |
| 259 | Ga0157369_11157387 | 3300013105 | Bacteria | 790 |
| 260 | Ga0157369_11468877 | 3300013105 | Bacteria | 694 |
| 261 | Ga0157374_10359752 | 3300013296 | Bacteria | 1447 |
| 262 | Ga0157374_10372251 | 3300013296 | Bacteria | 1422 |
| 263 | Ga0163162_10004424 | 3300013306 | Bacteria | 13529 |
| 264 | Ga0163162_10116464 | 3300013306 | Bacteria | 2773 |
| 265 | Ga0163162_10177994 | 3300013306 | Bacteria | 2252 |
| 266 | Ga0163162_10291800 | 3300013306 | Bacteria | 1763 |
| 267 | Ga0157372_10433592 | 3300013307 | Bacteria | 1532 |
| 268 | Ga0157375_10006387 | 3300013308 | Bacteria | 10274 |
| 269 | Ga0157375_10059937 | 3300013308 | Bacteria | 3772 |
| 270 | Ga0157375_10138513 | 3300013308 | Bacteria | 2559 |
| 271 | Ga0157375_10451488 | 3300013308 | Bacteria | 1451 |
| 272 | Ga0163163_10000532 | 3300014325 | Bacteria | 33942 |
| 273 | Ga0163163_10010179 | 3300014325 | Bacteria | 8441 |
| 274 | Ga0163163_10685778 | 3300014325 | Bacteria | 1088 |
| 275 | Ga0163163_11529212 | 3300014325 | Bacteria | 729 |
| 276 | Ga0163163_12956102 | 3300014325 | Bacteria | 530 |
| 277 | Ga0157380_10012973 | 3300014326 | Bacteria | 6057 |
| 278 | Ga0157380_10130474 | 3300014326 | Bacteria | 2143 |
| 279 | Ga0157380_11473815 | 3300014326 | Bacteria | 733 |
| 280 | Ga0157380_12989077 | 3300014326 | Bacteria | 539 |
| 281 | Ga0157377_10031570 | 3300014745 | Bacteria | 2879 |
| 282 | Ga0157377_10348261 | 3300014745 | Bacteria | 993 |
| 283 | Ga0157379_10004462 | 3300014968 | Bacteria | 12005 |
| 284 | Ga0157379_10024218 | 3300014968 | Bacteria | 5388 |
| 285 | Ga0157379_10043320 | 3300014968 | Bacteria | 4018 |
| 286 | Ga0157379_10060086 | 3300014968 | Bacteria | 3398 |
| 287 | Ga0157376_10433621 | 3300014969 | Bacteria | 1278 |
| 288 | Ga0157376_10868048 | 3300014969 | Bacteria | 919 |
| 289 | Ga0157376_10985308 | 3300014969 | Bacteria | 865 |
| 290 | Ga0157376_11077411 | 3300014969 | Bacteria | 829 |
| 291 | Ga0163161_10031951 | 3300017792 | Bacteria | 3755 |
| 292 | Ga0163161_10213343 | 3300017792 | Bacteria | 1492 |
| 293 | Ga0163161_10451125 | 3300017792 | Bacteria | 1040 |
| 294 | Ga0163161_10480496 | 3300017792 | Bacteria | 1009 |
| 295 | Ga0209674_111433 | 3300025226 | Bacteria | 905 |
| 296 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 297 | Ga0207697_10049074 | 3300025315 | Bacteria | 1742 |
| 298 | Ga0207697_10229534 | 3300025315 | Bacteria | 820 |
| 299 | Ga0207697_10537176 | 3300025315 | Bacteria | 515 |
| 300 | Ga0207656_10042257 | 3300025321 | Bacteria | 1939 |
| 301 | Ga0207656_10053522 | 3300025321 | Bacteria | 1752 |
| 302 | Ga0207656_10096025 | 3300025321 | Bacteria | 1352 |
| 303 | Ga0207656_10249475 | 3300025321 | Bacteria | 869 |
| 304 | Ga0207682_10007636 | 3300025893 | Bacteria | 4304 |
| 305 | Ga0207682_10043178 | 3300025893 | Bacteria | 1844 |
| 306 | Ga0207682_10054709 | 3300025893 | Bacteria | 1659 |
| 307 | Ga0207682_10109308 | 3300025893 | Bacteria | 1216 |
| 308 | Ga0207682_10117515 | 3300025893 | Bacteria | 1176 |
| 309 | Ga0207642_10002689 | 3300025899 | Bacteria | 5544 |
| 310 | Ga0207642_10064618 | 3300025899 | Bacteria | 1716 |
| 311 | Ga0207688_10031184 | 3300025901 | Bacteria | 2942 |
| 312 | Ga0207680_10028222 | 3300025903 | Bacteria | 3136 |
| 313 | Ga0207680_10093891 | 3300025903 | Bacteria | 1915 |
| 314 | Ga0207685_10080552 | 3300025905 | Bacteria | 1346 |
| 315 | Ga0207645_10031798 | 3300025907 | Bacteria | 3393 |
| 316 | Ga0207645_10050248 | 3300025907 | Bacteria | 2662 |
| 317 | Ga0207643_10084941 | 3300025908 | Bacteria | 1838 |
| 318 | Ga0207705_10107497 | 3300025909 | Bacteria | 2058 |
| 319 | Ga0207684_10120209 | 3300025910 | Bacteria | 2252 |
| 320 | Ga0207662_10007292 | 3300025918 | Bacteria | 6011 |
| 321 | Ga0207657_10381695 | 3300025919 | Bacteria | 1109 |
| 322 | Ga0207681_10052619 | 3300025923 | Bacteria | 2761 |
| 323 | Ga0207681_10110128 | 3300025923 | Bacteria | 2001 |
| 324 | Ga0207650_10018537 | 3300025925 | Bacteria | 4885 |
| 325 | Ga0207650_10048417 | 3300025925 | Bacteria | 3135 |
| 326 | Ga0207650_10102743 | 3300025925 | Bacteria | 2203 |
| 327 | Ga0207650_10395047 | 3300025925 | Bacteria | 1144 |
| 328 | Ga0207650_10734134 | 3300025925 | Bacteria | 835 |
| 329 | Ga0207659_10000313 | 3300025926 | Bacteria | 29491 |
| 330 | Ga0207659_10050735 | 3300025926 | Bacteria | 2948 |
| 331 | Ga0207644_10000517 | 3300025931 | Bacteria | 24952 |
| 332 | Ga0207644_10005549 | 3300025931 | Bacteria | 8209 |
| 333 | Ga0207644_10072230 | 3300025931 | Bacteria | 2527 |
| 334 | Ga0207644_10288833 | 3300025931 | Bacteria | 1318 |
| 335 | Ga0207644_10312811 | 3300025931 | Bacteria | 1268 |
| 336 | Ga0207644_10597305 | 3300025931 | Bacteria | 916 |
| 337 | Ga0207690_10321926 | 3300025932 | Bacteria | 1216 |
| 338 | Ga0207706_10015438 | 3300025933 | Bacteria | 6899 |
| 339 | Ga0207706_10085101 | 3300025933 | Bacteria | 2780 |
| 340 | Ga0207706_10608999 | 3300025933 | Bacteria | 938 |
| 341 | Ga0207706_10812396 | 3300025933 | Bacteria | 794 |
| 342 | Ga0207686_11009943 | 3300025934 | Bacteria | 675 |
| 343 | Ga0207686_11051381 | 3300025934 | Bacteria | 662 |
| 344 | Ga0207686_11083159 | 3300025934 | Bacteria | 653 |
| 345 | Ga0207709_10032906 | 3300025935 | Bacteria | 3040 |
| 346 | Ga0207709_10041491 | 3300025935 | Bacteria | 2761 |
| 347 | Ga0207709_10562207 | 3300025935 | Bacteria | 898 |
| 348 | Ga0207670_10005218 | 3300025936 | Bacteria | 7107 |
| 349 | Ga0207669_10169264 | 3300025937 | Bacteria | 1553 |
| 350 | Ga0207669_10314964 | 3300025937 | Bacteria | 1195 |
| 351 | Ga0207669_10433406 | 3300025937 | Bacteria | 1037 |
| 352 | Ga0207669_10636984 | 3300025937 | Bacteria | 870 |
| 353 | Ga0207669_11623041 | 3300025937 | Bacteria | 552 |
| 354 | Ga0207704_10033101 | 3300025938 | Bacteria | 2935 |
| 355 | Ga0207704_10452945 | 3300025938 | Bacteria | 1024 |
| 356 | Ga0207704_10582727 | 3300025938 | Bacteria | 913 |
| 357 | Ga0207665_10130042 | 3300025939 | Bacteria | 1786 |
| 358 | Ga0207665_11244255 | 3300025939 | Bacteria | 594 |
| 359 | Ga0207691_10022088 | 3300025940 | Bacteria | 6004 |
| 360 | Ga0207691_10033898 | 3300025940 | Bacteria | 4753 |
| 361 | Ga0207691_10054876 | 3300025940 | Bacteria | 3634 |
| 362 | Ga0207691_10114412 | 3300025940 | Bacteria | 2397 |
| 363 | Ga0207691_10133529 | 3300025940 | Bacteria | 2191 |
| 364 | Ga0207691_10150234 | 3300025940 | Bacteria | 2048 |
| 365 | Ga0207691_10246845 | 3300025940 | Bacteria | 1542 |
| 366 | Ga0207711_10003170 | 3300025941 | Bacteria | 14341 |
| 367 | Ga0207711_10072292 | 3300025941 | Bacteria | 2996 |
| 368 | Ga0207711_10367832 | 3300025941 | Bacteria | 1333 |
| 369 | Ga0207711_10646067 | 3300025941 | Bacteria | 987 |
| 370 | Ga0207689_10013647 | 3300025942 | Bacteria | 6928 |
| 371 | Ga0207689_10021025 | 3300025942 | Bacteria | 5485 |
| 372 | Ga0207689_10602763 | 3300025942 | Bacteria | 924 |
| 373 | Ga0207679_10139117 | 3300025945 | Bacteria | 1960 |
| 374 | Ga0207679_10544922 | 3300025945 | Bacteria | 1040 |
| 375 | Ga0207679_10592968 | 3300025945 | Bacteria | 998 |
| 376 | Ga0207651_10066518 | 3300025960 | Bacteria | 2532 |
| 377 | Ga0207651_10221464 | 3300025960 | Bacteria | 1530 |
| 378 | Ga0207651_10472482 | 3300025960 | Bacteria | 1079 |
| 379 | Ga0207651_10597552 | 3300025960 | Bacteria | 964 |
| 380 | Ga0207651_11206044 | 3300025960 | Bacteria | 679 |
| 381 | Ga0207712_10093088 | 3300025961 | Bacteria | 2223 |
| 382 | Ga0207712_10305486 | 3300025961 | Bacteria | 1307 |
| 383 | Ga0207668_10062324 | 3300025972 | Bacteria | 2625 |
| 384 | Ga0207668_10071084 | 3300025972 | Bacteria | 2484 |
| 385 | Ga0207668_11022764 | 3300025972 | Bacteria | 739 |
| 386 | Ga0207640_10055671 | 3300025981 | Bacteria | 2592 |
| 387 | Ga0207640_11152593 | 3300025981 | Bacteria | 688 |
| 388 | Ga0207658_10000812 | 3300025986 | Bacteria | 26147 |
| 389 | Ga0207658_10004524 | 3300025986 | Bacteria | 9661 |
| 390 | Ga0207658_10049839 | 3300025986 | Bacteria | 3079 |
| 391 | Ga0207677_10004232 | 3300026023 | Bacteria | 7684 |
| 392 | Ga0207677_10068217 | 3300026023 | Bacteria | 2495 |
| 393 | Ga0207677_10911196 | 3300026023 | Bacteria | 793 |
| 394 | Ga0207703_10000929 | 3300026035 | Bacteria | 28489 |
| 395 | Ga0207703_10001541 | 3300026035 | Bacteria | 20913 |
| 396 | Ga0207703_10499031 | 3300026035 | Bacteria | 1142 |
| 397 | Ga0207639_11234313 | 3300026041 | Bacteria | 702 |
| 398 | Ga0207678_10306318 | 3300026067 | Bacteria | 1366 |
| 399 | Ga0207678_10372354 | 3300026067 | Bacteria | 1234 |
| 400 | Ga0207708_10036575 | 3300026075 | Bacteria | 3738 |
| 401 | Ga0207702_10603650 | 3300026078 | Bacteria | 1077 |
| 402 | Ga0207641_10000655 | 3300026088 | Bacteria | 37743 |
| 403 | Ga0207641_10002319 | 3300026088 | Bacteria | 17659 |
| 404 | Ga0207641_10025895 | 3300026088 | Bacteria | 4838 |
| 405 | Ga0207641_10031495 | 3300026088 | Bacteria | 4399 |
| 406 | Ga0207641_10056214 | 3300026088 | Bacteria | 3343 |
| 407 | Ga0207641_12096397 | 3300026088 | Bacteria | 566 |
| 408 | Ga0207648_10006616 | 3300026089 | Bacteria | 11512 |
| 409 | Ga0207648_10152456 | 3300026089 | Bacteria | 2040 |
| 410 | Ga0207648_10360701 | 3300026089 | Bacteria | 1311 |
| 411 | Ga0207648_10504353 | 3300026089 | Bacteria | 1107 |
| 412 | Ga0207676_10002990 | 3300026095 | Bacteria | 12054 |
| 413 | Ga0207676_10019288 | 3300026095 | Bacteria | 4972 |
| 414 | Ga0207676_10027347 | 3300026095 | Bacteria | 4247 |
| 415 | Ga0207676_10171790 | 3300026095 | Bacteria | 1889 |
| 416 | Ga0207676_12420863 | 3300026095 | Bacteria | 522 |
| 417 | Ga0207675_100007375 | 3300026118 | Bacteria | 10394 |
| 418 | Ga0207675_100045418 | 3300026118 | Bacteria | 4104 |
| 419 | Ga0207675_100315865 | 3300026118 | Bacteria | 1524 |
| 420 | Ga0207683_10001877 | 3300026121 | Bacteria | 18588 |
| 421 | Ga0207683_10015629 | 3300026121 | Bacteria | 6461 |
| 422 | Ga0207683_10069474 | 3300026121 | Bacteria | 3111 |
| 423 | Ga0207683_11011194 | 3300026121 | Bacteria | 772 |
| 424 | Ga0207683_11170920 | 3300026121 | Bacteria | 713 |
| 425 | Ga0207683_11309161 | 3300026121 | Bacteria | 671 |
| 426 | Ga0207698_10047674 | 3300026142 | Bacteria | 3248 |
| 427 | Ga0207698_10089408 | 3300026142 | Bacteria | 2515 |
| 428 | Ga0207698_10145002 | 3300026142 | Bacteria | 2052 |
| 429 | Ga0207698_10376817 | 3300026142 | Bacteria | 1349 |
| 430 | Ga0207698_10992679 | 3300026142 | Bacteria | 850 |
| 431 | Ga0207698_11040918 | 3300026142 | Bacteria | 830 |
| 432 | Ga0207698_11209556 | 3300026142 | Bacteria | 770 |
| 433 | Ga0207698_11306513 | 3300026142 | Bacteria | 740 |
| 434 | Ga0207698_11503044 | 3300026142 | Bacteria | 689 |
| 435 | Ga0207698_11635731 | 3300026142 | Bacteria | 659 |
| 436 | Ga0207428_10551450 | 3300027907 | Bacteria | 834 |
| 437 | Ga0268266_11334451 | 3300028379 | Bacteria | 693 |
| 438 | Ga0268265_10031887 | 3300028380 | Bacteria | 3810 |
| 439 | Ga0268265_10412897 | 3300028380 | Bacteria | 1251 |
| 440 | Ga0268265_11064548 | 3300028380 | Bacteria | 801 |
| 441 | Ga0268264_10037391 | 3300028381 | Bacteria | 4003 |
| 442 | Ga0268264_10120333 | 3300028381 | Bacteria | 2313 |
| 443 | Ga0268264_10456759 | 3300028381 | Bacteria | 1239 |
| 444 | Ga0307515_10001727 | 3300028794 | Bacteria | 48647 |
| 445 | Ga0307515_10048310 | 3300028794 | Bacteria | 6437 |
| 446 | Ga0307515_10109047 | 3300028794 | Bacteria | 3256 |
| 447 | Ga0307515_10202732 | 3300028794 | Bacteria | 1854 |
| 448 | Ga0265328_10086600 | 3300031239 | Bacteria | 1156 |
| 449 | Ga0265331_10014048 | 3300031250 | Bacteria | 4278 |
| 450 | Ga0265327_10000083 | 3300031251 | Bacteria | 204923 |
| 451 | Ga0307513_10080456 | 3300031456 | Bacteria | 3361 |
| 452 | Ga0307509_10064051 | 3300031507 | Bacteria | 3869 |
| 453 | Ga0307509_10308473 | 3300031507 | Bacteria | 1326 |
| 454 | Ga0307408_100000038 | 3300031548 | Bacteria | 183170 |
| 455 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 456 | Ga0307514_10592980 | 3300031649 | Bacteria | 500 |
| 457 | Ga0307405_10941600 | 3300031731 | Bacteria | 733 |
| 458 | Ga0307406_11272098 | 3300031901 | Bacteria | 641 |
| 459 | Ga0307409_101502760 | 3300031995 | Bacteria | 701 |
| 460 | Ga0307414_10083480 | 3300032004 | Bacteria | 2346 |
| 461 | Ga0307411_10000214 | 3300032005 | Bacteria | 18630 |
| 462 | Ga0307507_10063800 | 3300033179 | Bacteria | 3406 |
| 463 | Ga0373954_0042286 | 3300035118 | Bacteria | 2125 |
| 464 | Ga0373956_0288236 | 3300035119 | Bacteria | 782 |
| 465 | Ga0373943_0102141 | 3300035170 | Bacteria | 1501 |
| 466 | Ga0373946_0083441 | 3300035171 | Bacteria | 1403 |
| 467 | Ga0373935_0066476 | 3300035692 | Bacteria | 2316 |
| 468 | Ga0373935_1371624 | 3300035692 | Bacteria | 528 |
| 469 | Ga0373933_0292354 | 3300035724 | Bacteria | 1054 |
| 470 | Ga0373947_0064625 | 3300035725 | Bacteria | 2231 |
| 471 | Ga0373947_0181270 | 3300035725 | Bacteria | 1371 |
| 472 | Ga0373937_0209133 | 3300036401 | Bacteria | 1835 |
| 473 | Ga0373937_1254679 | 3300036401 | Bacteria | 689 |
| 474 | Ga0373925_0014054 | 3300037068 | Bacteria | 5795 |
| 475 | Ga0373925_0157549 | 3300037068 | Bacteria | 1787 |
| 476 | Ga0373925_0423399 | 3300037068 | Bacteria | 1088 |
| 477 | Ga0395905_0009740 | 3300037471 | Bacteria | 9373 |
| 478 | Ga0436364_1404502 | 3300037853 | Bacteria | 746 |
| 479 | Ga0451787_389700 | 3300041441 | Bacteria | 793 |
| 480 | Ga0451789_0880985 | 3300041443 | Bacteria | 558 |
| 481 | Ga0451793_1059538 | 3300041452 | Bacteria | 939 |
| 482 | Ga0451807_0710180 | 3300041486 | Bacteria | 769 |
| 483 | Ga0451855_0667034 | 3300041511 | Bacteria | 682 |
| 484 | Ga0451853_3133088 | 3300041512 | Bacteria | 529 |
| 485 | Ga0451853_3248874 | 3300041512 | Bacteria | 1345 |
| 486 | Ga0439437_001347 | 3300042000 | Bacteria | 2585 |
| 487 | Ga0450911_030681 | 3300042115 | Bacteria | 697 |
| 488 | Ga0450917_006046 | 3300042120 | Bacteria | 907 |
| 489 | Ga0450888_004032 | 3300042126 | Bacteria | 1516 |
| 490 | Ga0450890_001516 | 3300042127 | Bacteria | 3337 |
| 491 | Ga0450891_001423 | 3300042129 | Bacteria | 2477 |
| 492 | Ga0450898_002950 | 3300042134 | Bacteria | 2402 |
| 493 | Ga0450899_004088 | 3300042135 | Bacteria | 1562 |
| 494 | Ga0450889_000335 | 3300042144 | Bacteria | 5261 |
| 495 | Ga0439464_0298218 | 3300042439 | Bacteria | 526 |
| 496 | Ga0450893_0004301 | 3300042532 | Bacteria | 2268 |
| 497 | Ga0453684_0000457 | 3300044712 | Bacteria | 163653 |
| 498 | Ga0453684_0369757 | 3300044712 | Bacteria | 1612 |
| 499 | Ga0451576_0041466 | 3300045051 | Bacteria | 4866 |
| 500 | Ga0451576_0162344 | 3300045051 | Bacteria | 2332 |
| 501 | Ga0451576_0538876 | 3300045051 | Bacteria | 1226 |
| 502 | Ga0495603_0119726 | 3300046455 | Bacteria | 1535 |
| 503 | Ga0495629_0073241 | 3300046459 | Bacteria | 2392 |
| 504 | Ga0495610_0137328 | 3300046512 | Bacteria | 1055 |
| 505 | Ga0495632_0135578 | 3300046519 | Bacteria | 1144 |
| 506 | Ga0495652_0496674 | 3300046529 | Bacteria | 847 |
| 507 | Ga0495654_0192099 | 3300046530 | Bacteria | 879 |
| 508 | Ga0495640_0285497 | 3300046533 | Bacteria | 1027 |
| 509 | Ga0495586_0642876 | 3300046535 | Bacteria | 613 |
| 510 | Ga0495598_0012869 | 3300046537 | Bacteria | 2064 |
| 511 | Ga0495598_0065563 | 3300046537 | Bacteria | 1131 |
| 512 | Ga0495621_0070645 | 3300046539 | Bacteria | 1285 |
| 513 | Ga0495597_0406942 | 3300046542 | Bacteria | 517 |
| 514 | Ga0495645_0269720 | 3300046543 | Bacteria | 1123 |
| 515 | Ga0495635_0380548 | 3300046663 | Bacteria | 939 |
| 516 | Ga0495657_0415908 | 3300046675 | Bacteria | 790 |
| 517 | Ga0495647_0101331 | 3300046681 | Bacteria | 1193 |
| 518 | Ga0495647_0357977 | 3300046681 | Bacteria | 665 |
| 519 | Ga0495658_0009768 | 3300046683 | Bacteria | 4784 |
| 520 | Ga0495658_0201011 | 3300046683 | Bacteria | 1242 |
| 521 | Ga0495658_0800538 | 3300046683 | Bacteria | 603 |
| 522 | Ga0495670_0140677 | 3300046691 | Bacteria | 1262 |
| 523 | Ga0495604_0271411 | 3300047317 | Bacteria | 1149 |
| 524 | Ga0495674_0448332 | 3300047319 | Bacteria | 1037 |
| 525 | Ga0495680_0104749 | 3300047322 | Bacteria | 2104 |
| 526 | Ga0495684_0121875 | 3300047471 | Bacteria | 1963 |
| 527 | Ga0495684_0201239 | 3300047471 | Bacteria | 1468 |
| 528 | Ga0495614_0317897 | 3300048089 | Bacteria | 722 |
| 529 | Ga0496100_0068446 | 3300048903 | Bacteria | 2361 |
| 530 | Ga0496100_0850821 | 3300048903 | Bacteria | 715 |
| 531 | Ga0496101_0899322 | 3300048904 | Bacteria | 697 |
| 532 | Ga0496102_0015200 | 3300048905 | Bacteria | 6700 |
| 533 | Ga0496104_0335229 | 3300048907 | Bacteria | 1425 |
| 534 | Ga0496104_0827018 | 3300048907 | Bacteria | 832 |
| 535 | Ga0496104_1355760 | 3300048907 | Bacteria | 614 |
| 536 | Ga0496105_0013657 | 3300048908 | Bacteria | 6448 |
| 537 | Ga0496106_0023114 | 3300048909 | Bacteria | 4618 |
| 538 | Ga0496106_0618865 | 3300048909 | Bacteria | 867 |
| 539 | Ga0496108_0059595 | 3300048911 | Bacteria | 3210 |
| 540 | Ga0496109_0153025 | 3300048912 | Bacteria | 2160 |
| 541 | Ga0496110_0480413 | 3300048913 | Bacteria | 1132 |
| 542 | Ga0496110_0630431 | 3300048913 | Bacteria | 971 |
| 543 | Ga0496110_1672943 | 3300048913 | Bacteria | 546 |
| 544 | Ga0496111_0519474 | 3300048914 | Bacteria | 876 |
| 545 | Ga0496113_0189643 | 3300048916 | Bacteria | 1632 |
| 546 | Ga0496114_0076201 | 3300048917 | Bacteria | 2826 |
| 547 | Ga0496114_0405377 | 3300048917 | Bacteria | 1207 |
| 548 | Ga0496114_0745451 | 3300048917 | Bacteria | 856 |
| 549 | Ga0496115_0559583 | 3300048918 | Bacteria | 913 |
| 550 | Ga0496124_0099099 | 3300048927 | Bacteria | 2364 |
| 551 | Ga0501291_088598 | 3300049514 | Bacteria | 628 |
| 552 | Ga0501300_001957 | 3300049523 | Bacteria | 3084 |
| 553 | Ga0501222_005305 | 3300049662 | Bacteria | 1742 |
| 554 | Ga0501227_014844 | 3300049665 | Bacteria | 1735 |
| 555 | Ga0501233_022443 | 3300049668 | Bacteria | 1363 |
| 556 | Ga0501235_001655 | 3300049669 | Bacteria | 4775 |
| 557 | Ga0501239_011591 | 3300049672 | Bacteria | 987 |
| 558 | Ga0501249_003607 | 3300049679 | Bacteria | 3116 |
| 559 | Ga0501258_005143 | 3300049687 | Bacteria | 1261 |
| 560 | Ga0501225_0025179 | 3300049705 | Bacteria | 1638 |
| 561 | Ga0501229_011018 | 3300049706 | Bacteria | 1144 |
| 562 | Ga0501229_030280 | 3300049706 | Bacteria | 740 |
| 563 | Ga0501232_038265 | 3300049757 | Bacteria | 697 |
| 564 | Ga0501262_004944 | 3300049759 | Bacteria | 1562 |
| 565 | Ga0501265_001805 | 3300049762 | Bacteria | 2431 |
| 566 | Ga0501266_021295 | 3300049763 | Bacteria | 886 |
| 567 | Ga0501267_000352 | 3300049764 | Bacteria | 3446 |
| 568 | Ga0501269_008000 | 3300049766 | Bacteria | 1278 |
| 569 | Ga0501271_011340 | 3300049768 | Bacteria | 952 |
| 570 | nmdc:mga03n38_42821_c1 | 3300050490 | Bacteria | 1981 |
| 571 | nmdc:mga0k408_134788_c1 | 3300050493 | Bacteria | 1467 |
| 572 | nmdc:mga0k408_145750_c1 | 3300050493 | Bacteria | 1410 |
| 573 | nmdc:mga0k408_187724_c1 | 3300050493 | Bacteria | 1233 |
| 574 | nmdc:mga0k408_29930_c1 | 3300050493 | Bacteria | 3102 |
| 575 | nmdc:mga0k408_5050_c1 | 3300050493 | Bacteria | 6988 |
| 576 | nmdc:mga0k408_77120_c1 | 3300050493 | Bacteria | 1949 |
| 577 | nmdc:mga07m45_52252_c1 | 3300050496 | Bacteria | 2307 |
| 578 | nmdc:mga08y16_495743_c1 | 3300050511 | Bacteria | 1241 |
| 579 | Ga0495601_0015412 | 3300053077 | Bacteria | 4620 |
| 580 | Ga0495601_0212289 | 3300053077 | Bacteria | 1264 |
| 581 | Ga0495595_0117964 | 3300053084 | Bacteria | 1291 |
| 582 | Ga0495595_0192342 | 3300053084 | Bacteria | 1014 |
| 583 | Ga0495619_0084993 | 3300053085 | Bacteria | 2136 |
| 584 | Ga0495619_0763871 | 3300053085 | Bacteria | 655 |
| 585 | Ga0500593_067582 | 3300053117 | Bacteria | 1557 |
| 586 | Ga0500597_140729 | 3300053120 | Bacteria | 1040 |
| 587 | Ga0500559_0544655 | 3300053136 | Bacteria | 530 |
| 588 | Ga0500590_003574 | 3300053148 | Bacteria | 7197 |
| 589 | Ga0500620_178222 | 3300053155 | Bacteria | 733 |
| 590 | Ga0500587_002259 | 3300053739 | Bacteria | 2746 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037068 | Ga0373925_0423399 | Ga0373925_0423399_481_1005 | 112 |
| 2 | 3300047317 | Ga0495604_0271411 | Ga0495604_0271411_38_559 | 112 |
| 3 | 3300005547 | Ga0070693_100957826 | Ga0070693_1009578261 | 114 |
| 4 | 3300044712 | Ga0453684_0369757 | Ga0453684_0369757_1048_1404 | 115 |
| 5 | 3300045051 | Ga0451576_0162344 | Ga0451576_0162344_417_773 | 115 |
| 6 | 3300005842 | Ga0068858_100425474 | Ga0068858_1004254741 | 116 |
| 7 | 3300005843 | Ga0068860_100143651 | Ga0068860_1001436512 | 116 |
| 8 | 3300005844 | Ga0068862_100007774 | Ga0068862_1000077749 | 116 |
| 9 | 3300006177 | Ga0075362_10547334 | Ga0075362_105473341 | 116 |
| 10 | 3300006178 | Ga0075367_10010079 | Ga0075367_100100793 | 116 |
| 11 | 3300006195 | Ga0075366_10060820 | Ga0075366_100608203 | 116 |
| 12 | 3300009177 | Ga0105248_11118411 | Ga0105248_111184112 | 116 |
| 13 | 3300009553 | Ga0105249_10533196 | Ga0105249_105331963 | 116 |
| 14 | 3300014325 | Ga0163163_10000532 | Ga0163163_100005327 | 116 |
| 15 | 3300014326 | Ga0157380_11473815 | Ga0157380_114738152 | 116 |
| 16 | 3300025986 | Ga0207658_10049839 | Ga0207658_100498392 | 116 |
| 17 | 3300026035 | Ga0207703_10499031 | Ga0207703_104990312 | 116 |
| 18 | 3300026088 | Ga0207641_10025895 | Ga0207641_100258954 | 116 |
| 19 | 3300026142 | Ga0207698_10376817 | Ga0207698_103768172 | 116 |
| 20 | 3300028381 | Ga0268264_10456759 | Ga0268264_104567592 | 116 |
| 21 | 3300028794 | Ga0307515_10001727 | Ga0307515_1000172718 | 116 |
| 22 | 3300031507 | Ga0307509_10064051 | Ga0307509_100640514 | 116 |
| 23 | 3300031616 | Ga0307508_10000007 | Ga0307508_10000007185 | 116 |
| 24 | 3300031649 | Ga0307514_10592980 | Ga0307514_105929801 | 116 |
| 25 | 3300031731 | Ga0307405_10941600 | Ga0307405_109416002 | 116 |
| 26 | 3300031901 | Ga0307406_11272098 | Ga0307406_112720982 | 116 |
| 27 | 3300031995 | Ga0307409_101502760 | Ga0307409_1015027601 | 116 |
| 28 | 3300033179 | Ga0307507_10063800 | Ga0307507_100638004 | 116 |
| 29 | 3300035692 | Ga0373935_1371624 | Ga0373935_1371624_117_503 | 116 |
| 30 | 3300037471 | Ga0395905_0009740 | Ga0395905_0009740_4152_4511 | 116 |
| 31 | 3300042134 | Ga0450898_002950 | Ga0450898_002950_997_1356 | 116 |
| 32 | 3300042135 | Ga0450899_004088 | Ga0450899_004088_752_1111 | 116 |
| 33 | 3300042439 | Ga0439464_0298218 | Ga0439464_0298218_60_419 | 116 |
| 34 | 3300044712 | Ga0453684_0000457 | Ga0453684_0000457_101348_101713 | 116 |
| 35 | 3300048903 | Ga0496100_0068446 | Ga0496100_0068446_1311_1697 | 116 |
| 36 | 3300048909 | Ga0496106_0023114 | Ga0496106_0023114_3426_3812 | 116 |
| 37 | 3300050493 | nmdc:mga0k408_29930_c1 | nmdc:mga0k408_29930_c1_2329_2688 | 116 |
| 38 | 3300002773 | JGI25152J39213_1001665 | JGI25152J39213_10016652 | 117 |
| 39 | 3300002774 | JGI25150J39212_1026233 | JGI25150J39212_10262332 | 117 |
| 40 | 3300003215 | JGI25153J46596_10007026 | JGI25153J46596_100070263 | 117 |
| 41 | 3300003322 | rootL2_10071287 | rootL2_100712873 | 117 |
| 42 | 3300003771 | Ga0055526_1006007 | Ga0055526_10060079 | 117 |
| 43 | 3300003771 | Ga0055526_1010196 | Ga0055526_10101961 | 117 |
| 44 | 3300003790 | Ga0055528_1073289 | Ga0055528_10732892 | 117 |
| 45 | 3300004625 | Ga0055543_1003721 | Ga0055543_10037212 | 117 |
| 46 | 3300005262 | Ga0065165_1000151 | Ga0065165_100015172 | 117 |
| 47 | 3300005262 | Ga0065165_1000166 | Ga0065165_10001667 | 117 |
| 48 | 3300005262 | Ga0065165_1003633 | Ga0065165_10036333 | 117 |
| 49 | 3300005327 | Ga0070658_10452234 | Ga0070658_104522341 | 117 |
| 50 | 3300005327 | Ga0070658_10494048 | Ga0070658_104940482 | 117 |
| 51 | 3300005328 | Ga0070676_10241457 | Ga0070676_102414572 | 117 |
| 52 | 3300005328 | Ga0070676_10471206 | Ga0070676_104712061 | 117 |
| 53 | 3300005331 | Ga0070670_100020576 | Ga0070670_1000205764 | 117 |
| 54 | 3300005331 | Ga0070670_100087630 | Ga0070670_1000876302 | 117 |
| 55 | 3300005331 | Ga0070670_100163454 | Ga0070670_1001634542 | 117 |
| 56 | 3300005331 | Ga0070670_100492426 | Ga0070670_1004924262 | 117 |
| 57 | 3300005333 | Ga0070677_10007318 | Ga0070677_100073186 | 117 |
| 58 | 3300005333 | Ga0070677_10036866 | Ga0070677_100368662 | 117 |
| 59 | 3300005333 | Ga0070677_10171988 | Ga0070677_101719881 | 117 |
| 60 | 3300005334 | Ga0068869_100008578 | Ga0068869_1000085789 | 117 |
| 61 | 3300005334 | Ga0068869_100009021 | Ga0068869_1000090219 | 117 |
| 62 | 3300005334 | Ga0068869_100489138 | Ga0068869_1004891381 | 117 |
| 63 | 3300005335 | Ga0070666_10008568 | Ga0070666_100085682 | 117 |
| 64 | 3300005335 | Ga0070666_10042193 | Ga0070666_100421932 | 117 |
| 65 | 3300005335 | Ga0070666_10549998 | Ga0070666_105499982 | 117 |
| 66 | 3300005335 | Ga0070666_11313381 | Ga0070666_113133811 | 117 |
| 67 | 3300005338 | Ga0068868_100016008 | Ga0068868_1000160086 | 117 |
| 68 | 3300005338 | Ga0068868_100088171 | Ga0068868_1000881712 | 117 |
| 69 | 3300005338 | Ga0068868_100329161 | Ga0068868_1003291612 | 117 |
| 70 | 3300005338 | Ga0068868_100573405 | Ga0068868_1005734052 | 117 |
| 71 | 3300005338 | Ga0068868_101182042 | Ga0068868_1011820422 | 117 |
| 72 | 3300005339 | Ga0070660_100323247 | Ga0070660_1003232473 | 117 |
| 73 | 3300005340 | Ga0070689_100005848 | Ga0070689_1000058488 | 117 |
| 74 | 3300005340 | Ga0070689_100117669 | Ga0070689_1001176693 | 117 |
| 75 | 3300005343 | Ga0070687_100027854 | Ga0070687_1000278542 | 117 |
| 76 | 3300005343 | Ga0070687_100045233 | Ga0070687_1000452332 | 117 |
| 77 | 3300005344 | Ga0070661_100061882 | Ga0070661_1000618823 | 117 |
| 78 | 3300005344 | Ga0070661_100074410 | Ga0070661_1000744104 | 117 |
| 79 | 3300005344 | Ga0070661_100201255 | Ga0070661_1002012552 | 117 |
| 80 | 3300005344 | Ga0070661_101195980 | Ga0070661_1011959802 | 117 |
| 81 | 3300005347 | Ga0070668_100007130 | Ga0070668_1000071309 | 117 |
| 82 | 3300005347 | Ga0070668_100556649 | Ga0070668_1005566492 | 117 |
| 83 | 3300005353 | Ga0070669_100001340 | Ga0070669_10000134013 | 117 |
| 84 | 3300005353 | Ga0070669_100298297 | Ga0070669_1002982971 | 117 |
| 85 | 3300005354 | Ga0070675_100014979 | Ga0070675_1000149796 | 117 |
| 86 | 3300005354 | Ga0070675_100024515 | Ga0070675_1000245153 | 117 |
| 87 | 3300005354 | Ga0070675_100079931 | Ga0070675_1000799313 | 117 |
| 88 | 3300005354 | Ga0070675_100116471 | Ga0070675_1001164713 | 117 |
| 89 | 3300005354 | Ga0070675_100176442 | Ga0070675_1001764422 | 117 |
| 90 | 3300005355 | Ga0070671_100009693 | Ga0070671_1000096933 | 117 |
| 91 | 3300005355 | Ga0070671_100066889 | Ga0070671_1000668894 | 117 |
| 92 | 3300005355 | Ga0070671_100099617 | Ga0070671_1000996174 | 117 |
| 93 | 3300005355 | Ga0070671_100313041 | Ga0070671_1003130412 | 117 |
| 94 | 3300005355 | Ga0070671_100406523 | Ga0070671_1004065232 | 117 |
| 95 | 3300005355 | Ga0070671_100711509 | Ga0070671_1007115091 | 117 |
| 96 | 3300005356 | Ga0070674_100013491 | Ga0070674_1000134912 | 117 |
| 97 | 3300005356 | Ga0070674_100134822 | Ga0070674_1001348222 | 117 |
| 98 | 3300005356 | Ga0070674_100272725 | Ga0070674_1002727252 | 117 |
| 99 | 3300005356 | Ga0070674_100448932 | Ga0070674_1004489322 | 117 |
| 100 | 3300005356 | Ga0070674_101137331 | Ga0070674_1011373311 | 117 |
| 101 | 3300005364 | Ga0070673_100000512 | Ga0070673_10000051216 | 117 |
| 102 | 3300005364 | Ga0070673_100007311 | Ga0070673_1000073114 | 117 |
| 103 | 3300005364 | Ga0070673_100026611 | Ga0070673_1000266114 | 117 |
| 104 | 3300005364 | Ga0070673_100113770 | Ga0070673_1001137703 | 117 |
| 105 | 3300005364 | Ga0070673_100115213 | Ga0070673_1001152133 | 117 |
| 106 | 3300005364 | Ga0070673_100586547 | Ga0070673_1005865472 | 117 |
| 107 | 3300005364 | Ga0070673_100848584 | Ga0070673_1008485841 | 117 |
| 108 | 3300005365 | Ga0070688_100024768 | Ga0070688_1000247682 | 117 |
| 109 | 3300005365 | Ga0070688_101045358 | Ga0070688_1010453581 | 117 |
| 110 | 3300005366 | Ga0070659_100352647 | Ga0070659_1003526472 | 117 |
| 111 | 3300005367 | Ga0070667_100001703 | Ga0070667_1000017038 | 117 |
| 112 | 3300005367 | Ga0070667_100004388 | Ga0070667_1000043883 | 117 |
| 113 | 3300005367 | Ga0070667_100006263 | Ga0070667_10000626312 | 117 |
| 114 | 3300005367 | Ga0070667_100321402 | Ga0070667_1003214022 | 117 |
| 115 | 3300005367 | Ga0070667_100456592 | Ga0070667_1004565922 | 117 |
| 116 | 3300005438 | Ga0070701_10093410 | Ga0070701_100934103 | 117 |
| 117 | 3300005438 | Ga0070701_10367515 | Ga0070701_103675152 | 117 |
| 118 | 3300005445 | Ga0070708_101509850 | Ga0070708_1015098502 | 117 |
| 119 | 3300005455 | Ga0070663_101094223 | Ga0070663_1010942232 | 117 |
| 120 | 3300005456 | Ga0070678_100004036 | Ga0070678_1000040364 | 117 |
| 121 | 3300005456 | Ga0070678_100010301 | Ga0070678_1000103015 | 117 |
| 122 | 3300005456 | Ga0070678_100197655 | Ga0070678_1001976552 | 117 |
| 123 | 3300005456 | Ga0070678_100494027 | Ga0070678_1004940272 | 117 |
| 124 | 3300005456 | Ga0070678_100684634 | Ga0070678_1006846342 | 117 |
| 125 | 3300005456 | Ga0070678_100719893 | Ga0070678_1007198932 | 117 |
| 126 | 3300005456 | Ga0070678_100900932 | Ga0070678_1009009322 | 117 |
| 127 | 3300005457 | Ga0070662_100008433 | Ga0070662_1000084339 | 117 |
| 128 | 3300005457 | Ga0070662_100134873 | Ga0070662_1001348733 | 117 |
| 129 | 3300005457 | Ga0070662_100411919 | Ga0070662_1004119192 | 117 |
| 130 | 3300005457 | Ga0070662_101233076 | Ga0070662_1012330762 | 117 |
| 131 | 3300005457 | Ga0070662_101672335 | Ga0070662_1016723351 | 117 |
| 132 | 3300005459 | Ga0068867_100011339 | Ga0068867_1000113399 | 117 |
| 133 | 3300005459 | Ga0068867_100015106 | Ga0068867_1000151063 | 117 |
| 134 | 3300005459 | Ga0068867_100792975 | Ga0068867_1007929751 | 117 |
| 135 | 3300005459 | Ga0068867_101724872 | Ga0068867_1017248721 | 117 |
| 136 | 3300005466 | Ga0070685_10191425 | Ga0070685_101914251 | 117 |
| 137 | 3300005466 | Ga0070685_10828728 | Ga0070685_108287282 | 117 |
| 138 | 3300005467 | Ga0070706_100073795 | Ga0070706_1000737953 | 117 |
| 139 | 3300005535 | Ga0070684_101042671 | Ga0070684_1010426711 | 117 |
| 140 | 3300005539 | Ga0068853_101496454 | Ga0068853_1014964542 | 117 |
| 141 | 3300005543 | Ga0070672_100002366 | Ga0070672_1000023666 | 117 |
| 142 | 3300005543 | Ga0070672_100056785 | Ga0070672_1000567852 | 117 |
| 143 | 3300005543 | Ga0070672_100119912 | Ga0070672_1001199121 | 117 |
| 144 | 3300005543 | Ga0070672_100187342 | Ga0070672_1001873423 | 117 |
| 145 | 3300005543 | Ga0070672_100264018 | Ga0070672_1002640182 | 117 |
| 146 | 3300005543 | Ga0070672_100750413 | Ga0070672_1007504132 | 117 |
| 147 | 3300005544 | Ga0070686_100038385 | Ga0070686_1000383852 | 117 |
| 148 | 3300005544 | Ga0070686_100114604 | Ga0070686_1001146042 | 117 |
| 149 | 3300005547 | Ga0070693_100229928 | Ga0070693_1002299282 | 117 |
| 150 | 3300005547 | Ga0070693_100738002 | Ga0070693_1007380022 | 117 |
| 151 | 3300005548 | Ga0070665_101470701 | Ga0070665_1014707012 | 117 |
| 152 | 3300005563 | Ga0068855_101531396 | Ga0068855_1015313961 | 117 |
| 153 | 3300005564 | Ga0070664_100102998 | Ga0070664_1001029982 | 117 |
| 154 | 3300005564 | Ga0070664_100592439 | Ga0070664_1005924392 | 117 |
| 155 | 3300005564 | Ga0070664_100928461 | Ga0070664_1009284612 | 117 |
| 156 | 3300005564 | Ga0070664_100998784 | Ga0070664_1009987841 | 117 |
| 157 | 3300005564 | Ga0070664_101665317 | Ga0070664_1016653172 | 117 |
| 158 | 3300005577 | Ga0068857_100124261 | Ga0068857_1001242611 | 117 |
| 159 | 3300005578 | Ga0068854_100014237 | Ga0068854_1000142374 | 117 |
| 160 | 3300005578 | Ga0068854_100411192 | Ga0068854_1004111922 | 117 |
| 161 | 3300005578 | Ga0068854_100648290 | Ga0068854_1006482902 | 117 |
| 162 | 3300005578 | Ga0068854_101999974 | Ga0068854_1019999742 | 117 |
| 163 | 3300005615 | Ga0070702_100402597 | Ga0070702_1004025972 | 117 |
| 164 | 3300005616 | Ga0068852_100009488 | Ga0068852_1000094884 | 117 |
| 165 | 3300005616 | Ga0068852_100064088 | Ga0068852_1000640883 | 117 |
| 166 | 3300005616 | Ga0068852_100269320 | Ga0068852_1002693202 | 117 |
| 167 | 3300005616 | Ga0068852_100394861 | Ga0068852_1003948613 | 117 |
| 168 | 3300005616 | Ga0068852_100684070 | Ga0068852_1006840702 | 117 |
| 169 | 3300005616 | Ga0068852_100935289 | Ga0068852_1009352892 | 117 |
| 170 | 3300005617 | Ga0068859_100032866 | Ga0068859_1000328662 | 117 |
| 171 | 3300005617 | Ga0068859_100790279 | Ga0068859_1007902793 | 117 |
| 172 | 3300005618 | Ga0068864_100009050 | Ga0068864_1000090506 | 117 |
| 173 | 3300005618 | Ga0068864_100015458 | Ga0068864_1000154584 | 117 |
| 174 | 3300005618 | Ga0068864_100016929 | Ga0068864_1000169293 | 117 |
| 175 | 3300005618 | Ga0068864_100055318 | Ga0068864_1000553183 | 117 |
| 176 | 3300005618 | Ga0068864_100401503 | Ga0068864_1004015032 | 117 |
| 177 | 3300005618 | Ga0068864_100945142 | Ga0068864_1009451422 | 117 |
| 178 | 3300005718 | Ga0068866_10004159 | Ga0068866_100041596 | 117 |
| 179 | 3300005718 | Ga0068866_10080870 | Ga0068866_100808702 | 117 |
| 180 | 3300005718 | Ga0068866_10112833 | Ga0068866_101128332 | 117 |
| 181 | 3300005718 | Ga0068866_10873095 | Ga0068866_108730951 | 117 |
| 182 | 3300005718 | Ga0068866_11005305 | Ga0068866_110053052 | 117 |
| 183 | 3300005719 | Ga0068861_100016694 | Ga0068861_1000166943 | 117 |
| 184 | 3300005719 | Ga0068861_100055084 | Ga0068861_1000550844 | 117 |
| 185 | 3300005719 | Ga0068861_100170880 | Ga0068861_1001708802 | 117 |
| 186 | 3300005719 | Ga0068861_100844326 | Ga0068861_1008443262 | 117 |
| 187 | 3300005834 | Ga0068851_10003950 | Ga0068851_100039503 | 117 |
| 188 | 3300005834 | Ga0068851_10012597 | Ga0068851_100125972 | 117 |
| 189 | 3300005834 | Ga0068851_10074372 | Ga0068851_100743722 | 117 |
| 190 | 3300005834 | Ga0068851_10398179 | Ga0068851_103981792 | 117 |
| 191 | 3300005834 | Ga0068851_10420542 | Ga0068851_104205422 | 117 |
| 192 | 3300005834 | Ga0068851_10457232 | Ga0068851_104572322 | 117 |
| 193 | 3300005840 | Ga0068870_10300549 | Ga0068870_103005492 | 117 |
| 194 | 3300005841 | Ga0068863_100000585 | Ga0068863_10000058527 | 117 |
| 195 | 3300005841 | Ga0068863_100030558 | Ga0068863_1000305586 | 117 |
| 196 | 3300005841 | Ga0068863_100084167 | Ga0068863_1000841674 | 117 |
| 197 | 3300005842 | Ga0068858_100003791 | Ga0068858_1000037914 | 117 |
| 198 | 3300005842 | Ga0068858_100004338 | Ga0068858_1000043383 | 117 |
| 199 | 3300005842 | Ga0068858_100040761 | Ga0068858_1000407613 | 117 |
| 200 | 3300005843 | Ga0068860_100009426 | Ga0068860_1000094263 | 117 |
| 201 | 3300005843 | Ga0068860_100739390 | Ga0068860_1007393902 | 117 |
| 202 | 3300005844 | Ga0068862_100017376 | Ga0068862_1000173762 | 117 |
| 203 | 3300005844 | Ga0068862_100092044 | Ga0068862_1000920442 | 117 |
| 204 | 3300005844 | Ga0068862_100237248 | Ga0068862_1002372483 | 117 |
| 205 | 3300006048 | Ga0075363_100046109 | Ga0075363_1000461092 | 117 |
| 206 | 3300006048 | Ga0075363_100092249 | Ga0075363_1000922493 | 117 |
| 207 | 3300006048 | Ga0075363_100135254 | Ga0075363_1001352542 | 117 |
| 208 | 3300006051 | Ga0075364_11106488 | Ga0075364_111064882 | 117 |
| 209 | 3300006058 | Ga0075432_10119778 | Ga0075432_101197782 | 117 |
| 210 | 3300006163 | Ga0070715_10060047 | Ga0070715_100600472 | 117 |
| 211 | 3300006177 | Ga0075362_10149782 | Ga0075362_101497823 | 117 |
| 212 | 3300006177 | Ga0075362_10286403 | Ga0075362_102864032 | 117 |
| 213 | 3300006178 | Ga0075367_10072398 | Ga0075367_100723982 | 117 |
| 214 | 3300006178 | Ga0075367_10476319 | Ga0075367_104763192 | 117 |
| 215 | 3300006178 | Ga0075367_10792718 | Ga0075367_107927182 | 117 |
| 216 | 3300006186 | Ga0075369_10082140 | Ga0075369_100821401 | 117 |
| 217 | 3300006195 | Ga0075366_10004561 | Ga0075366_1000456110 | 117 |
| 218 | 3300006195 | Ga0075366_10041399 | Ga0075366_100413993 | 117 |
| 219 | 3300006195 | Ga0075366_10074317 | Ga0075366_100743172 | 117 |
| 220 | 3300006195 | Ga0075366_10095318 | Ga0075366_100953183 | 117 |
| 221 | 3300006195 | Ga0075366_10111637 | Ga0075366_101116372 | 117 |
| 222 | 3300006195 | Ga0075366_10212218 | Ga0075366_102122182 | 117 |
| 223 | 3300006195 | Ga0075366_10262354 | Ga0075366_102623542 | 117 |
| 224 | 3300006195 | Ga0075366_10269222 | Ga0075366_102692222 | 117 |
| 225 | 3300006195 | Ga0075366_10288838 | Ga0075366_102888382 | 117 |
| 226 | 3300006195 | Ga0075366_10302268 | Ga0075366_103022682 | 117 |
| 227 | 3300006195 | Ga0075366_10335030 | Ga0075366_103350302 | 117 |
| 228 | 3300006195 | Ga0075366_10670885 | Ga0075366_106708852 | 117 |
| 229 | 3300006237 | Ga0097621_100029626 | Ga0097621_1000296263 | 117 |
| 230 | 3300006237 | Ga0097621_100046754 | Ga0097621_1000467546 | 117 |
| 231 | 3300006237 | Ga0097621_100070577 | Ga0097621_1000705773 | 117 |
| 232 | 3300006237 | Ga0097621_100103028 | Ga0097621_1001030283 | 117 |
| 233 | 3300006237 | Ga0097621_100275565 | Ga0097621_1002755652 | 117 |
| 234 | 3300006237 | Ga0097621_100397941 | Ga0097621_1003979412 | 117 |
| 235 | 3300006237 | Ga0097621_100908038 | Ga0097621_1009080382 | 117 |
| 236 | 3300006353 | Ga0075370_10000538 | Ga0075370_100005387 | 117 |
| 237 | 3300006353 | Ga0075370_10004004 | Ga0075370_100040049 | 117 |
| 238 | 3300006353 | Ga0075370_10007898 | Ga0075370_100078984 | 117 |
| 239 | 3300006353 | Ga0075370_10057411 | Ga0075370_100574113 | 117 |
| 240 | 3300006353 | Ga0075370_10087471 | Ga0075370_100874713 | 117 |
| 241 | 3300006353 | Ga0075370_10100191 | Ga0075370_101001913 | 117 |
| 242 | 3300006353 | Ga0075370_10155526 | Ga0075370_101555262 | 117 |
| 243 | 3300006353 | Ga0075370_10570672 | Ga0075370_105706722 | 117 |
| 244 | 3300006353 | Ga0075370_10616875 | Ga0075370_106168752 | 117 |
| 245 | 3300006358 | Ga0068871_100101626 | Ga0068871_1001016263 | 117 |
| 246 | 3300006358 | Ga0068871_100165350 | Ga0068871_1001653503 | 117 |
| 247 | 3300006358 | Ga0068871_100184978 | Ga0068871_1001849782 | 117 |
| 248 | 3300006358 | Ga0068871_100255127 | Ga0068871_1002551272 | 117 |
| 249 | 3300006358 | Ga0068871_100478652 | Ga0068871_1004786522 | 117 |
| 250 | 3300006358 | Ga0068871_100736002 | Ga0068871_1007360021 | 117 |
| 251 | 3300006881 | Ga0068865_100095849 | Ga0068865_1000958493 | 117 |
| 252 | 3300006881 | Ga0068865_100440218 | Ga0068865_1004402182 | 117 |
| 253 | 3300006881 | Ga0068865_100608154 | Ga0068865_1006081542 | 117 |
| 254 | 3300006931 | Ga0097620_100032866 | Ga0097620_1000328662 | 117 |
| 255 | 3300006931 | Ga0097620_100790373 | Ga0097620_1007903733 | 117 |
| 256 | 3300006931 | Ga0097620_101672697 | Ga0097620_1016726972 | 117 |
| 257 | 3300006946 | Ga0079104_1066484 | Ga0079104_10664841 | 117 |
| 258 | 3300009094 | Ga0111539_12071301 | Ga0111539_120713012 | 117 |
| 259 | 3300009148 | Ga0105243_10089500 | Ga0105243_100895003 | 117 |
| 260 | 3300009148 | Ga0105243_10350273 | Ga0105243_103502732 | 117 |
| 261 | 3300009148 | Ga0105243_10464194 | Ga0105243_104641942 | 117 |
| 262 | 3300009148 | Ga0105243_10488986 | Ga0105243_104889862 | 117 |
| 263 | 3300009174 | Ga0105241_12092215 | Ga0105241_120922151 | 117 |
| 264 | 3300009176 | Ga0105242_10051786 | Ga0105242_100517862 | 117 |
| 265 | 3300009176 | Ga0105242_10373544 | Ga0105242_103735442 | 117 |
| 266 | 3300009177 | Ga0105248_10069620 | Ga0105248_100696202 | 117 |
| 267 | 3300009177 | Ga0105248_10072235 | Ga0105248_100722355 | 117 |
| 268 | 3300009177 | Ga0105248_10155186 | Ga0105248_101551863 | 117 |
| 269 | 3300009177 | Ga0105248_10193938 | Ga0105248_101939382 | 117 |
| 270 | 3300009177 | Ga0105248_10216600 | Ga0105248_102166002 | 117 |
| 271 | 3300009177 | Ga0105248_10665881 | Ga0105248_106658812 | 117 |
| 272 | 3300009177 | Ga0105248_11211900 | Ga0105248_112119002 | 117 |
| 273 | 3300009177 | Ga0105248_11686089 | Ga0105248_116860892 | 117 |
| 274 | 3300009545 | Ga0105237_10910577 | Ga0105237_109105771 | 117 |
| 275 | 3300009551 | Ga0105238_10380034 | Ga0105238_103800342 | 117 |
| 276 | 3300009551 | Ga0105238_10425409 | Ga0105238_104254092 | 117 |
| 277 | 3300009553 | Ga0105249_10029308 | Ga0105249_100293086 | 117 |
| 278 | 3300009553 | Ga0105249_10048014 | Ga0105249_100480143 | 117 |
| 279 | 3300009553 | Ga0105249_10087076 | Ga0105249_100870764 | 117 |
| 280 | 3300009553 | Ga0105249_11053954 | Ga0105249_110539542 | 117 |
| 281 | 3300010375 | Ga0105239_12035610 | Ga0105239_120356102 | 117 |
| 282 | 3300012512 | Ga0157327_1080636 | Ga0157327_10806361 | 117 |
| 283 | 3300012513 | Ga0157326_1038424 | Ga0157326_10384242 | 117 |
| 284 | 3300013102 | Ga0157371_10740009 | Ga0157371_107400091 | 117 |
| 285 | 3300013104 | Ga0157370_10165329 | Ga0157370_101653293 | 117 |
| 286 | 3300013105 | Ga0157369_10752850 | Ga0157369_107528502 | 117 |
| 287 | 3300013105 | Ga0157369_11157387 | Ga0157369_111573872 | 117 |
| 288 | 3300013105 | Ga0157369_11468877 | Ga0157369_114688772 | 117 |
| 289 | 3300013296 | Ga0157374_10359752 | Ga0157374_103597523 | 117 |
| 290 | 3300013296 | Ga0157374_10372251 | Ga0157374_103722512 | 117 |
| 291 | 3300013306 | Ga0163162_10004424 | Ga0163162_100044247 | 117 |
| 292 | 3300013306 | Ga0163162_10116464 | Ga0163162_101164643 | 117 |
| 293 | 3300013306 | Ga0163162_10177994 | Ga0163162_101779943 | 117 |
| 294 | 3300013306 | Ga0163162_10291800 | Ga0163162_102918002 | 117 |
| 295 | 3300013307 | Ga0157372_10433592 | Ga0157372_104335922 | 117 |
| 296 | 3300013308 | Ga0157375_10006387 | Ga0157375_1000638713 | 117 |
| 297 | 3300013308 | Ga0157375_10059937 | Ga0157375_100599374 | 117 |
| 298 | 3300013308 | Ga0157375_10138513 | Ga0157375_101385134 | 117 |
| 299 | 3300013308 | Ga0157375_10451488 | Ga0157375_104514883 | 117 |
| 300 | 3300014325 | Ga0163163_10010179 | Ga0163163_100101796 | 117 |
| 301 | 3300014325 | Ga0163163_10685778 | Ga0163163_106857782 | 117 |
| 302 | 3300014325 | Ga0163163_11529212 | Ga0163163_115292122 | 117 |
| 303 | 3300014325 | Ga0163163_12956102 | Ga0163163_129561021 | 117 |
| 304 | 3300014326 | Ga0157380_10012973 | Ga0157380_100129737 | 117 |
| 305 | 3300014326 | Ga0157380_10130474 | Ga0157380_101304743 | 117 |
| 306 | 3300014326 | Ga0157380_12989077 | Ga0157380_129890772 | 117 |
| 307 | 3300014745 | Ga0157377_10031570 | Ga0157377_100315703 | 117 |
| 308 | 3300014745 | Ga0157377_10348261 | Ga0157377_103482612 | 117 |
| 309 | 3300014968 | Ga0157379_10004462 | Ga0157379_100044628 | 117 |
| 310 | 3300014968 | Ga0157379_10024218 | Ga0157379_100242186 | 117 |
| 311 | 3300014968 | Ga0157379_10043320 | Ga0157379_100433205 | 117 |
| 312 | 3300014968 | Ga0157379_10060086 | Ga0157379_100600863 | 117 |
| 313 | 3300014969 | Ga0157376_10433621 | Ga0157376_104336212 | 117 |
| 314 | 3300014969 | Ga0157376_10868048 | Ga0157376_108680482 | 117 |
| 315 | 3300014969 | Ga0157376_10985308 | Ga0157376_109853082 | 117 |
| 316 | 3300014969 | Ga0157376_11077411 | Ga0157376_110774112 | 117 |
| 317 | 3300017792 | Ga0163161_10031951 | Ga0163161_100319515 | 117 |
| 318 | 3300017792 | Ga0163161_10213343 | Ga0163161_102133432 | 117 |
| 319 | 3300017792 | Ga0163161_10451125 | Ga0163161_104511252 | 117 |
| 320 | 3300017792 | Ga0163161_10480496 | Ga0163161_104804962 | 117 |
| 321 | 3300025226 | Ga0209674_111433 | Ga0209674_1114331 | 117 |
| 322 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051101 | 117 |
| 323 | 3300025315 | Ga0207697_10049074 | Ga0207697_100490742 | 117 |
| 324 | 3300025315 | Ga0207697_10229534 | Ga0207697_102295342 | 117 |
| 325 | 3300025315 | Ga0207697_10537176 | Ga0207697_105371761 | 117 |
| 326 | 3300025321 | Ga0207656_10042257 | Ga0207656_100422572 | 117 |
| 327 | 3300025321 | Ga0207656_10053522 | Ga0207656_100535223 | 117 |
| 328 | 3300025321 | Ga0207656_10096025 | Ga0207656_100960252 | 117 |
| 329 | 3300025321 | Ga0207656_10249475 | Ga0207656_102494752 | 117 |
| 330 | 3300025893 | Ga0207682_10007636 | Ga0207682_100076363 | 117 |
| 331 | 3300025893 | Ga0207682_10043178 | Ga0207682_100431782 | 117 |
| 332 | 3300025893 | Ga0207682_10054709 | Ga0207682_100547092 | 117 |
| 333 | 3300025893 | Ga0207682_10109308 | Ga0207682_101093082 | 117 |
| 334 | 3300025893 | Ga0207682_10117515 | Ga0207682_101175152 | 117 |
| 335 | 3300025899 | Ga0207642_10002689 | Ga0207642_100026896 | 117 |
| 336 | 3300025899 | Ga0207642_10064618 | Ga0207642_100646183 | 117 |
| 337 | 3300025901 | Ga0207688_10031184 | Ga0207688_100311843 | 117 |
| 338 | 3300025903 | Ga0207680_10028222 | Ga0207680_100282222 | 117 |
| 339 | 3300025903 | Ga0207680_10093891 | Ga0207680_100938911 | 117 |
| 340 | 3300025905 | Ga0207685_10080552 | Ga0207685_100805523 | 117 |
| 341 | 3300025907 | Ga0207645_10031798 | Ga0207645_100317985 | 117 |
| 342 | 3300025907 | Ga0207645_10050248 | Ga0207645_100502483 | 117 |
| 343 | 3300025908 | Ga0207643_10084941 | Ga0207643_100849413 | 117 |
| 344 | 3300025909 | Ga0207705_10107497 | Ga0207705_101074973 | 117 |
| 345 | 3300025910 | Ga0207684_10120209 | Ga0207684_101202092 | 117 |
| 346 | 3300025918 | Ga0207662_10007292 | Ga0207662_100072928 | 117 |
| 347 | 3300025919 | Ga0207657_10381695 | Ga0207657_103816952 | 117 |
| 348 | 3300025923 | Ga0207681_10052619 | Ga0207681_100526193 | 117 |
| 349 | 3300025923 | Ga0207681_10110128 | Ga0207681_101101282 | 117 |
| 350 | 3300025925 | Ga0207650_10018537 | Ga0207650_100185377 | 117 |
| 351 | 3300025925 | Ga0207650_10048417 | Ga0207650_100484173 | 117 |
| 352 | 3300025925 | Ga0207650_10102743 | Ga0207650_101027432 | 117 |
| 353 | 3300025925 | Ga0207650_10395047 | Ga0207650_103950472 | 117 |
| 354 | 3300025925 | Ga0207650_10734134 | Ga0207650_107341341 | 117 |
| 355 | 3300025926 | Ga0207659_10000313 | Ga0207659_1000031312 | 117 |
| 356 | 3300025926 | Ga0207659_10050735 | Ga0207659_100507352 | 117 |
| 357 | 3300025931 | Ga0207644_10000517 | Ga0207644_1000051720 | 117 |
| 358 | 3300025931 | Ga0207644_10005549 | Ga0207644_1000554910 | 117 |
| 359 | 3300025931 | Ga0207644_10072230 | Ga0207644_100722304 | 117 |
| 360 | 3300025931 | Ga0207644_10288833 | Ga0207644_102888332 | 117 |
| 361 | 3300025931 | Ga0207644_10312811 | Ga0207644_103128112 | 117 |
| 362 | 3300025931 | Ga0207644_10597305 | Ga0207644_105973052 | 117 |
| 363 | 3300025932 | Ga0207690_10321926 | Ga0207690_103219262 | 117 |
| 364 | 3300025933 | Ga0207706_10015438 | Ga0207706_100154382 | 117 |
| 365 | 3300025933 | Ga0207706_10085101 | Ga0207706_100851013 | 117 |
| 366 | 3300025933 | Ga0207706_10608999 | Ga0207706_106089992 | 117 |
| 367 | 3300025933 | Ga0207706_10812396 | Ga0207706_108123962 | 117 |
| 368 | 3300025934 | Ga0207686_11009943 | Ga0207686_110099432 | 117 |
| 369 | 3300025934 | Ga0207686_11051381 | Ga0207686_110513812 | 117 |
| 370 | 3300025934 | Ga0207686_11083159 | Ga0207686_110831592 | 117 |
| 371 | 3300025935 | Ga0207709_10032906 | Ga0207709_100329064 | 117 |
| 372 | 3300025935 | Ga0207709_10041491 | Ga0207709_100414913 | 117 |
| 373 | 3300025935 | Ga0207709_10562207 | Ga0207709_105622072 | 117 |
| 374 | 3300025936 | Ga0207670_10005218 | Ga0207670_100052188 | 117 |
| 375 | 3300025937 | Ga0207669_10169264 | Ga0207669_101692642 | 117 |
| 376 | 3300025937 | Ga0207669_10314964 | Ga0207669_103149643 | 117 |
| 377 | 3300025937 | Ga0207669_10433406 | Ga0207669_104334062 | 117 |
| 378 | 3300025937 | Ga0207669_10636984 | Ga0207669_106369842 | 117 |
| 379 | 3300025937 | Ga0207669_11623041 | Ga0207669_116230412 | 117 |
| 380 | 3300025938 | Ga0207704_10033101 | Ga0207704_100331012 | 117 |
| 381 | 3300025938 | Ga0207704_10452945 | Ga0207704_104529452 | 117 |
| 382 | 3300025938 | Ga0207704_10582727 | Ga0207704_105827272 | 117 |
| 383 | 3300025939 | Ga0207665_10130042 | Ga0207665_101300423 | 117 |
| 384 | 3300025939 | Ga0207665_11244255 | Ga0207665_112442551 | 117 |
| 385 | 3300025940 | Ga0207691_10022088 | Ga0207691_100220885 | 117 |
| 386 | 3300025940 | Ga0207691_10033898 | Ga0207691_100338983 | 117 |
| 387 | 3300025940 | Ga0207691_10054876 | Ga0207691_100548764 | 117 |
| 388 | 3300025940 | Ga0207691_10114412 | Ga0207691_101144123 | 117 |
| 389 | 3300025940 | Ga0207691_10133529 | Ga0207691_101335292 | 117 |
| 390 | 3300025940 | Ga0207691_10150234 | Ga0207691_101502343 | 117 |
| 391 | 3300025940 | Ga0207691_10246845 | Ga0207691_102468453 | 117 |
| 392 | 3300025941 | Ga0207711_10003170 | Ga0207711_1000317013 | 117 |
| 393 | 3300025941 | Ga0207711_10072292 | Ga0207711_100722922 | 117 |
| 394 | 3300025941 | Ga0207711_10367832 | Ga0207711_103678322 | 117 |
| 395 | 3300025941 | Ga0207711_10646067 | Ga0207711_106460672 | 117 |
| 396 | 3300025942 | Ga0207689_10013647 | Ga0207689_100136479 | 117 |
| 397 | 3300025942 | Ga0207689_10021025 | Ga0207689_100210256 | 117 |
| 398 | 3300025942 | Ga0207689_10602763 | Ga0207689_106027632 | 117 |
| 399 | 3300025945 | Ga0207679_10139117 | Ga0207679_101391173 | 117 |
| 400 | 3300025945 | Ga0207679_10544922 | Ga0207679_105449222 | 117 |
| 401 | 3300025945 | Ga0207679_10592968 | Ga0207679_105929682 | 117 |
| 402 | 3300025960 | Ga0207651_10066518 | Ga0207651_100665183 | 117 |
| 403 | 3300025960 | Ga0207651_10221464 | Ga0207651_102214642 | 117 |
| 404 | 3300025960 | Ga0207651_10472482 | Ga0207651_104724822 | 117 |
| 405 | 3300025960 | Ga0207651_10597552 | Ga0207651_105975522 | 117 |
| 406 | 3300025960 | Ga0207651_11206044 | Ga0207651_112060442 | 117 |
| 407 | 3300025961 | Ga0207712_10093088 | Ga0207712_100930883 | 117 |
| 408 | 3300025961 | Ga0207712_10305486 | Ga0207712_103054862 | 117 |
| 409 | 3300025972 | Ga0207668_10062324 | Ga0207668_100623243 | 117 |
| 410 | 3300025972 | Ga0207668_10071084 | Ga0207668_100710841 | 117 |
| 411 | 3300025972 | Ga0207668_11022764 | Ga0207668_110227642 | 117 |
| 412 | 3300025981 | Ga0207640_10055671 | Ga0207640_100556712 | 117 |
| 413 | 3300025981 | Ga0207640_11152593 | Ga0207640_111525932 | 117 |
| 414 | 3300025986 | Ga0207658_10000812 | Ga0207658_100008126 | 117 |
| 415 | 3300025986 | Ga0207658_10004524 | Ga0207658_1000452413 | 117 |
| 416 | 3300026023 | Ga0207677_10004232 | Ga0207677_100042329 | 117 |
| 417 | 3300026023 | Ga0207677_10068217 | Ga0207677_100682174 | 117 |
| 418 | 3300026023 | Ga0207677_10911196 | Ga0207677_109111962 | 117 |
| 419 | 3300026035 | Ga0207703_10000929 | Ga0207703_1000092916 | 117 |
| 420 | 3300026035 | Ga0207703_10001541 | Ga0207703_100015414 | 117 |
| 421 | 3300026041 | Ga0207639_11234313 | Ga0207639_112343132 | 117 |
| 422 | 3300026067 | Ga0207678_10306318 | Ga0207678_103063182 | 117 |
| 423 | 3300026067 | Ga0207678_10372354 | Ga0207678_103723541 | 117 |
| 424 | 3300026075 | Ga0207708_10036575 | Ga0207708_100365753 | 117 |
| 425 | 3300026078 | Ga0207702_10603650 | Ga0207702_106036502 | 117 |
| 426 | 3300026088 | Ga0207641_10000655 | Ga0207641_1000065543 | 117 |
| 427 | 3300026088 | Ga0207641_10002319 | Ga0207641_100023193 | 117 |
| 428 | 3300026088 | Ga0207641_10031495 | Ga0207641_100314954 | 117 |
| 429 | 3300026088 | Ga0207641_10056214 | Ga0207641_100562143 | 117 |
| 430 | 3300026088 | Ga0207641_12096397 | Ga0207641_120963972 | 117 |
| 431 | 3300026089 | Ga0207648_10006616 | Ga0207648_1000661616 | 117 |
| 432 | 3300026089 | Ga0207648_10152456 | Ga0207648_101524563 | 117 |
| 433 | 3300026089 | Ga0207648_10360701 | Ga0207648_103607012 | 117 |
| 434 | 3300026089 | Ga0207648_10504353 | Ga0207648_105043532 | 117 |
| 435 | 3300026095 | Ga0207676_10002990 | Ga0207676_1000299012 | 117 |
| 436 | 3300026095 | Ga0207676_10019288 | Ga0207676_100192886 | 117 |
| 437 | 3300026095 | Ga0207676_10027347 | Ga0207676_100273475 | 117 |
| 438 | 3300026095 | Ga0207676_10171790 | Ga0207676_101717904 | 117 |
| 439 | 3300026095 | Ga0207676_12420863 | Ga0207676_124208631 | 117 |
| 440 | 3300026118 | Ga0207675_100007375 | Ga0207675_10000737510 | 117 |
| 441 | 3300026118 | Ga0207675_100045418 | Ga0207675_1000454185 | 117 |
| 442 | 3300026118 | Ga0207675_100315865 | Ga0207675_1003158653 | 117 |
| 443 | 3300026121 | Ga0207683_10001877 | Ga0207683_100018776 | 117 |
| 444 | 3300026121 | Ga0207683_10015629 | Ga0207683_100156294 | 117 |
| 445 | 3300026121 | Ga0207683_10069474 | Ga0207683_100694743 | 117 |
| 446 | 3300026121 | Ga0207683_11011194 | Ga0207683_110111942 | 117 |
| 447 | 3300026121 | Ga0207683_11170920 | Ga0207683_111709202 | 117 |
| 448 | 3300026121 | Ga0207683_11309161 | Ga0207683_113091612 | 117 |
| 449 | 3300026142 | Ga0207698_10047674 | Ga0207698_100476743 | 117 |
| 450 | 3300026142 | Ga0207698_10089408 | Ga0207698_100894084 | 117 |
| 451 | 3300026142 | Ga0207698_10145002 | Ga0207698_101450023 | 117 |
| 452 | 3300026142 | Ga0207698_10992679 | Ga0207698_109926791 | 117 |
| 453 | 3300026142 | Ga0207698_11040918 | Ga0207698_110409181 | 117 |
| 454 | 3300026142 | Ga0207698_11209556 | Ga0207698_112095562 | 117 |
| 455 | 3300026142 | Ga0207698_11306513 | Ga0207698_113065132 | 117 |
| 456 | 3300026142 | Ga0207698_11503044 | Ga0207698_115030442 | 117 |
| 457 | 3300026142 | Ga0207698_11635731 | Ga0207698_116357312 | 117 |
| 458 | 3300027907 | Ga0207428_10551450 | Ga0207428_105514502 | 117 |
| 459 | 3300028379 | Ga0268266_11334451 | Ga0268266_113344512 | 117 |
| 460 | 3300028380 | Ga0268265_10031887 | Ga0268265_100318872 | 117 |
| 461 | 3300028380 | Ga0268265_10412897 | Ga0268265_104128972 | 117 |
| 462 | 3300028380 | Ga0268265_11064548 | Ga0268265_110645482 | 117 |
| 463 | 3300028381 | Ga0268264_10037391 | Ga0268264_100373914 | 117 |
| 464 | 3300028381 | Ga0268264_10120333 | Ga0268264_101203333 | 117 |
| 465 | 3300028794 | Ga0307515_10048310 | Ga0307515_100483107 | 117 |
| 466 | 3300028794 | Ga0307515_10109047 | Ga0307515_101090475 | 117 |
| 467 | 3300028794 | Ga0307515_10202732 | Ga0307515_102027322 | 117 |
| 468 | 3300031239 | Ga0265328_10086600 | Ga0265328_100866002 | 117 |
| 469 | 3300031250 | Ga0265331_10014048 | Ga0265331_100140485 | 117 |
| 470 | 3300031251 | Ga0265327_10000083 | Ga0265327_10000083170 | 117 |
| 471 | 3300031456 | Ga0307513_10080456 | Ga0307513_100804563 | 117 |
| 472 | 3300031507 | Ga0307509_10308473 | Ga0307509_103084732 | 117 |
| 473 | 3300031548 | Ga0307408_100000038 | Ga0307408_100000038103 | 117 |
| 474 | 3300032004 | Ga0307414_10083480 | Ga0307414_100834802 | 117 |
| 475 | 3300032005 | Ga0307411_10000214 | Ga0307411_1000021421 | 117 |
| 476 | 3300035118 | Ga0373954_0042286 | Ga0373954_0042286_43_402 | 117 |
| 477 | 3300035119 | Ga0373956_0288236 | Ga0373956_0288236_74_433 | 117 |
| 478 | 3300035170 | Ga0373943_0102141 | Ga0373943_0102141_864_1223 | 117 |
| 479 | 3300035171 | Ga0373946_0083441 | Ga0373946_0083441_786_1145 | 117 |
| 480 | 3300035692 | Ga0373935_0066476 | Ga0373935_0066476_1387_1746 | 117 |
| 481 | 3300035724 | Ga0373933_0292354 | Ga0373933_0292354_188_547 | 117 |
| 482 | 3300035725 | Ga0373947_0064625 | Ga0373947_0064625_1427_1786 | 117 |
| 483 | 3300035725 | Ga0373947_0181270 | Ga0373947_0181270_119_478 | 117 |
| 484 | 3300036401 | Ga0373937_0209133 | Ga0373937_0209133_1291_1650 | 117 |
| 485 | 3300036401 | Ga0373937_1254679 | Ga0373937_1254679_53_412 | 117 |
| 486 | 3300037068 | Ga0373925_0014054 | Ga0373925_0014054_3428_3787 | 117 |
| 487 | 3300037068 | Ga0373925_0157549 | Ga0373925_0157549_154_513 | 117 |
| 488 | 3300037853 | Ga0436364_1404502 | Ga0436364_1404502_357_719 | 117 |
| 489 | 3300041441 | Ga0451787_389700 | Ga0451787_389700_32_472 | 117 |
| 490 | 3300041443 | Ga0451789_0880985 | Ga0451789_0880985_20_376 | 117 |
| 491 | 3300041452 | Ga0451793_1059538 | Ga0451793_1059538_392_832 | 117 |
| 492 | 3300041486 | Ga0451807_0710180 | Ga0451807_0710180_95_535 | 117 |
| 493 | 3300041511 | Ga0451855_0667034 | Ga0451855_0667034_129_488 | 117 |
| 494 | 3300041512 | Ga0451853_3133088 | Ga0451853_3133088_24_383 | 117 |
| 495 | 3300041512 | Ga0451853_3248874 | Ga0451853_3248874_256_696 | 117 |
| 496 | 3300042000 | Ga0439437_001347 | Ga0439437_001347_2006_2365 | 117 |
| 497 | 3300042115 | Ga0450911_030681 | Ga0450911_030681_192_548 | 117 |
| 498 | 3300042120 | Ga0450917_006046 | Ga0450917_006046_378_734 | 117 |
| 499 | 3300042126 | Ga0450888_004032 | Ga0450888_004032_644_1000 | 117 |
| 500 | 3300042127 | Ga0450890_001516 | Ga0450890_001516_512_868 | 117 |
| 501 | 3300042129 | Ga0450891_001423 | Ga0450891_001423_223_579 | 117 |
| 502 | 3300042144 | Ga0450889_000335 | Ga0450889_000335_867_1223 | 117 |
| 503 | 3300042532 | Ga0450893_0004301 | Ga0450893_0004301_1396_1752 | 117 |
| 504 | 3300045051 | Ga0451576_0041466 | Ga0451576_0041466_1313_1669 | 117 |
| 505 | 3300045051 | Ga0451576_0538876 | Ga0451576_0538876_489_845 | 117 |
| 506 | 3300046455 | Ga0495603_0119726 | Ga0495603_0119726_911_1270 | 117 |
| 507 | 3300046459 | Ga0495629_0073241 | Ga0495629_0073241_1173_1532 | 117 |
| 508 | 3300046512 | Ga0495610_0137328 | Ga0495610_0137328_574_1014 | 117 |
| 509 | 3300046519 | Ga0495632_0135578 | Ga0495632_0135578_125_565 | 117 |
| 510 | 3300046529 | Ga0495652_0496674 | Ga0495652_0496674_406_765 | 117 |
| 511 | 3300046530 | Ga0495654_0192099 | Ga0495654_0192099_41_400 | 117 |
| 512 | 3300046533 | Ga0495640_0285497 | Ga0495640_0285497_576_935 | 117 |
| 513 | 3300046535 | Ga0495586_0642876 | Ga0495586_0642876_42_401 | 117 |
| 514 | 3300046537 | Ga0495598_0012869 | Ga0495598_0012869_434_793 | 117 |
| 515 | 3300046537 | Ga0495598_0065563 | Ga0495598_0065563_385_744 | 117 |
| 516 | 3300046539 | Ga0495621_0070645 | Ga0495621_0070645_523_882 | 117 |
| 517 | 3300046542 | Ga0495597_0406942 | Ga0495597_0406942_14_454 | 117 |
| 518 | 3300046543 | Ga0495645_0269720 | Ga0495645_0269720_607_966 | 117 |
| 519 | 3300046663 | Ga0495635_0380548 | Ga0495635_0380548_95_454 | 117 |
| 520 | 3300046675 | Ga0495657_0415908 | Ga0495657_0415908_275_634 | 117 |
| 521 | 3300046681 | Ga0495647_0101331 | Ga0495647_0101331_490_849 | 117 |
| 522 | 3300046681 | Ga0495647_0357977 | Ga0495647_0357977_22_381 | 117 |
| 523 | 3300046683 | Ga0495658_0009768 | Ga0495658_0009768_2020_2379 | 117 |
| 524 | 3300046683 | Ga0495658_0201011 | Ga0495658_0201011_793_1152 | 117 |
| 525 | 3300046683 | Ga0495658_0800538 | Ga0495658_0800538_70_429 | 117 |
| 526 | 3300046691 | Ga0495670_0140677 | Ga0495670_0140677_359_718 | 117 |
| 527 | 3300047319 | Ga0495674_0448332 | Ga0495674_0448332_508_867 | 117 |
| 528 | 3300047322 | Ga0495680_0104749 | Ga0495680_0104749_859_1218 | 117 |
| 529 | 3300047471 | Ga0495684_0121875 | Ga0495684_0121875_462_821 | 117 |
| 530 | 3300047471 | Ga0495684_0201239 | Ga0495684_0201239_171_530 | 117 |
| 531 | 3300048089 | Ga0495614_0317897 | Ga0495614_0317897_309_668 | 117 |
| 532 | 3300048903 | Ga0496100_0850821 | Ga0496100_0850821_178_537 | 117 |
| 533 | 3300048904 | Ga0496101_0899322 | Ga0496101_0899322_285_644 | 117 |
| 534 | 3300048905 | Ga0496102_0015200 | Ga0496102_0015200_4243_4602 | 117 |
| 535 | 3300048907 | Ga0496104_0335229 | Ga0496104_0335229_373_732 | 117 |
| 536 | 3300048907 | Ga0496104_0827018 | Ga0496104_0827018_306_665 | 117 |
| 537 | 3300048907 | Ga0496104_1355760 | Ga0496104_1355760_245_604 | 117 |
| 538 | 3300048908 | Ga0496105_0013657 | Ga0496105_0013657_4707_5066 | 117 |
| 539 | 3300048909 | Ga0496106_0618865 | Ga0496106_0618865_417_773 | 117 |
| 540 | 3300048911 | Ga0496108_0059595 | Ga0496108_0059595_2430_2789 | 117 |
| 541 | 3300048912 | Ga0496109_0153025 | Ga0496109_0153025_1607_1966 | 117 |
| 542 | 3300048913 | Ga0496110_0480413 | Ga0496110_0480413_525_884 | 117 |
| 543 | 3300048913 | Ga0496110_0630431 | Ga0496110_0630431_528_887 | 117 |
| 544 | 3300048913 | Ga0496110_1672943 | Ga0496110_1672943_147_506 | 117 |
| 545 | 3300048914 | Ga0496111_0519474 | Ga0496111_0519474_22_381 | 117 |
| 546 | 3300048916 | Ga0496113_0189643 | Ga0496113_0189643_947_1303 | 117 |
| 547 | 3300048917 | Ga0496114_0076201 | Ga0496114_0076201_1305_1664 | 117 |
| 548 | 3300048917 | Ga0496114_0405377 | Ga0496114_0405377_688_1047 | 117 |
| 549 | 3300048917 | Ga0496114_0745451 | Ga0496114_0745451_246_605 | 117 |
| 550 | 3300048918 | Ga0496115_0559583 | Ga0496115_0559583_49_408 | 117 |
| 551 | 3300048927 | Ga0496124_0099099 | Ga0496124_0099099_25_390 | 117 |
| 552 | 3300049514 | Ga0501291_088598 | Ga0501291_088598_93_449 | 117 |
| 553 | 3300049523 | Ga0501300_001957 | Ga0501300_001957_2673_3029 | 117 |
| 554 | 3300049662 | Ga0501222_005305 | Ga0501222_005305_1276_1632 | 117 |
| 555 | 3300049665 | Ga0501227_014844 | Ga0501227_014844_539_895 | 117 |
| 556 | 3300049668 | Ga0501233_022443 | Ga0501233_022443_702_1058 | 117 |
| 557 | 3300049669 | Ga0501235_001655 | Ga0501235_001655_3023_3382 | 117 |
| 558 | 3300049672 | Ga0501239_011591 | Ga0501239_011591_523_879 | 117 |
| 559 | 3300049679 | Ga0501249_003607 | Ga0501249_003607_1958_2314 | 117 |
| 560 | 3300049687 | Ga0501258_005143 | Ga0501258_005143_894_1250 | 117 |
| 561 | 3300049705 | Ga0501225_0025179 | Ga0501225_0025179_262_618 | 117 |
| 562 | 3300049706 | Ga0501229_011018 | Ga0501229_011018_125_481 | 117 |
| 563 | 3300049706 | Ga0501229_030280 | Ga0501229_030280_125_481 | 117 |
| 564 | 3300049757 | Ga0501232_038265 | Ga0501232_038265_218_574 | 117 |
| 565 | 3300049759 | Ga0501262_004944 | Ga0501262_004944_256_612 | 117 |
| 566 | 3300049762 | Ga0501265_001805 | Ga0501265_001805_1359_1715 | 117 |
| 567 | 3300049763 | Ga0501266_021295 | Ga0501266_021295_451_810 | 117 |
| 568 | 3300049764 | Ga0501267_000352 | Ga0501267_000352_2695_3051 | 117 |
| 569 | 3300049766 | Ga0501269_008000 | Ga0501269_008000_896_1252 | 117 |
| 570 | 3300049768 | Ga0501271_011340 | Ga0501271_011340_515_874 | 117 |
| 571 | 3300050490 | nmdc:mga03n38_42821_c1 | nmdc:mga03n38_42821_c1_271_627 | 117 |
| 572 | 3300050493 | nmdc:mga0k408_134788_c1 | nmdc:mga0k408_134788_c1_879_1235 | 117 |
| 573 | 3300050493 | nmdc:mga0k408_145750_c1 | nmdc:mga0k408_145750_c1_104_544 | 117 |
| 574 | 3300050493 | nmdc:mga0k408_187724_c1 | nmdc:mga0k408_187724_c1_60_422 | 117 |
| 575 | 3300050493 | nmdc:mga0k408_5050_c1 | nmdc:mga0k408_5050_c1_6389_6745 | 117 |
| 576 | 3300050493 | nmdc:mga0k408_77120_c1 | nmdc:mga0k408_77120_c1_1019_1459 | 117 |
| 577 | 3300050496 | nmdc:mga07m45_52252_c1 | nmdc:mga07m45_52252_c1_1552_1992 | 117 |
| 578 | 3300050511 | nmdc:mga08y16_495743_c1 | nmdc:mga08y16_495743_c1_92_451 | 117 |
| 579 | 3300053077 | Ga0495601_0015412 | Ga0495601_0015412_3757_4116 | 117 |
| 580 | 3300053077 | Ga0495601_0212289 | Ga0495601_0212289_342_701 | 117 |
| 581 | 3300053084 | Ga0495595_0117964 | Ga0495595_0117964_13_372 | 117 |
| 582 | 3300053084 | Ga0495595_0192342 | Ga0495595_0192342_28_387 | 117 |
| 583 | 3300053085 | Ga0495619_0084993 | Ga0495619_0084993_83_442 | 117 |
| 584 | 3300053085 | Ga0495619_0763871 | Ga0495619_0763871_213_572 | 117 |
| 585 | 3300053117 | Ga0500593_067582 | Ga0500593_067582_391_750 | 117 |
| 586 | 3300053120 | Ga0500597_140729 | Ga0500597_140729_409_771 | 117 |
| 587 | 3300053136 | Ga0500559_0544655 | Ga0500559_0544655_76_432 | 117 |
| 588 | 3300053148 | Ga0500590_003574 | Ga0500590_003574_5807_6163 | 117 |
| 589 | 3300053155 | Ga0500620_178222 | Ga0500620_178222_345_701 | 117 |
| 590 | 3300053739 | Ga0500587_002259 | Ga0500587_002259_312_752 | 117 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.6683 | 10 | 111 |
| 7szt-assembly1.cif.gz_A | crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) | 0.6495 | 10 | 117 |
| 7szt-assembly1.cif.gz_A | crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) | 0.6402 | 10 | 117 |
| 7ssu-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.6317 | 10 | 114 |
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.6234 | 10 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69212_3_109_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.7497 | 10 | 114 | 1.10.3730.20 |
| af_P69210_8_109_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.7306 | 10 | 117 | 1.10.3730.20 |
| af_P69210_8_109_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.7075 | 10 | 117 | 1.10.3730.20 |
| af_Q3C1C7_10_111_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.7059 | 11 | 116 | 1.10.3730.20 |
| af_Q47377_2_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.6889 | 10 | 117 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7XYB8-F1-model_v4 | EamA domain-containing protein | 0.9525 | 16 | 117 |
GO:0016020
|
| AF-A0A517YNW5-F1-model_v4 | DMT family protein | 0.9319 | 9 | 117 |
GO:0016020
|
| AF-A0A0Q6BMR0-F1-model_v4 | DMT family protein | 0.9263 | 6 | 117 |
GO:0016020
|
| AF-A0L3W2-F1-model_v4 | Transmembrane signal peptide protein | 0.926 | 6 | 116 |
GO:0016020
|
| AF-A0A143BBA2-F1-model_v4 | Membrane protein | 0.9255 | 4 | 117 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar