F466981

General Info

Members Datasets Scaffolds Average Seq Length
590 260 590 120

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0423399|Ga0373925_0423399_481_1005
Length 147
Sequence VGVLDRSQAEGRERHDATAHDGGLGSASTADARDDAMTIIPTVLLLVCSNLFMTIAWYAHLKNLADRPWYVAAIVSWGIALFEYLLQVPANRIGFHVVSLAQLKIIQEIITLAVFVPFAVFYMRQPVTWNFLWAGVCLMGAVYFMFR

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
83 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
176 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
182 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
183 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
184 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
187 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
188 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
189 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
231 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
232 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
235 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
236 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
239 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
240 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
241 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
242 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
243 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
244 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
245 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
246 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
247 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
256 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
260 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.17
Nodule 0.17
Rhizoplane 4.24
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001665 3300002773 Bacteria 9215
2 JGI25150J39212_1026233 3300002774 Bacteria 844
3 JGI25153J46596_10007026 3300003215 Bacteria 5605
4 rootL2_10071287 3300003322 Bacteria 2448
5 Ga0055526_1006007 3300003771 Bacteria 6741
6 Ga0055526_1010196 3300003771 Bacteria 4403
7 Ga0055528_1073289 3300003790 Bacteria 614
8 Ga0055543_1003721 3300004625 Bacteria 4365
9 Ga0065165_1000151 3300005262 Bacteria 120917
10 Ga0065165_1000166 3300005262 Bacteria 115866
11 Ga0065165_1003633 3300005262 Bacteria 10560
12 Ga0070658_10452234 3300005327 Bacteria 1107
13 Ga0070658_10494048 3300005327 Bacteria 1056
14 Ga0070676_10241457 3300005328 Bacteria 1202
15 Ga0070676_10471206 3300005328 Bacteria 887
16 Ga0070670_100020576 3300005331 Bacteria 5675
17 Ga0070670_100087630 3300005331 Bacteria 2675
18 Ga0070670_100163454 3300005331 Bacteria 1930
19 Ga0070670_100492426 3300005331 Bacteria 1089
20 Ga0070677_10007318 3300005333 Bacteria 3683
21 Ga0070677_10036866 3300005333 Bacteria 1905
22 Ga0070677_10171988 3300005333 Bacteria 1025
23 Ga0068869_100008578 3300005334 Bacteria 6598
24 Ga0068869_100009021 3300005334 Bacteria 6463
25 Ga0068869_100489138 3300005334 Bacteria 1026
26 Ga0070666_10008568 3300005335 Bacteria 6353
27 Ga0070666_10042193 3300005335 Bacteria 3051
28 Ga0070666_10549998 3300005335 Bacteria 839
29 Ga0070666_11313381 3300005335 Bacteria 540
30 Ga0068868_100016008 3300005338 Bacteria 5561
31 Ga0068868_100088171 3300005338 Bacteria 2497
32 Ga0068868_100329161 3300005338 Bacteria 1303
33 Ga0068868_100573405 3300005338 Bacteria 997
34 Ga0068868_101182042 3300005338 Bacteria 707
35 Ga0070660_100323247 3300005339 Bacteria 1268
36 Ga0070689_100005848 3300005340 Bacteria 8451
37 Ga0070689_100117669 3300005340 Bacteria 2120
38 Ga0070687_100027854 3300005343 Bacteria 2735
39 Ga0070687_100045233 3300005343 Bacteria 2247
40 Ga0070661_100061882 3300005344 Bacteria 2748
41 Ga0070661_100074410 3300005344 Bacteria 2501
42 Ga0070661_100201255 3300005344 Bacteria 1522
43 Ga0070661_101195980 3300005344 Bacteria 636
44 Ga0070668_100007130 3300005347 Bacteria 8283
45 Ga0070668_100556649 3300005347 Bacteria 999
46 Ga0070669_100001340 3300005353 Bacteria 17754
47 Ga0070669_100298297 3300005353 Bacteria 1295
48 Ga0070675_100014979 3300005354 Bacteria 6124
49 Ga0070675_100024515 3300005354 Bacteria 4831
50 Ga0070675_100079931 3300005354 Bacteria 2725
51 Ga0070675_100116471 3300005354 Bacteria 2267
52 Ga0070675_100176442 3300005354 Bacteria 1845
53 Ga0070671_100009693 3300005355 Bacteria 7738
54 Ga0070671_100066889 3300005355 Bacteria 2995
55 Ga0070671_100099617 3300005355 Bacteria 2438
56 Ga0070671_100313041 3300005355 Bacteria 1337
57 Ga0070671_100406523 3300005355 Bacteria 1165
58 Ga0070671_100711509 3300005355 Bacteria 872
59 Ga0070674_100013491 3300005356 Bacteria 5053
60 Ga0070674_100134822 3300005356 Bacteria 1846
61 Ga0070674_100272725 3300005356 Bacteria 1338
62 Ga0070674_100448932 3300005356 Bacteria 1064
63 Ga0070674_101137331 3300005356 Bacteria 691
64 Ga0070673_100000512 3300005364 Bacteria 20784
65 Ga0070673_100007311 3300005364 Bacteria 7271
66 Ga0070673_100026611 3300005364 Bacteria 4275
67 Ga0070673_100113770 3300005364 Bacteria 2247
68 Ga0070673_100115213 3300005364 Bacteria 2235
69 Ga0070673_100586547 3300005364 Bacteria 1016
70 Ga0070673_100848584 3300005364 Bacteria 845
71 Ga0070688_100024768 3300005365 Bacteria 3546
72 Ga0070688_101045358 3300005365 Bacteria 651
73 Ga0070659_100352647 3300005366 Bacteria 1235
74 Ga0070667_100001703 3300005367 Bacteria 19670
75 Ga0070667_100004388 3300005367 Bacteria 11903
76 Ga0070667_100006263 3300005367 Bacteria 9893
77 Ga0070667_100321402 3300005367 Bacteria 1396
78 Ga0070667_100456592 3300005367 Bacteria 1168
79 Ga0070701_10093410 3300005438 Bacteria 1653
80 Ga0070701_10367515 3300005438 Bacteria 903
81 Ga0070708_101509850 3300005445 Bacteria 626
82 Ga0070663_101094223 3300005455 Bacteria 696
83 Ga0070678_100004036 3300005456 Bacteria 8264
84 Ga0070678_100010301 3300005456 Bacteria 5702
85 Ga0070678_100197655 3300005456 Bacteria 1657
86 Ga0070678_100494027 3300005456 Bacteria 1079
87 Ga0070678_100684634 3300005456 Bacteria 922
88 Ga0070678_100719893 3300005456 Bacteria 900
89 Ga0070678_100900932 3300005456 Bacteria 808
90 Ga0070662_100008433 3300005457 Bacteria 6718
91 Ga0070662_100134873 3300005457 Bacteria 1908
92 Ga0070662_100411919 3300005457 Bacteria 1117
93 Ga0070662_101233076 3300005457 Bacteria 643
94 Ga0070662_101672335 3300005457 Bacteria 550
95 Ga0068867_100011339 3300005459 Bacteria 6288
96 Ga0068867_100015106 3300005459 Bacteria 5475
97 Ga0068867_100792975 3300005459 Bacteria 844
98 Ga0068867_101724872 3300005459 Bacteria 588
99 Ga0070685_10191425 3300005466 Bacteria 1324
100 Ga0070685_10828728 3300005466 Bacteria 684
101 Ga0070706_100073795 3300005467 Bacteria 3158
102 Ga0070684_101042671 3300005535 Bacteria 768
103 Ga0068853_101496454 3300005539 Bacteria 653
104 Ga0070672_100002366 3300005543 Bacteria 11936
105 Ga0070672_100056785 3300005543 Bacteria 3071
106 Ga0070672_100119912 3300005543 Bacteria 2152
107 Ga0070672_100187342 3300005543 Bacteria 1726
108 Ga0070672_100264018 3300005543 Bacteria 1452
109 Ga0070672_100750413 3300005543 Bacteria 856
110 Ga0070686_100038385 3300005544 Bacteria 2977
111 Ga0070686_100114604 3300005544 Bacteria 1842
112 Ga0070693_100229928 3300005547 Bacteria 1219
113 Ga0070693_100738002 3300005547 Bacteria 724
114 Ga0070693_100957826 3300005547 Bacteria 645
115 Ga0070665_101470701 3300005548 Bacteria 690
116 Ga0068855_101531396 3300005563 Bacteria 684
117 Ga0070664_100102998 3300005564 Bacteria 2484
118 Ga0070664_100592439 3300005564 Bacteria 1028
119 Ga0070664_100928461 3300005564 Bacteria 816
120 Ga0070664_100998784 3300005564 Bacteria 786
121 Ga0070664_101665317 3300005564 Bacteria 604
122 Ga0068857_100124261 3300005577 Bacteria 2325
123 Ga0068854_100014237 3300005578 Bacteria 5238
124 Ga0068854_100411192 3300005578 Bacteria 1122
125 Ga0068854_100648290 3300005578 Bacteria 906
126 Ga0068854_101999974 3300005578 Bacteria 534
127 Ga0070702_100402597 3300005615 Bacteria 979
128 Ga0068852_100009488 3300005616 Bacteria 7230
129 Ga0068852_100064088 3300005616 Bacteria 3202
130 Ga0068852_100269320 3300005616 Bacteria 1638
131 Ga0068852_100394861 3300005616 Bacteria 1359
132 Ga0068852_100684070 3300005616 Bacteria 1035
133 Ga0068852_100935289 3300005616 Bacteria 885
134 Ga0068859_100032866 3300005617 Bacteria 5212
135 Ga0068859_100790279 3300005617 Bacteria 1037
136 Ga0068864_100009050 3300005618 Bacteria 8209
137 Ga0068864_100015458 3300005618 Bacteria 6346
138 Ga0068864_100016929 3300005618 Bacteria 6074
139 Ga0068864_100055318 3300005618 Bacteria 3425
140 Ga0068864_100401503 3300005618 Bacteria 1302
141 Ga0068864_100945142 3300005618 Bacteria 853
142 Ga0068866_10004159 3300005718 Bacteria 5934
143 Ga0068866_10080870 3300005718 Bacteria 1744
144 Ga0068866_10112833 3300005718 Bacteria 1520
145 Ga0068866_10873095 3300005718 Bacteria 631
146 Ga0068866_11005305 3300005718 Bacteria 593
147 Ga0068861_100016694 3300005719 Bacteria 5200
148 Ga0068861_100055084 3300005719 Bacteria 3031
149 Ga0068861_100170880 3300005719 Bacteria 1801
150 Ga0068861_100844326 3300005719 Bacteria 863
151 Ga0068851_10003950 3300005834 Bacteria 6636
152 Ga0068851_10012597 3300005834 Bacteria 3990
153 Ga0068851_10074372 3300005834 Bacteria 1764
154 Ga0068851_10398179 3300005834 Bacteria 810
155 Ga0068851_10420542 3300005834 Bacteria 789
156 Ga0068851_10457232 3300005834 Bacteria 759
157 Ga0068870_10300549 3300005840 Bacteria 1013
158 Ga0068863_100000585 3300005841 Bacteria 37128
159 Ga0068863_100030558 3300005841 Bacteria 5143
160 Ga0068863_100084167 3300005841 Bacteria 3014
161 Ga0068858_100003791 3300005842 Bacteria 14951
162 Ga0068858_100004338 3300005842 Bacteria 13920
163 Ga0068858_100040761 3300005842 Bacteria 4307
164 Ga0068858_100425474 3300005842 Bacteria 1277
165 Ga0068860_100009426 3300005843 Bacteria 9703
166 Ga0068860_100143651 3300005843 Bacteria 2295
167 Ga0068860_100739390 3300005843 Bacteria 995
168 Ga0068862_100007774 3300005844 Bacteria 8866
169 Ga0068862_100017376 3300005844 Bacteria 5990
170 Ga0068862_100092044 3300005844 Bacteria 2642
171 Ga0068862_100237248 3300005844 Bacteria 1657
172 Ga0075363_100046109 3300006048 Bacteria 2312
173 Ga0075363_100092249 3300006048 Bacteria 1668
174 Ga0075363_100135254 3300006048 Bacteria 1385
175 Ga0075364_11106488 3300006051 Bacteria 538
176 Ga0075432_10119778 3300006058 Bacteria 988
177 Ga0070715_10060047 3300006163 Bacteria 1666
178 Ga0075362_10149782 3300006177 Bacteria 1119
179 Ga0075362_10286403 3300006177 Bacteria 816
180 Ga0075362_10547334 3300006177 Bacteria 595
181 Ga0075367_10010079 3300006178 Bacteria 4955
182 Ga0075367_10072398 3300006178 Bacteria 2075
183 Ga0075367_10476319 3300006178 Bacteria 791
184 Ga0075367_10792718 3300006178 Bacteria 603
185 Ga0075369_10082140 3300006186 Bacteria 1430
186 Ga0075366_10004561 3300006195 Bacteria 7441
187 Ga0075366_10041399 3300006195 Bacteria 2728
188 Ga0075366_10060820 3300006195 Bacteria 2244
189 Ga0075366_10074317 3300006195 Bacteria 2027
190 Ga0075366_10095318 3300006195 Bacteria 1784
191 Ga0075366_10111637 3300006195 Bacteria 1644
192 Ga0075366_10212218 3300006195 Bacteria 1178
193 Ga0075366_10262354 3300006195 Bacteria 1054
194 Ga0075366_10269222 3300006195 Bacteria 1040
195 Ga0075366_10288838 3300006195 Bacteria 1003
196 Ga0075366_10302268 3300006195 Bacteria 979
197 Ga0075366_10335030 3300006195 Bacteria 928
198 Ga0075366_10670885 3300006195 Bacteria 643
199 Ga0097621_100029626 3300006237 Bacteria 4325
200 Ga0097621_100046754 3300006237 Bacteria 3503
201 Ga0097621_100070577 3300006237 Bacteria 2885
202 Ga0097621_100103028 3300006237 Bacteria 2403
203 Ga0097621_100275565 3300006237 Bacteria 1479
204 Ga0097621_100397941 3300006237 Bacteria 1233
205 Ga0097621_100908038 3300006237 Bacteria 821
206 Ga0075370_10000538 3300006353 Bacteria 14505
207 Ga0075370_10004004 3300006353 Bacteria 7081
208 Ga0075370_10007898 3300006353 Bacteria 5445
209 Ga0075370_10057411 3300006353 Bacteria 2212
210 Ga0075370_10087471 3300006353 Bacteria 1795
211 Ga0075370_10100191 3300006353 Bacteria 1676
212 Ga0075370_10155526 3300006353 Bacteria 1341
213 Ga0075370_10570672 3300006353 Bacteria 685
214 Ga0075370_10616875 3300006353 Bacteria 657
215 Ga0068871_100101626 3300006358 Bacteria 2409
216 Ga0068871_100165350 3300006358 Bacteria 1894
217 Ga0068871_100184978 3300006358 Bacteria 1792
218 Ga0068871_100255127 3300006358 Bacteria 1528
219 Ga0068871_100478652 3300006358 Bacteria 1119
220 Ga0068871_100736002 3300006358 Bacteria 906
221 Ga0068865_100095849 3300006881 Bacteria 2162
222 Ga0068865_100440218 3300006881 Bacteria 1075
223 Ga0068865_100608154 3300006881 Bacteria 925
224 Ga0097620_100032866 3300006931 Bacteria 5212
225 Ga0097620_100790373 3300006931 Bacteria 1037
226 Ga0097620_101672697 3300006931 Bacteria 703
227 Ga0079104_1066484 3300006946 Bacteria 765
228 Ga0111539_12071301 3300009094 Bacteria 660
229 Ga0105243_10089500 3300009148 Bacteria 2531
230 Ga0105243_10350273 3300009148 Bacteria 1356
231 Ga0105243_10464194 3300009148 Bacteria 1191
232 Ga0105243_10488986 3300009148 Bacteria 1163
233 Ga0105241_12092215 3300009174 Bacteria 559
234 Ga0105242_10051786 3300009176 Bacteria 3347
235 Ga0105242_10373544 3300009176 Bacteria 1323
236 Ga0105248_10069620 3300009177 Bacteria 3950
237 Ga0105248_10072235 3300009177 Bacteria 3878
238 Ga0105248_10155186 3300009177 Bacteria 2583
239 Ga0105248_10193938 3300009177 Bacteria 2289
240 Ga0105248_10216600 3300009177 Bacteria 2156
241 Ga0105248_10665881 3300009177 Bacteria 1174
242 Ga0105248_11118411 3300009177 Bacteria 890
243 Ga0105248_11211900 3300009177 Bacteria 853
244 Ga0105248_11686089 3300009177 Bacteria 718
245 Ga0105237_10910577 3300009545 Bacteria 886
246 Ga0105238_10380034 3300009551 Bacteria 1404
247 Ga0105238_10425409 3300009551 Bacteria 1323
248 Ga0105249_10029308 3300009553 Bacteria 4970
249 Ga0105249_10048014 3300009553 Bacteria 3892
250 Ga0105249_10087076 3300009553 Bacteria 2914
251 Ga0105249_10533196 3300009553 Bacteria 1223
252 Ga0105249_11053954 3300009553 Bacteria 883
253 Ga0105239_12035610 3300010375 Bacteria 667
254 Ga0157327_1080636 3300012512 Bacteria 523
255 Ga0157326_1038424 3300012513 Bacteria 662
256 Ga0157371_10740009 3300013102 Bacteria 738
257 Ga0157370_10165329 3300013104 Bacteria 2058
258 Ga0157369_10752850 3300013105 Bacteria 1002
259 Ga0157369_11157387 3300013105 Bacteria 790
260 Ga0157369_11468877 3300013105 Bacteria 694
261 Ga0157374_10359752 3300013296 Bacteria 1447
262 Ga0157374_10372251 3300013296 Bacteria 1422
263 Ga0163162_10004424 3300013306 Bacteria 13529
264 Ga0163162_10116464 3300013306 Bacteria 2773
265 Ga0163162_10177994 3300013306 Bacteria 2252
266 Ga0163162_10291800 3300013306 Bacteria 1763
267 Ga0157372_10433592 3300013307 Bacteria 1532
268 Ga0157375_10006387 3300013308 Bacteria 10274
269 Ga0157375_10059937 3300013308 Bacteria 3772
270 Ga0157375_10138513 3300013308 Bacteria 2559
271 Ga0157375_10451488 3300013308 Bacteria 1451
272 Ga0163163_10000532 3300014325 Bacteria 33942
273 Ga0163163_10010179 3300014325 Bacteria 8441
274 Ga0163163_10685778 3300014325 Bacteria 1088
275 Ga0163163_11529212 3300014325 Bacteria 729
276 Ga0163163_12956102 3300014325 Bacteria 530
277 Ga0157380_10012973 3300014326 Bacteria 6057
278 Ga0157380_10130474 3300014326 Bacteria 2143
279 Ga0157380_11473815 3300014326 Bacteria 733
280 Ga0157380_12989077 3300014326 Bacteria 539
281 Ga0157377_10031570 3300014745 Bacteria 2879
282 Ga0157377_10348261 3300014745 Bacteria 993
283 Ga0157379_10004462 3300014968 Bacteria 12005
284 Ga0157379_10024218 3300014968 Bacteria 5388
285 Ga0157379_10043320 3300014968 Bacteria 4018
286 Ga0157379_10060086 3300014968 Bacteria 3398
287 Ga0157376_10433621 3300014969 Bacteria 1278
288 Ga0157376_10868048 3300014969 Bacteria 919
289 Ga0157376_10985308 3300014969 Bacteria 865
290 Ga0157376_11077411 3300014969 Bacteria 829
291 Ga0163161_10031951 3300017792 Bacteria 3755
292 Ga0163161_10213343 3300017792 Bacteria 1492
293 Ga0163161_10451125 3300017792 Bacteria 1040
294 Ga0163161_10480496 3300017792 Bacteria 1009
295 Ga0209674_111433 3300025226 Bacteria 905
296 Ga0209563_100005 3300025230 Bacteria 1774893
297 Ga0207697_10049074 3300025315 Bacteria 1742
298 Ga0207697_10229534 3300025315 Bacteria 820
299 Ga0207697_10537176 3300025315 Bacteria 515
300 Ga0207656_10042257 3300025321 Bacteria 1939
301 Ga0207656_10053522 3300025321 Bacteria 1752
302 Ga0207656_10096025 3300025321 Bacteria 1352
303 Ga0207656_10249475 3300025321 Bacteria 869
304 Ga0207682_10007636 3300025893 Bacteria 4304
305 Ga0207682_10043178 3300025893 Bacteria 1844
306 Ga0207682_10054709 3300025893 Bacteria 1659
307 Ga0207682_10109308 3300025893 Bacteria 1216
308 Ga0207682_10117515 3300025893 Bacteria 1176
309 Ga0207642_10002689 3300025899 Bacteria 5544
310 Ga0207642_10064618 3300025899 Bacteria 1716
311 Ga0207688_10031184 3300025901 Bacteria 2942
312 Ga0207680_10028222 3300025903 Bacteria 3136
313 Ga0207680_10093891 3300025903 Bacteria 1915
314 Ga0207685_10080552 3300025905 Bacteria 1346
315 Ga0207645_10031798 3300025907 Bacteria 3393
316 Ga0207645_10050248 3300025907 Bacteria 2662
317 Ga0207643_10084941 3300025908 Bacteria 1838
318 Ga0207705_10107497 3300025909 Bacteria 2058
319 Ga0207684_10120209 3300025910 Bacteria 2252
320 Ga0207662_10007292 3300025918 Bacteria 6011
321 Ga0207657_10381695 3300025919 Bacteria 1109
322 Ga0207681_10052619 3300025923 Bacteria 2761
323 Ga0207681_10110128 3300025923 Bacteria 2001
324 Ga0207650_10018537 3300025925 Bacteria 4885
325 Ga0207650_10048417 3300025925 Bacteria 3135
326 Ga0207650_10102743 3300025925 Bacteria 2203
327 Ga0207650_10395047 3300025925 Bacteria 1144
328 Ga0207650_10734134 3300025925 Bacteria 835
329 Ga0207659_10000313 3300025926 Bacteria 29491
330 Ga0207659_10050735 3300025926 Bacteria 2948
331 Ga0207644_10000517 3300025931 Bacteria 24952
332 Ga0207644_10005549 3300025931 Bacteria 8209
333 Ga0207644_10072230 3300025931 Bacteria 2527
334 Ga0207644_10288833 3300025931 Bacteria 1318
335 Ga0207644_10312811 3300025931 Bacteria 1268
336 Ga0207644_10597305 3300025931 Bacteria 916
337 Ga0207690_10321926 3300025932 Bacteria 1216
338 Ga0207706_10015438 3300025933 Bacteria 6899
339 Ga0207706_10085101 3300025933 Bacteria 2780
340 Ga0207706_10608999 3300025933 Bacteria 938
341 Ga0207706_10812396 3300025933 Bacteria 794
342 Ga0207686_11009943 3300025934 Bacteria 675
343 Ga0207686_11051381 3300025934 Bacteria 662
344 Ga0207686_11083159 3300025934 Bacteria 653
345 Ga0207709_10032906 3300025935 Bacteria 3040
346 Ga0207709_10041491 3300025935 Bacteria 2761
347 Ga0207709_10562207 3300025935 Bacteria 898
348 Ga0207670_10005218 3300025936 Bacteria 7107
349 Ga0207669_10169264 3300025937 Bacteria 1553
350 Ga0207669_10314964 3300025937 Bacteria 1195
351 Ga0207669_10433406 3300025937 Bacteria 1037
352 Ga0207669_10636984 3300025937 Bacteria 870
353 Ga0207669_11623041 3300025937 Bacteria 552
354 Ga0207704_10033101 3300025938 Bacteria 2935
355 Ga0207704_10452945 3300025938 Bacteria 1024
356 Ga0207704_10582727 3300025938 Bacteria 913
357 Ga0207665_10130042 3300025939 Bacteria 1786
358 Ga0207665_11244255 3300025939 Bacteria 594
359 Ga0207691_10022088 3300025940 Bacteria 6004
360 Ga0207691_10033898 3300025940 Bacteria 4753
361 Ga0207691_10054876 3300025940 Bacteria 3634
362 Ga0207691_10114412 3300025940 Bacteria 2397
363 Ga0207691_10133529 3300025940 Bacteria 2191
364 Ga0207691_10150234 3300025940 Bacteria 2048
365 Ga0207691_10246845 3300025940 Bacteria 1542
366 Ga0207711_10003170 3300025941 Bacteria 14341
367 Ga0207711_10072292 3300025941 Bacteria 2996
368 Ga0207711_10367832 3300025941 Bacteria 1333
369 Ga0207711_10646067 3300025941 Bacteria 987
370 Ga0207689_10013647 3300025942 Bacteria 6928
371 Ga0207689_10021025 3300025942 Bacteria 5485
372 Ga0207689_10602763 3300025942 Bacteria 924
373 Ga0207679_10139117 3300025945 Bacteria 1960
374 Ga0207679_10544922 3300025945 Bacteria 1040
375 Ga0207679_10592968 3300025945 Bacteria 998
376 Ga0207651_10066518 3300025960 Bacteria 2532
377 Ga0207651_10221464 3300025960 Bacteria 1530
378 Ga0207651_10472482 3300025960 Bacteria 1079
379 Ga0207651_10597552 3300025960 Bacteria 964
380 Ga0207651_11206044 3300025960 Bacteria 679
381 Ga0207712_10093088 3300025961 Bacteria 2223
382 Ga0207712_10305486 3300025961 Bacteria 1307
383 Ga0207668_10062324 3300025972 Bacteria 2625
384 Ga0207668_10071084 3300025972 Bacteria 2484
385 Ga0207668_11022764 3300025972 Bacteria 739
386 Ga0207640_10055671 3300025981 Bacteria 2592
387 Ga0207640_11152593 3300025981 Bacteria 688
388 Ga0207658_10000812 3300025986 Bacteria 26147
389 Ga0207658_10004524 3300025986 Bacteria 9661
390 Ga0207658_10049839 3300025986 Bacteria 3079
391 Ga0207677_10004232 3300026023 Bacteria 7684
392 Ga0207677_10068217 3300026023 Bacteria 2495
393 Ga0207677_10911196 3300026023 Bacteria 793
394 Ga0207703_10000929 3300026035 Bacteria 28489
395 Ga0207703_10001541 3300026035 Bacteria 20913
396 Ga0207703_10499031 3300026035 Bacteria 1142
397 Ga0207639_11234313 3300026041 Bacteria 702
398 Ga0207678_10306318 3300026067 Bacteria 1366
399 Ga0207678_10372354 3300026067 Bacteria 1234
400 Ga0207708_10036575 3300026075 Bacteria 3738
401 Ga0207702_10603650 3300026078 Bacteria 1077
402 Ga0207641_10000655 3300026088 Bacteria 37743
403 Ga0207641_10002319 3300026088 Bacteria 17659
404 Ga0207641_10025895 3300026088 Bacteria 4838
405 Ga0207641_10031495 3300026088 Bacteria 4399
406 Ga0207641_10056214 3300026088 Bacteria 3343
407 Ga0207641_12096397 3300026088 Bacteria 566
408 Ga0207648_10006616 3300026089 Bacteria 11512
409 Ga0207648_10152456 3300026089 Bacteria 2040
410 Ga0207648_10360701 3300026089 Bacteria 1311
411 Ga0207648_10504353 3300026089 Bacteria 1107
412 Ga0207676_10002990 3300026095 Bacteria 12054
413 Ga0207676_10019288 3300026095 Bacteria 4972
414 Ga0207676_10027347 3300026095 Bacteria 4247
415 Ga0207676_10171790 3300026095 Bacteria 1889
416 Ga0207676_12420863 3300026095 Bacteria 522
417 Ga0207675_100007375 3300026118 Bacteria 10394
418 Ga0207675_100045418 3300026118 Bacteria 4104
419 Ga0207675_100315865 3300026118 Bacteria 1524
420 Ga0207683_10001877 3300026121 Bacteria 18588
421 Ga0207683_10015629 3300026121 Bacteria 6461
422 Ga0207683_10069474 3300026121 Bacteria 3111
423 Ga0207683_11011194 3300026121 Bacteria 772
424 Ga0207683_11170920 3300026121 Bacteria 713
425 Ga0207683_11309161 3300026121 Bacteria 671
426 Ga0207698_10047674 3300026142 Bacteria 3248
427 Ga0207698_10089408 3300026142 Bacteria 2515
428 Ga0207698_10145002 3300026142 Bacteria 2052
429 Ga0207698_10376817 3300026142 Bacteria 1349
430 Ga0207698_10992679 3300026142 Bacteria 850
431 Ga0207698_11040918 3300026142 Bacteria 830
432 Ga0207698_11209556 3300026142 Bacteria 770
433 Ga0207698_11306513 3300026142 Bacteria 740
434 Ga0207698_11503044 3300026142 Bacteria 689
435 Ga0207698_11635731 3300026142 Bacteria 659
436 Ga0207428_10551450 3300027907 Bacteria 834
437 Ga0268266_11334451 3300028379 Bacteria 693
438 Ga0268265_10031887 3300028380 Bacteria 3810
439 Ga0268265_10412897 3300028380 Bacteria 1251
440 Ga0268265_11064548 3300028380 Bacteria 801
441 Ga0268264_10037391 3300028381 Bacteria 4003
442 Ga0268264_10120333 3300028381 Bacteria 2313
443 Ga0268264_10456759 3300028381 Bacteria 1239
444 Ga0307515_10001727 3300028794 Bacteria 48647
445 Ga0307515_10048310 3300028794 Bacteria 6437
446 Ga0307515_10109047 3300028794 Bacteria 3256
447 Ga0307515_10202732 3300028794 Bacteria 1854
448 Ga0265328_10086600 3300031239 Bacteria 1156
449 Ga0265331_10014048 3300031250 Bacteria 4278
450 Ga0265327_10000083 3300031251 Bacteria 204923
451 Ga0307513_10080456 3300031456 Bacteria 3361
452 Ga0307509_10064051 3300031507 Bacteria 3869
453 Ga0307509_10308473 3300031507 Bacteria 1326
454 Ga0307408_100000038 3300031548 Bacteria 183170
455 Ga0307508_10000007 3300031616 Bacteria 268359
456 Ga0307514_10592980 3300031649 Bacteria 500
457 Ga0307405_10941600 3300031731 Bacteria 733
458 Ga0307406_11272098 3300031901 Bacteria 641
459 Ga0307409_101502760 3300031995 Bacteria 701
460 Ga0307414_10083480 3300032004 Bacteria 2346
461 Ga0307411_10000214 3300032005 Bacteria 18630
462 Ga0307507_10063800 3300033179 Bacteria 3406
463 Ga0373954_0042286 3300035118 Bacteria 2125
464 Ga0373956_0288236 3300035119 Bacteria 782
465 Ga0373943_0102141 3300035170 Bacteria 1501
466 Ga0373946_0083441 3300035171 Bacteria 1403
467 Ga0373935_0066476 3300035692 Bacteria 2316
468 Ga0373935_1371624 3300035692 Bacteria 528
469 Ga0373933_0292354 3300035724 Bacteria 1054
470 Ga0373947_0064625 3300035725 Bacteria 2231
471 Ga0373947_0181270 3300035725 Bacteria 1371
472 Ga0373937_0209133 3300036401 Bacteria 1835
473 Ga0373937_1254679 3300036401 Bacteria 689
474 Ga0373925_0014054 3300037068 Bacteria 5795
475 Ga0373925_0157549 3300037068 Bacteria 1787
476 Ga0373925_0423399 3300037068 Bacteria 1088
477 Ga0395905_0009740 3300037471 Bacteria 9373
478 Ga0436364_1404502 3300037853 Bacteria 746
479 Ga0451787_389700 3300041441 Bacteria 793
480 Ga0451789_0880985 3300041443 Bacteria 558
481 Ga0451793_1059538 3300041452 Bacteria 939
482 Ga0451807_0710180 3300041486 Bacteria 769
483 Ga0451855_0667034 3300041511 Bacteria 682
484 Ga0451853_3133088 3300041512 Bacteria 529
485 Ga0451853_3248874 3300041512 Bacteria 1345
486 Ga0439437_001347 3300042000 Bacteria 2585
487 Ga0450911_030681 3300042115 Bacteria 697
488 Ga0450917_006046 3300042120 Bacteria 907
489 Ga0450888_004032 3300042126 Bacteria 1516
490 Ga0450890_001516 3300042127 Bacteria 3337
491 Ga0450891_001423 3300042129 Bacteria 2477
492 Ga0450898_002950 3300042134 Bacteria 2402
493 Ga0450899_004088 3300042135 Bacteria 1562
494 Ga0450889_000335 3300042144 Bacteria 5261
495 Ga0439464_0298218 3300042439 Bacteria 526
496 Ga0450893_0004301 3300042532 Bacteria 2268
497 Ga0453684_0000457 3300044712 Bacteria 163653
498 Ga0453684_0369757 3300044712 Bacteria 1612
499 Ga0451576_0041466 3300045051 Bacteria 4866
500 Ga0451576_0162344 3300045051 Bacteria 2332
501 Ga0451576_0538876 3300045051 Bacteria 1226
502 Ga0495603_0119726 3300046455 Bacteria 1535
503 Ga0495629_0073241 3300046459 Bacteria 2392
504 Ga0495610_0137328 3300046512 Bacteria 1055
505 Ga0495632_0135578 3300046519 Bacteria 1144
506 Ga0495652_0496674 3300046529 Bacteria 847
507 Ga0495654_0192099 3300046530 Bacteria 879
508 Ga0495640_0285497 3300046533 Bacteria 1027
509 Ga0495586_0642876 3300046535 Bacteria 613
510 Ga0495598_0012869 3300046537 Bacteria 2064
511 Ga0495598_0065563 3300046537 Bacteria 1131
512 Ga0495621_0070645 3300046539 Bacteria 1285
513 Ga0495597_0406942 3300046542 Bacteria 517
514 Ga0495645_0269720 3300046543 Bacteria 1123
515 Ga0495635_0380548 3300046663 Bacteria 939
516 Ga0495657_0415908 3300046675 Bacteria 790
517 Ga0495647_0101331 3300046681 Bacteria 1193
518 Ga0495647_0357977 3300046681 Bacteria 665
519 Ga0495658_0009768 3300046683 Bacteria 4784
520 Ga0495658_0201011 3300046683 Bacteria 1242
521 Ga0495658_0800538 3300046683 Bacteria 603
522 Ga0495670_0140677 3300046691 Bacteria 1262
523 Ga0495604_0271411 3300047317 Bacteria 1149
524 Ga0495674_0448332 3300047319 Bacteria 1037
525 Ga0495680_0104749 3300047322 Bacteria 2104
526 Ga0495684_0121875 3300047471 Bacteria 1963
527 Ga0495684_0201239 3300047471 Bacteria 1468
528 Ga0495614_0317897 3300048089 Bacteria 722
529 Ga0496100_0068446 3300048903 Bacteria 2361
530 Ga0496100_0850821 3300048903 Bacteria 715
531 Ga0496101_0899322 3300048904 Bacteria 697
532 Ga0496102_0015200 3300048905 Bacteria 6700
533 Ga0496104_0335229 3300048907 Bacteria 1425
534 Ga0496104_0827018 3300048907 Bacteria 832
535 Ga0496104_1355760 3300048907 Bacteria 614
536 Ga0496105_0013657 3300048908 Bacteria 6448
537 Ga0496106_0023114 3300048909 Bacteria 4618
538 Ga0496106_0618865 3300048909 Bacteria 867
539 Ga0496108_0059595 3300048911 Bacteria 3210
540 Ga0496109_0153025 3300048912 Bacteria 2160
541 Ga0496110_0480413 3300048913 Bacteria 1132
542 Ga0496110_0630431 3300048913 Bacteria 971
543 Ga0496110_1672943 3300048913 Bacteria 546
544 Ga0496111_0519474 3300048914 Bacteria 876
545 Ga0496113_0189643 3300048916 Bacteria 1632
546 Ga0496114_0076201 3300048917 Bacteria 2826
547 Ga0496114_0405377 3300048917 Bacteria 1207
548 Ga0496114_0745451 3300048917 Bacteria 856
549 Ga0496115_0559583 3300048918 Bacteria 913
550 Ga0496124_0099099 3300048927 Bacteria 2364
551 Ga0501291_088598 3300049514 Bacteria 628
552 Ga0501300_001957 3300049523 Bacteria 3084
553 Ga0501222_005305 3300049662 Bacteria 1742
554 Ga0501227_014844 3300049665 Bacteria 1735
555 Ga0501233_022443 3300049668 Bacteria 1363
556 Ga0501235_001655 3300049669 Bacteria 4775
557 Ga0501239_011591 3300049672 Bacteria 987
558 Ga0501249_003607 3300049679 Bacteria 3116
559 Ga0501258_005143 3300049687 Bacteria 1261
560 Ga0501225_0025179 3300049705 Bacteria 1638
561 Ga0501229_011018 3300049706 Bacteria 1144
562 Ga0501229_030280 3300049706 Bacteria 740
563 Ga0501232_038265 3300049757 Bacteria 697
564 Ga0501262_004944 3300049759 Bacteria 1562
565 Ga0501265_001805 3300049762 Bacteria 2431
566 Ga0501266_021295 3300049763 Bacteria 886
567 Ga0501267_000352 3300049764 Bacteria 3446
568 Ga0501269_008000 3300049766 Bacteria 1278
569 Ga0501271_011340 3300049768 Bacteria 952
570 nmdc:mga03n38_42821_c1 3300050490 Bacteria 1981
571 nmdc:mga0k408_134788_c1 3300050493 Bacteria 1467
572 nmdc:mga0k408_145750_c1 3300050493 Bacteria 1410
573 nmdc:mga0k408_187724_c1 3300050493 Bacteria 1233
574 nmdc:mga0k408_29930_c1 3300050493 Bacteria 3102
575 nmdc:mga0k408_5050_c1 3300050493 Bacteria 6988
576 nmdc:mga0k408_77120_c1 3300050493 Bacteria 1949
577 nmdc:mga07m45_52252_c1 3300050496 Bacteria 2307
578 nmdc:mga08y16_495743_c1 3300050511 Bacteria 1241
579 Ga0495601_0015412 3300053077 Bacteria 4620
580 Ga0495601_0212289 3300053077 Bacteria 1264
581 Ga0495595_0117964 3300053084 Bacteria 1291
582 Ga0495595_0192342 3300053084 Bacteria 1014
583 Ga0495619_0084993 3300053085 Bacteria 2136
584 Ga0495619_0763871 3300053085 Bacteria 655
585 Ga0500593_067582 3300053117 Bacteria 1557
586 Ga0500597_140729 3300053120 Bacteria 1040
587 Ga0500559_0544655 3300053136 Bacteria 530
588 Ga0500590_003574 3300053148 Bacteria 7197
589 Ga0500620_178222 3300053155 Bacteria 733
590 Ga0500587_002259 3300053739 Bacteria 2746

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0423399 Ga0373925_0423399_481_1005 112
2 3300047317 Ga0495604_0271411 Ga0495604_0271411_38_559 112
3 3300005547 Ga0070693_100957826 Ga0070693_1009578261 114
4 3300044712 Ga0453684_0369757 Ga0453684_0369757_1048_1404 115
5 3300045051 Ga0451576_0162344 Ga0451576_0162344_417_773 115
6 3300005842 Ga0068858_100425474 Ga0068858_1004254741 116
7 3300005843 Ga0068860_100143651 Ga0068860_1001436512 116
8 3300005844 Ga0068862_100007774 Ga0068862_1000077749 116
9 3300006177 Ga0075362_10547334 Ga0075362_105473341 116
10 3300006178 Ga0075367_10010079 Ga0075367_100100793 116
11 3300006195 Ga0075366_10060820 Ga0075366_100608203 116
12 3300009177 Ga0105248_11118411 Ga0105248_111184112 116
13 3300009553 Ga0105249_10533196 Ga0105249_105331963 116
14 3300014325 Ga0163163_10000532 Ga0163163_100005327 116
15 3300014326 Ga0157380_11473815 Ga0157380_114738152 116
16 3300025986 Ga0207658_10049839 Ga0207658_100498392 116
17 3300026035 Ga0207703_10499031 Ga0207703_104990312 116
18 3300026088 Ga0207641_10025895 Ga0207641_100258954 116
19 3300026142 Ga0207698_10376817 Ga0207698_103768172 116
20 3300028381 Ga0268264_10456759 Ga0268264_104567592 116
21 3300028794 Ga0307515_10001727 Ga0307515_1000172718 116
22 3300031507 Ga0307509_10064051 Ga0307509_100640514 116
23 3300031616 Ga0307508_10000007 Ga0307508_10000007185 116
24 3300031649 Ga0307514_10592980 Ga0307514_105929801 116
25 3300031731 Ga0307405_10941600 Ga0307405_109416002 116
26 3300031901 Ga0307406_11272098 Ga0307406_112720982 116
27 3300031995 Ga0307409_101502760 Ga0307409_1015027601 116
28 3300033179 Ga0307507_10063800 Ga0307507_100638004 116
29 3300035692 Ga0373935_1371624 Ga0373935_1371624_117_503 116
30 3300037471 Ga0395905_0009740 Ga0395905_0009740_4152_4511 116
31 3300042134 Ga0450898_002950 Ga0450898_002950_997_1356 116
32 3300042135 Ga0450899_004088 Ga0450899_004088_752_1111 116
33 3300042439 Ga0439464_0298218 Ga0439464_0298218_60_419 116
34 3300044712 Ga0453684_0000457 Ga0453684_0000457_101348_101713 116
35 3300048903 Ga0496100_0068446 Ga0496100_0068446_1311_1697 116
36 3300048909 Ga0496106_0023114 Ga0496106_0023114_3426_3812 116
37 3300050493 nmdc:mga0k408_29930_c1 nmdc:mga0k408_29930_c1_2329_2688 116
38 3300002773 JGI25152J39213_1001665 JGI25152J39213_10016652 117
39 3300002774 JGI25150J39212_1026233 JGI25150J39212_10262332 117
40 3300003215 JGI25153J46596_10007026 JGI25153J46596_100070263 117
41 3300003322 rootL2_10071287 rootL2_100712873 117
42 3300003771 Ga0055526_1006007 Ga0055526_10060079 117
43 3300003771 Ga0055526_1010196 Ga0055526_10101961 117
44 3300003790 Ga0055528_1073289 Ga0055528_10732892 117
45 3300004625 Ga0055543_1003721 Ga0055543_10037212 117
46 3300005262 Ga0065165_1000151 Ga0065165_100015172 117
47 3300005262 Ga0065165_1000166 Ga0065165_10001667 117
48 3300005262 Ga0065165_1003633 Ga0065165_10036333 117
49 3300005327 Ga0070658_10452234 Ga0070658_104522341 117
50 3300005327 Ga0070658_10494048 Ga0070658_104940482 117
51 3300005328 Ga0070676_10241457 Ga0070676_102414572 117
52 3300005328 Ga0070676_10471206 Ga0070676_104712061 117
53 3300005331 Ga0070670_100020576 Ga0070670_1000205764 117
54 3300005331 Ga0070670_100087630 Ga0070670_1000876302 117
55 3300005331 Ga0070670_100163454 Ga0070670_1001634542 117
56 3300005331 Ga0070670_100492426 Ga0070670_1004924262 117
57 3300005333 Ga0070677_10007318 Ga0070677_100073186 117
58 3300005333 Ga0070677_10036866 Ga0070677_100368662 117
59 3300005333 Ga0070677_10171988 Ga0070677_101719881 117
60 3300005334 Ga0068869_100008578 Ga0068869_1000085789 117
61 3300005334 Ga0068869_100009021 Ga0068869_1000090219 117
62 3300005334 Ga0068869_100489138 Ga0068869_1004891381 117
63 3300005335 Ga0070666_10008568 Ga0070666_100085682 117
64 3300005335 Ga0070666_10042193 Ga0070666_100421932 117
65 3300005335 Ga0070666_10549998 Ga0070666_105499982 117
66 3300005335 Ga0070666_11313381 Ga0070666_113133811 117
67 3300005338 Ga0068868_100016008 Ga0068868_1000160086 117
68 3300005338 Ga0068868_100088171 Ga0068868_1000881712 117
69 3300005338 Ga0068868_100329161 Ga0068868_1003291612 117
70 3300005338 Ga0068868_100573405 Ga0068868_1005734052 117
71 3300005338 Ga0068868_101182042 Ga0068868_1011820422 117
72 3300005339 Ga0070660_100323247 Ga0070660_1003232473 117
73 3300005340 Ga0070689_100005848 Ga0070689_1000058488 117
74 3300005340 Ga0070689_100117669 Ga0070689_1001176693 117
75 3300005343 Ga0070687_100027854 Ga0070687_1000278542 117
76 3300005343 Ga0070687_100045233 Ga0070687_1000452332 117
77 3300005344 Ga0070661_100061882 Ga0070661_1000618823 117
78 3300005344 Ga0070661_100074410 Ga0070661_1000744104 117
79 3300005344 Ga0070661_100201255 Ga0070661_1002012552 117
80 3300005344 Ga0070661_101195980 Ga0070661_1011959802 117
81 3300005347 Ga0070668_100007130 Ga0070668_1000071309 117
82 3300005347 Ga0070668_100556649 Ga0070668_1005566492 117
83 3300005353 Ga0070669_100001340 Ga0070669_10000134013 117
84 3300005353 Ga0070669_100298297 Ga0070669_1002982971 117
85 3300005354 Ga0070675_100014979 Ga0070675_1000149796 117
86 3300005354 Ga0070675_100024515 Ga0070675_1000245153 117
87 3300005354 Ga0070675_100079931 Ga0070675_1000799313 117
88 3300005354 Ga0070675_100116471 Ga0070675_1001164713 117
89 3300005354 Ga0070675_100176442 Ga0070675_1001764422 117
90 3300005355 Ga0070671_100009693 Ga0070671_1000096933 117
91 3300005355 Ga0070671_100066889 Ga0070671_1000668894 117
92 3300005355 Ga0070671_100099617 Ga0070671_1000996174 117
93 3300005355 Ga0070671_100313041 Ga0070671_1003130412 117
94 3300005355 Ga0070671_100406523 Ga0070671_1004065232 117
95 3300005355 Ga0070671_100711509 Ga0070671_1007115091 117
96 3300005356 Ga0070674_100013491 Ga0070674_1000134912 117
97 3300005356 Ga0070674_100134822 Ga0070674_1001348222 117
98 3300005356 Ga0070674_100272725 Ga0070674_1002727252 117
99 3300005356 Ga0070674_100448932 Ga0070674_1004489322 117
100 3300005356 Ga0070674_101137331 Ga0070674_1011373311 117
101 3300005364 Ga0070673_100000512 Ga0070673_10000051216 117
102 3300005364 Ga0070673_100007311 Ga0070673_1000073114 117
103 3300005364 Ga0070673_100026611 Ga0070673_1000266114 117
104 3300005364 Ga0070673_100113770 Ga0070673_1001137703 117
105 3300005364 Ga0070673_100115213 Ga0070673_1001152133 117
106 3300005364 Ga0070673_100586547 Ga0070673_1005865472 117
107 3300005364 Ga0070673_100848584 Ga0070673_1008485841 117
108 3300005365 Ga0070688_100024768 Ga0070688_1000247682 117
109 3300005365 Ga0070688_101045358 Ga0070688_1010453581 117
110 3300005366 Ga0070659_100352647 Ga0070659_1003526472 117
111 3300005367 Ga0070667_100001703 Ga0070667_1000017038 117
112 3300005367 Ga0070667_100004388 Ga0070667_1000043883 117
113 3300005367 Ga0070667_100006263 Ga0070667_10000626312 117
114 3300005367 Ga0070667_100321402 Ga0070667_1003214022 117
115 3300005367 Ga0070667_100456592 Ga0070667_1004565922 117
116 3300005438 Ga0070701_10093410 Ga0070701_100934103 117
117 3300005438 Ga0070701_10367515 Ga0070701_103675152 117
118 3300005445 Ga0070708_101509850 Ga0070708_1015098502 117
119 3300005455 Ga0070663_101094223 Ga0070663_1010942232 117
120 3300005456 Ga0070678_100004036 Ga0070678_1000040364 117
121 3300005456 Ga0070678_100010301 Ga0070678_1000103015 117
122 3300005456 Ga0070678_100197655 Ga0070678_1001976552 117
123 3300005456 Ga0070678_100494027 Ga0070678_1004940272 117
124 3300005456 Ga0070678_100684634 Ga0070678_1006846342 117
125 3300005456 Ga0070678_100719893 Ga0070678_1007198932 117
126 3300005456 Ga0070678_100900932 Ga0070678_1009009322 117
127 3300005457 Ga0070662_100008433 Ga0070662_1000084339 117
128 3300005457 Ga0070662_100134873 Ga0070662_1001348733 117
129 3300005457 Ga0070662_100411919 Ga0070662_1004119192 117
130 3300005457 Ga0070662_101233076 Ga0070662_1012330762 117
131 3300005457 Ga0070662_101672335 Ga0070662_1016723351 117
132 3300005459 Ga0068867_100011339 Ga0068867_1000113399 117
133 3300005459 Ga0068867_100015106 Ga0068867_1000151063 117
134 3300005459 Ga0068867_100792975 Ga0068867_1007929751 117
135 3300005459 Ga0068867_101724872 Ga0068867_1017248721 117
136 3300005466 Ga0070685_10191425 Ga0070685_101914251 117
137 3300005466 Ga0070685_10828728 Ga0070685_108287282 117
138 3300005467 Ga0070706_100073795 Ga0070706_1000737953 117
139 3300005535 Ga0070684_101042671 Ga0070684_1010426711 117
140 3300005539 Ga0068853_101496454 Ga0068853_1014964542 117
141 3300005543 Ga0070672_100002366 Ga0070672_1000023666 117
142 3300005543 Ga0070672_100056785 Ga0070672_1000567852 117
143 3300005543 Ga0070672_100119912 Ga0070672_1001199121 117
144 3300005543 Ga0070672_100187342 Ga0070672_1001873423 117
145 3300005543 Ga0070672_100264018 Ga0070672_1002640182 117
146 3300005543 Ga0070672_100750413 Ga0070672_1007504132 117
147 3300005544 Ga0070686_100038385 Ga0070686_1000383852 117
148 3300005544 Ga0070686_100114604 Ga0070686_1001146042 117
149 3300005547 Ga0070693_100229928 Ga0070693_1002299282 117
150 3300005547 Ga0070693_100738002 Ga0070693_1007380022 117
151 3300005548 Ga0070665_101470701 Ga0070665_1014707012 117
152 3300005563 Ga0068855_101531396 Ga0068855_1015313961 117
153 3300005564 Ga0070664_100102998 Ga0070664_1001029982 117
154 3300005564 Ga0070664_100592439 Ga0070664_1005924392 117
155 3300005564 Ga0070664_100928461 Ga0070664_1009284612 117
156 3300005564 Ga0070664_100998784 Ga0070664_1009987841 117
157 3300005564 Ga0070664_101665317 Ga0070664_1016653172 117
158 3300005577 Ga0068857_100124261 Ga0068857_1001242611 117
159 3300005578 Ga0068854_100014237 Ga0068854_1000142374 117
160 3300005578 Ga0068854_100411192 Ga0068854_1004111922 117
161 3300005578 Ga0068854_100648290 Ga0068854_1006482902 117
162 3300005578 Ga0068854_101999974 Ga0068854_1019999742 117
163 3300005615 Ga0070702_100402597 Ga0070702_1004025972 117
164 3300005616 Ga0068852_100009488 Ga0068852_1000094884 117
165 3300005616 Ga0068852_100064088 Ga0068852_1000640883 117
166 3300005616 Ga0068852_100269320 Ga0068852_1002693202 117
167 3300005616 Ga0068852_100394861 Ga0068852_1003948613 117
168 3300005616 Ga0068852_100684070 Ga0068852_1006840702 117
169 3300005616 Ga0068852_100935289 Ga0068852_1009352892 117
170 3300005617 Ga0068859_100032866 Ga0068859_1000328662 117
171 3300005617 Ga0068859_100790279 Ga0068859_1007902793 117
172 3300005618 Ga0068864_100009050 Ga0068864_1000090506 117
173 3300005618 Ga0068864_100015458 Ga0068864_1000154584 117
174 3300005618 Ga0068864_100016929 Ga0068864_1000169293 117
175 3300005618 Ga0068864_100055318 Ga0068864_1000553183 117
176 3300005618 Ga0068864_100401503 Ga0068864_1004015032 117
177 3300005618 Ga0068864_100945142 Ga0068864_1009451422 117
178 3300005718 Ga0068866_10004159 Ga0068866_100041596 117
179 3300005718 Ga0068866_10080870 Ga0068866_100808702 117
180 3300005718 Ga0068866_10112833 Ga0068866_101128332 117
181 3300005718 Ga0068866_10873095 Ga0068866_108730951 117
182 3300005718 Ga0068866_11005305 Ga0068866_110053052 117
183 3300005719 Ga0068861_100016694 Ga0068861_1000166943 117
184 3300005719 Ga0068861_100055084 Ga0068861_1000550844 117
185 3300005719 Ga0068861_100170880 Ga0068861_1001708802 117
186 3300005719 Ga0068861_100844326 Ga0068861_1008443262 117
187 3300005834 Ga0068851_10003950 Ga0068851_100039503 117
188 3300005834 Ga0068851_10012597 Ga0068851_100125972 117
189 3300005834 Ga0068851_10074372 Ga0068851_100743722 117
190 3300005834 Ga0068851_10398179 Ga0068851_103981792 117
191 3300005834 Ga0068851_10420542 Ga0068851_104205422 117
192 3300005834 Ga0068851_10457232 Ga0068851_104572322 117
193 3300005840 Ga0068870_10300549 Ga0068870_103005492 117
194 3300005841 Ga0068863_100000585 Ga0068863_10000058527 117
195 3300005841 Ga0068863_100030558 Ga0068863_1000305586 117
196 3300005841 Ga0068863_100084167 Ga0068863_1000841674 117
197 3300005842 Ga0068858_100003791 Ga0068858_1000037914 117
198 3300005842 Ga0068858_100004338 Ga0068858_1000043383 117
199 3300005842 Ga0068858_100040761 Ga0068858_1000407613 117
200 3300005843 Ga0068860_100009426 Ga0068860_1000094263 117
201 3300005843 Ga0068860_100739390 Ga0068860_1007393902 117
202 3300005844 Ga0068862_100017376 Ga0068862_1000173762 117
203 3300005844 Ga0068862_100092044 Ga0068862_1000920442 117
204 3300005844 Ga0068862_100237248 Ga0068862_1002372483 117
205 3300006048 Ga0075363_100046109 Ga0075363_1000461092 117
206 3300006048 Ga0075363_100092249 Ga0075363_1000922493 117
207 3300006048 Ga0075363_100135254 Ga0075363_1001352542 117
208 3300006051 Ga0075364_11106488 Ga0075364_111064882 117
209 3300006058 Ga0075432_10119778 Ga0075432_101197782 117
210 3300006163 Ga0070715_10060047 Ga0070715_100600472 117
211 3300006177 Ga0075362_10149782 Ga0075362_101497823 117
212 3300006177 Ga0075362_10286403 Ga0075362_102864032 117
213 3300006178 Ga0075367_10072398 Ga0075367_100723982 117
214 3300006178 Ga0075367_10476319 Ga0075367_104763192 117
215 3300006178 Ga0075367_10792718 Ga0075367_107927182 117
216 3300006186 Ga0075369_10082140 Ga0075369_100821401 117
217 3300006195 Ga0075366_10004561 Ga0075366_1000456110 117
218 3300006195 Ga0075366_10041399 Ga0075366_100413993 117
219 3300006195 Ga0075366_10074317 Ga0075366_100743172 117
220 3300006195 Ga0075366_10095318 Ga0075366_100953183 117
221 3300006195 Ga0075366_10111637 Ga0075366_101116372 117
222 3300006195 Ga0075366_10212218 Ga0075366_102122182 117
223 3300006195 Ga0075366_10262354 Ga0075366_102623542 117
224 3300006195 Ga0075366_10269222 Ga0075366_102692222 117
225 3300006195 Ga0075366_10288838 Ga0075366_102888382 117
226 3300006195 Ga0075366_10302268 Ga0075366_103022682 117
227 3300006195 Ga0075366_10335030 Ga0075366_103350302 117
228 3300006195 Ga0075366_10670885 Ga0075366_106708852 117
229 3300006237 Ga0097621_100029626 Ga0097621_1000296263 117
230 3300006237 Ga0097621_100046754 Ga0097621_1000467546 117
231 3300006237 Ga0097621_100070577 Ga0097621_1000705773 117
232 3300006237 Ga0097621_100103028 Ga0097621_1001030283 117
233 3300006237 Ga0097621_100275565 Ga0097621_1002755652 117
234 3300006237 Ga0097621_100397941 Ga0097621_1003979412 117
235 3300006237 Ga0097621_100908038 Ga0097621_1009080382 117
236 3300006353 Ga0075370_10000538 Ga0075370_100005387 117
237 3300006353 Ga0075370_10004004 Ga0075370_100040049 117
238 3300006353 Ga0075370_10007898 Ga0075370_100078984 117
239 3300006353 Ga0075370_10057411 Ga0075370_100574113 117
240 3300006353 Ga0075370_10087471 Ga0075370_100874713 117
241 3300006353 Ga0075370_10100191 Ga0075370_101001913 117
242 3300006353 Ga0075370_10155526 Ga0075370_101555262 117
243 3300006353 Ga0075370_10570672 Ga0075370_105706722 117
244 3300006353 Ga0075370_10616875 Ga0075370_106168752 117
245 3300006358 Ga0068871_100101626 Ga0068871_1001016263 117
246 3300006358 Ga0068871_100165350 Ga0068871_1001653503 117
247 3300006358 Ga0068871_100184978 Ga0068871_1001849782 117
248 3300006358 Ga0068871_100255127 Ga0068871_1002551272 117
249 3300006358 Ga0068871_100478652 Ga0068871_1004786522 117
250 3300006358 Ga0068871_100736002 Ga0068871_1007360021 117
251 3300006881 Ga0068865_100095849 Ga0068865_1000958493 117
252 3300006881 Ga0068865_100440218 Ga0068865_1004402182 117
253 3300006881 Ga0068865_100608154 Ga0068865_1006081542 117
254 3300006931 Ga0097620_100032866 Ga0097620_1000328662 117
255 3300006931 Ga0097620_100790373 Ga0097620_1007903733 117
256 3300006931 Ga0097620_101672697 Ga0097620_1016726972 117
257 3300006946 Ga0079104_1066484 Ga0079104_10664841 117
258 3300009094 Ga0111539_12071301 Ga0111539_120713012 117
259 3300009148 Ga0105243_10089500 Ga0105243_100895003 117
260 3300009148 Ga0105243_10350273 Ga0105243_103502732 117
261 3300009148 Ga0105243_10464194 Ga0105243_104641942 117
262 3300009148 Ga0105243_10488986 Ga0105243_104889862 117
263 3300009174 Ga0105241_12092215 Ga0105241_120922151 117
264 3300009176 Ga0105242_10051786 Ga0105242_100517862 117
265 3300009176 Ga0105242_10373544 Ga0105242_103735442 117
266 3300009177 Ga0105248_10069620 Ga0105248_100696202 117
267 3300009177 Ga0105248_10072235 Ga0105248_100722355 117
268 3300009177 Ga0105248_10155186 Ga0105248_101551863 117
269 3300009177 Ga0105248_10193938 Ga0105248_101939382 117
270 3300009177 Ga0105248_10216600 Ga0105248_102166002 117
271 3300009177 Ga0105248_10665881 Ga0105248_106658812 117
272 3300009177 Ga0105248_11211900 Ga0105248_112119002 117
273 3300009177 Ga0105248_11686089 Ga0105248_116860892 117
274 3300009545 Ga0105237_10910577 Ga0105237_109105771 117
275 3300009551 Ga0105238_10380034 Ga0105238_103800342 117
276 3300009551 Ga0105238_10425409 Ga0105238_104254092 117
277 3300009553 Ga0105249_10029308 Ga0105249_100293086 117
278 3300009553 Ga0105249_10048014 Ga0105249_100480143 117
279 3300009553 Ga0105249_10087076 Ga0105249_100870764 117
280 3300009553 Ga0105249_11053954 Ga0105249_110539542 117
281 3300010375 Ga0105239_12035610 Ga0105239_120356102 117
282 3300012512 Ga0157327_1080636 Ga0157327_10806361 117
283 3300012513 Ga0157326_1038424 Ga0157326_10384242 117
284 3300013102 Ga0157371_10740009 Ga0157371_107400091 117
285 3300013104 Ga0157370_10165329 Ga0157370_101653293 117
286 3300013105 Ga0157369_10752850 Ga0157369_107528502 117
287 3300013105 Ga0157369_11157387 Ga0157369_111573872 117
288 3300013105 Ga0157369_11468877 Ga0157369_114688772 117
289 3300013296 Ga0157374_10359752 Ga0157374_103597523 117
290 3300013296 Ga0157374_10372251 Ga0157374_103722512 117
291 3300013306 Ga0163162_10004424 Ga0163162_100044247 117
292 3300013306 Ga0163162_10116464 Ga0163162_101164643 117
293 3300013306 Ga0163162_10177994 Ga0163162_101779943 117
294 3300013306 Ga0163162_10291800 Ga0163162_102918002 117
295 3300013307 Ga0157372_10433592 Ga0157372_104335922 117
296 3300013308 Ga0157375_10006387 Ga0157375_1000638713 117
297 3300013308 Ga0157375_10059937 Ga0157375_100599374 117
298 3300013308 Ga0157375_10138513 Ga0157375_101385134 117
299 3300013308 Ga0157375_10451488 Ga0157375_104514883 117
300 3300014325 Ga0163163_10010179 Ga0163163_100101796 117
301 3300014325 Ga0163163_10685778 Ga0163163_106857782 117
302 3300014325 Ga0163163_11529212 Ga0163163_115292122 117
303 3300014325 Ga0163163_12956102 Ga0163163_129561021 117
304 3300014326 Ga0157380_10012973 Ga0157380_100129737 117
305 3300014326 Ga0157380_10130474 Ga0157380_101304743 117
306 3300014326 Ga0157380_12989077 Ga0157380_129890772 117
307 3300014745 Ga0157377_10031570 Ga0157377_100315703 117
308 3300014745 Ga0157377_10348261 Ga0157377_103482612 117
309 3300014968 Ga0157379_10004462 Ga0157379_100044628 117
310 3300014968 Ga0157379_10024218 Ga0157379_100242186 117
311 3300014968 Ga0157379_10043320 Ga0157379_100433205 117
312 3300014968 Ga0157379_10060086 Ga0157379_100600863 117
313 3300014969 Ga0157376_10433621 Ga0157376_104336212 117
314 3300014969 Ga0157376_10868048 Ga0157376_108680482 117
315 3300014969 Ga0157376_10985308 Ga0157376_109853082 117
316 3300014969 Ga0157376_11077411 Ga0157376_110774112 117
317 3300017792 Ga0163161_10031951 Ga0163161_100319515 117
318 3300017792 Ga0163161_10213343 Ga0163161_102133432 117
319 3300017792 Ga0163161_10451125 Ga0163161_104511252 117
320 3300017792 Ga0163161_10480496 Ga0163161_104804962 117
321 3300025226 Ga0209674_111433 Ga0209674_1114331 117
322 3300025230 Ga0209563_100005 Ga0209563_1000051101 117
323 3300025315 Ga0207697_10049074 Ga0207697_100490742 117
324 3300025315 Ga0207697_10229534 Ga0207697_102295342 117
325 3300025315 Ga0207697_10537176 Ga0207697_105371761 117
326 3300025321 Ga0207656_10042257 Ga0207656_100422572 117
327 3300025321 Ga0207656_10053522 Ga0207656_100535223 117
328 3300025321 Ga0207656_10096025 Ga0207656_100960252 117
329 3300025321 Ga0207656_10249475 Ga0207656_102494752 117
330 3300025893 Ga0207682_10007636 Ga0207682_100076363 117
331 3300025893 Ga0207682_10043178 Ga0207682_100431782 117
332 3300025893 Ga0207682_10054709 Ga0207682_100547092 117
333 3300025893 Ga0207682_10109308 Ga0207682_101093082 117
334 3300025893 Ga0207682_10117515 Ga0207682_101175152 117
335 3300025899 Ga0207642_10002689 Ga0207642_100026896 117
336 3300025899 Ga0207642_10064618 Ga0207642_100646183 117
337 3300025901 Ga0207688_10031184 Ga0207688_100311843 117
338 3300025903 Ga0207680_10028222 Ga0207680_100282222 117
339 3300025903 Ga0207680_10093891 Ga0207680_100938911 117
340 3300025905 Ga0207685_10080552 Ga0207685_100805523 117
341 3300025907 Ga0207645_10031798 Ga0207645_100317985 117
342 3300025907 Ga0207645_10050248 Ga0207645_100502483 117
343 3300025908 Ga0207643_10084941 Ga0207643_100849413 117
344 3300025909 Ga0207705_10107497 Ga0207705_101074973 117
345 3300025910 Ga0207684_10120209 Ga0207684_101202092 117
346 3300025918 Ga0207662_10007292 Ga0207662_100072928 117
347 3300025919 Ga0207657_10381695 Ga0207657_103816952 117
348 3300025923 Ga0207681_10052619 Ga0207681_100526193 117
349 3300025923 Ga0207681_10110128 Ga0207681_101101282 117
350 3300025925 Ga0207650_10018537 Ga0207650_100185377 117
351 3300025925 Ga0207650_10048417 Ga0207650_100484173 117
352 3300025925 Ga0207650_10102743 Ga0207650_101027432 117
353 3300025925 Ga0207650_10395047 Ga0207650_103950472 117
354 3300025925 Ga0207650_10734134 Ga0207650_107341341 117
355 3300025926 Ga0207659_10000313 Ga0207659_1000031312 117
356 3300025926 Ga0207659_10050735 Ga0207659_100507352 117
357 3300025931 Ga0207644_10000517 Ga0207644_1000051720 117
358 3300025931 Ga0207644_10005549 Ga0207644_1000554910 117
359 3300025931 Ga0207644_10072230 Ga0207644_100722304 117
360 3300025931 Ga0207644_10288833 Ga0207644_102888332 117
361 3300025931 Ga0207644_10312811 Ga0207644_103128112 117
362 3300025931 Ga0207644_10597305 Ga0207644_105973052 117
363 3300025932 Ga0207690_10321926 Ga0207690_103219262 117
364 3300025933 Ga0207706_10015438 Ga0207706_100154382 117
365 3300025933 Ga0207706_10085101 Ga0207706_100851013 117
366 3300025933 Ga0207706_10608999 Ga0207706_106089992 117
367 3300025933 Ga0207706_10812396 Ga0207706_108123962 117
368 3300025934 Ga0207686_11009943 Ga0207686_110099432 117
369 3300025934 Ga0207686_11051381 Ga0207686_110513812 117
370 3300025934 Ga0207686_11083159 Ga0207686_110831592 117
371 3300025935 Ga0207709_10032906 Ga0207709_100329064 117
372 3300025935 Ga0207709_10041491 Ga0207709_100414913 117
373 3300025935 Ga0207709_10562207 Ga0207709_105622072 117
374 3300025936 Ga0207670_10005218 Ga0207670_100052188 117
375 3300025937 Ga0207669_10169264 Ga0207669_101692642 117
376 3300025937 Ga0207669_10314964 Ga0207669_103149643 117
377 3300025937 Ga0207669_10433406 Ga0207669_104334062 117
378 3300025937 Ga0207669_10636984 Ga0207669_106369842 117
379 3300025937 Ga0207669_11623041 Ga0207669_116230412 117
380 3300025938 Ga0207704_10033101 Ga0207704_100331012 117
381 3300025938 Ga0207704_10452945 Ga0207704_104529452 117
382 3300025938 Ga0207704_10582727 Ga0207704_105827272 117
383 3300025939 Ga0207665_10130042 Ga0207665_101300423 117
384 3300025939 Ga0207665_11244255 Ga0207665_112442551 117
385 3300025940 Ga0207691_10022088 Ga0207691_100220885 117
386 3300025940 Ga0207691_10033898 Ga0207691_100338983 117
387 3300025940 Ga0207691_10054876 Ga0207691_100548764 117
388 3300025940 Ga0207691_10114412 Ga0207691_101144123 117
389 3300025940 Ga0207691_10133529 Ga0207691_101335292 117
390 3300025940 Ga0207691_10150234 Ga0207691_101502343 117
391 3300025940 Ga0207691_10246845 Ga0207691_102468453 117
392 3300025941 Ga0207711_10003170 Ga0207711_1000317013 117
393 3300025941 Ga0207711_10072292 Ga0207711_100722922 117
394 3300025941 Ga0207711_10367832 Ga0207711_103678322 117
395 3300025941 Ga0207711_10646067 Ga0207711_106460672 117
396 3300025942 Ga0207689_10013647 Ga0207689_100136479 117
397 3300025942 Ga0207689_10021025 Ga0207689_100210256 117
398 3300025942 Ga0207689_10602763 Ga0207689_106027632 117
399 3300025945 Ga0207679_10139117 Ga0207679_101391173 117
400 3300025945 Ga0207679_10544922 Ga0207679_105449222 117
401 3300025945 Ga0207679_10592968 Ga0207679_105929682 117
402 3300025960 Ga0207651_10066518 Ga0207651_100665183 117
403 3300025960 Ga0207651_10221464 Ga0207651_102214642 117
404 3300025960 Ga0207651_10472482 Ga0207651_104724822 117
405 3300025960 Ga0207651_10597552 Ga0207651_105975522 117
406 3300025960 Ga0207651_11206044 Ga0207651_112060442 117
407 3300025961 Ga0207712_10093088 Ga0207712_100930883 117
408 3300025961 Ga0207712_10305486 Ga0207712_103054862 117
409 3300025972 Ga0207668_10062324 Ga0207668_100623243 117
410 3300025972 Ga0207668_10071084 Ga0207668_100710841 117
411 3300025972 Ga0207668_11022764 Ga0207668_110227642 117
412 3300025981 Ga0207640_10055671 Ga0207640_100556712 117
413 3300025981 Ga0207640_11152593 Ga0207640_111525932 117
414 3300025986 Ga0207658_10000812 Ga0207658_100008126 117
415 3300025986 Ga0207658_10004524 Ga0207658_1000452413 117
416 3300026023 Ga0207677_10004232 Ga0207677_100042329 117
417 3300026023 Ga0207677_10068217 Ga0207677_100682174 117
418 3300026023 Ga0207677_10911196 Ga0207677_109111962 117
419 3300026035 Ga0207703_10000929 Ga0207703_1000092916 117
420 3300026035 Ga0207703_10001541 Ga0207703_100015414 117
421 3300026041 Ga0207639_11234313 Ga0207639_112343132 117
422 3300026067 Ga0207678_10306318 Ga0207678_103063182 117
423 3300026067 Ga0207678_10372354 Ga0207678_103723541 117
424 3300026075 Ga0207708_10036575 Ga0207708_100365753 117
425 3300026078 Ga0207702_10603650 Ga0207702_106036502 117
426 3300026088 Ga0207641_10000655 Ga0207641_1000065543 117
427 3300026088 Ga0207641_10002319 Ga0207641_100023193 117
428 3300026088 Ga0207641_10031495 Ga0207641_100314954 117
429 3300026088 Ga0207641_10056214 Ga0207641_100562143 117
430 3300026088 Ga0207641_12096397 Ga0207641_120963972 117
431 3300026089 Ga0207648_10006616 Ga0207648_1000661616 117
432 3300026089 Ga0207648_10152456 Ga0207648_101524563 117
433 3300026089 Ga0207648_10360701 Ga0207648_103607012 117
434 3300026089 Ga0207648_10504353 Ga0207648_105043532 117
435 3300026095 Ga0207676_10002990 Ga0207676_1000299012 117
436 3300026095 Ga0207676_10019288 Ga0207676_100192886 117
437 3300026095 Ga0207676_10027347 Ga0207676_100273475 117
438 3300026095 Ga0207676_10171790 Ga0207676_101717904 117
439 3300026095 Ga0207676_12420863 Ga0207676_124208631 117
440 3300026118 Ga0207675_100007375 Ga0207675_10000737510 117
441 3300026118 Ga0207675_100045418 Ga0207675_1000454185 117
442 3300026118 Ga0207675_100315865 Ga0207675_1003158653 117
443 3300026121 Ga0207683_10001877 Ga0207683_100018776 117
444 3300026121 Ga0207683_10015629 Ga0207683_100156294 117
445 3300026121 Ga0207683_10069474 Ga0207683_100694743 117
446 3300026121 Ga0207683_11011194 Ga0207683_110111942 117
447 3300026121 Ga0207683_11170920 Ga0207683_111709202 117
448 3300026121 Ga0207683_11309161 Ga0207683_113091612 117
449 3300026142 Ga0207698_10047674 Ga0207698_100476743 117
450 3300026142 Ga0207698_10089408 Ga0207698_100894084 117
451 3300026142 Ga0207698_10145002 Ga0207698_101450023 117
452 3300026142 Ga0207698_10992679 Ga0207698_109926791 117
453 3300026142 Ga0207698_11040918 Ga0207698_110409181 117
454 3300026142 Ga0207698_11209556 Ga0207698_112095562 117
455 3300026142 Ga0207698_11306513 Ga0207698_113065132 117
456 3300026142 Ga0207698_11503044 Ga0207698_115030442 117
457 3300026142 Ga0207698_11635731 Ga0207698_116357312 117
458 3300027907 Ga0207428_10551450 Ga0207428_105514502 117
459 3300028379 Ga0268266_11334451 Ga0268266_113344512 117
460 3300028380 Ga0268265_10031887 Ga0268265_100318872 117
461 3300028380 Ga0268265_10412897 Ga0268265_104128972 117
462 3300028380 Ga0268265_11064548 Ga0268265_110645482 117
463 3300028381 Ga0268264_10037391 Ga0268264_100373914 117
464 3300028381 Ga0268264_10120333 Ga0268264_101203333 117
465 3300028794 Ga0307515_10048310 Ga0307515_100483107 117
466 3300028794 Ga0307515_10109047 Ga0307515_101090475 117
467 3300028794 Ga0307515_10202732 Ga0307515_102027322 117
468 3300031239 Ga0265328_10086600 Ga0265328_100866002 117
469 3300031250 Ga0265331_10014048 Ga0265331_100140485 117
470 3300031251 Ga0265327_10000083 Ga0265327_10000083170 117
471 3300031456 Ga0307513_10080456 Ga0307513_100804563 117
472 3300031507 Ga0307509_10308473 Ga0307509_103084732 117
473 3300031548 Ga0307408_100000038 Ga0307408_100000038103 117
474 3300032004 Ga0307414_10083480 Ga0307414_100834802 117
475 3300032005 Ga0307411_10000214 Ga0307411_1000021421 117
476 3300035118 Ga0373954_0042286 Ga0373954_0042286_43_402 117
477 3300035119 Ga0373956_0288236 Ga0373956_0288236_74_433 117
478 3300035170 Ga0373943_0102141 Ga0373943_0102141_864_1223 117
479 3300035171 Ga0373946_0083441 Ga0373946_0083441_786_1145 117
480 3300035692 Ga0373935_0066476 Ga0373935_0066476_1387_1746 117
481 3300035724 Ga0373933_0292354 Ga0373933_0292354_188_547 117
482 3300035725 Ga0373947_0064625 Ga0373947_0064625_1427_1786 117
483 3300035725 Ga0373947_0181270 Ga0373947_0181270_119_478 117
484 3300036401 Ga0373937_0209133 Ga0373937_0209133_1291_1650 117
485 3300036401 Ga0373937_1254679 Ga0373937_1254679_53_412 117
486 3300037068 Ga0373925_0014054 Ga0373925_0014054_3428_3787 117
487 3300037068 Ga0373925_0157549 Ga0373925_0157549_154_513 117
488 3300037853 Ga0436364_1404502 Ga0436364_1404502_357_719 117
489 3300041441 Ga0451787_389700 Ga0451787_389700_32_472 117
490 3300041443 Ga0451789_0880985 Ga0451789_0880985_20_376 117
491 3300041452 Ga0451793_1059538 Ga0451793_1059538_392_832 117
492 3300041486 Ga0451807_0710180 Ga0451807_0710180_95_535 117
493 3300041511 Ga0451855_0667034 Ga0451855_0667034_129_488 117
494 3300041512 Ga0451853_3133088 Ga0451853_3133088_24_383 117
495 3300041512 Ga0451853_3248874 Ga0451853_3248874_256_696 117
496 3300042000 Ga0439437_001347 Ga0439437_001347_2006_2365 117
497 3300042115 Ga0450911_030681 Ga0450911_030681_192_548 117
498 3300042120 Ga0450917_006046 Ga0450917_006046_378_734 117
499 3300042126 Ga0450888_004032 Ga0450888_004032_644_1000 117
500 3300042127 Ga0450890_001516 Ga0450890_001516_512_868 117
501 3300042129 Ga0450891_001423 Ga0450891_001423_223_579 117
502 3300042144 Ga0450889_000335 Ga0450889_000335_867_1223 117
503 3300042532 Ga0450893_0004301 Ga0450893_0004301_1396_1752 117
504 3300045051 Ga0451576_0041466 Ga0451576_0041466_1313_1669 117
505 3300045051 Ga0451576_0538876 Ga0451576_0538876_489_845 117
506 3300046455 Ga0495603_0119726 Ga0495603_0119726_911_1270 117
507 3300046459 Ga0495629_0073241 Ga0495629_0073241_1173_1532 117
508 3300046512 Ga0495610_0137328 Ga0495610_0137328_574_1014 117
509 3300046519 Ga0495632_0135578 Ga0495632_0135578_125_565 117
510 3300046529 Ga0495652_0496674 Ga0495652_0496674_406_765 117
511 3300046530 Ga0495654_0192099 Ga0495654_0192099_41_400 117
512 3300046533 Ga0495640_0285497 Ga0495640_0285497_576_935 117
513 3300046535 Ga0495586_0642876 Ga0495586_0642876_42_401 117
514 3300046537 Ga0495598_0012869 Ga0495598_0012869_434_793 117
515 3300046537 Ga0495598_0065563 Ga0495598_0065563_385_744 117
516 3300046539 Ga0495621_0070645 Ga0495621_0070645_523_882 117
517 3300046542 Ga0495597_0406942 Ga0495597_0406942_14_454 117
518 3300046543 Ga0495645_0269720 Ga0495645_0269720_607_966 117
519 3300046663 Ga0495635_0380548 Ga0495635_0380548_95_454 117
520 3300046675 Ga0495657_0415908 Ga0495657_0415908_275_634 117
521 3300046681 Ga0495647_0101331 Ga0495647_0101331_490_849 117
522 3300046681 Ga0495647_0357977 Ga0495647_0357977_22_381 117
523 3300046683 Ga0495658_0009768 Ga0495658_0009768_2020_2379 117
524 3300046683 Ga0495658_0201011 Ga0495658_0201011_793_1152 117
525 3300046683 Ga0495658_0800538 Ga0495658_0800538_70_429 117
526 3300046691 Ga0495670_0140677 Ga0495670_0140677_359_718 117
527 3300047319 Ga0495674_0448332 Ga0495674_0448332_508_867 117
528 3300047322 Ga0495680_0104749 Ga0495680_0104749_859_1218 117
529 3300047471 Ga0495684_0121875 Ga0495684_0121875_462_821 117
530 3300047471 Ga0495684_0201239 Ga0495684_0201239_171_530 117
531 3300048089 Ga0495614_0317897 Ga0495614_0317897_309_668 117
532 3300048903 Ga0496100_0850821 Ga0496100_0850821_178_537 117
533 3300048904 Ga0496101_0899322 Ga0496101_0899322_285_644 117
534 3300048905 Ga0496102_0015200 Ga0496102_0015200_4243_4602 117
535 3300048907 Ga0496104_0335229 Ga0496104_0335229_373_732 117
536 3300048907 Ga0496104_0827018 Ga0496104_0827018_306_665 117
537 3300048907 Ga0496104_1355760 Ga0496104_1355760_245_604 117
538 3300048908 Ga0496105_0013657 Ga0496105_0013657_4707_5066 117
539 3300048909 Ga0496106_0618865 Ga0496106_0618865_417_773 117
540 3300048911 Ga0496108_0059595 Ga0496108_0059595_2430_2789 117
541 3300048912 Ga0496109_0153025 Ga0496109_0153025_1607_1966 117
542 3300048913 Ga0496110_0480413 Ga0496110_0480413_525_884 117
543 3300048913 Ga0496110_0630431 Ga0496110_0630431_528_887 117
544 3300048913 Ga0496110_1672943 Ga0496110_1672943_147_506 117
545 3300048914 Ga0496111_0519474 Ga0496111_0519474_22_381 117
546 3300048916 Ga0496113_0189643 Ga0496113_0189643_947_1303 117
547 3300048917 Ga0496114_0076201 Ga0496114_0076201_1305_1664 117
548 3300048917 Ga0496114_0405377 Ga0496114_0405377_688_1047 117
549 3300048917 Ga0496114_0745451 Ga0496114_0745451_246_605 117
550 3300048918 Ga0496115_0559583 Ga0496115_0559583_49_408 117
551 3300048927 Ga0496124_0099099 Ga0496124_0099099_25_390 117
552 3300049514 Ga0501291_088598 Ga0501291_088598_93_449 117
553 3300049523 Ga0501300_001957 Ga0501300_001957_2673_3029 117
554 3300049662 Ga0501222_005305 Ga0501222_005305_1276_1632 117
555 3300049665 Ga0501227_014844 Ga0501227_014844_539_895 117
556 3300049668 Ga0501233_022443 Ga0501233_022443_702_1058 117
557 3300049669 Ga0501235_001655 Ga0501235_001655_3023_3382 117
558 3300049672 Ga0501239_011591 Ga0501239_011591_523_879 117
559 3300049679 Ga0501249_003607 Ga0501249_003607_1958_2314 117
560 3300049687 Ga0501258_005143 Ga0501258_005143_894_1250 117
561 3300049705 Ga0501225_0025179 Ga0501225_0025179_262_618 117
562 3300049706 Ga0501229_011018 Ga0501229_011018_125_481 117
563 3300049706 Ga0501229_030280 Ga0501229_030280_125_481 117
564 3300049757 Ga0501232_038265 Ga0501232_038265_218_574 117
565 3300049759 Ga0501262_004944 Ga0501262_004944_256_612 117
566 3300049762 Ga0501265_001805 Ga0501265_001805_1359_1715 117
567 3300049763 Ga0501266_021295 Ga0501266_021295_451_810 117
568 3300049764 Ga0501267_000352 Ga0501267_000352_2695_3051 117
569 3300049766 Ga0501269_008000 Ga0501269_008000_896_1252 117
570 3300049768 Ga0501271_011340 Ga0501271_011340_515_874 117
571 3300050490 nmdc:mga03n38_42821_c1 nmdc:mga03n38_42821_c1_271_627 117
572 3300050493 nmdc:mga0k408_134788_c1 nmdc:mga0k408_134788_c1_879_1235 117
573 3300050493 nmdc:mga0k408_145750_c1 nmdc:mga0k408_145750_c1_104_544 117
574 3300050493 nmdc:mga0k408_187724_c1 nmdc:mga0k408_187724_c1_60_422 117
575 3300050493 nmdc:mga0k408_5050_c1 nmdc:mga0k408_5050_c1_6389_6745 117
576 3300050493 nmdc:mga0k408_77120_c1 nmdc:mga0k408_77120_c1_1019_1459 117
577 3300050496 nmdc:mga07m45_52252_c1 nmdc:mga07m45_52252_c1_1552_1992 117
578 3300050511 nmdc:mga08y16_495743_c1 nmdc:mga08y16_495743_c1_92_451 117
579 3300053077 Ga0495601_0015412 Ga0495601_0015412_3757_4116 117
580 3300053077 Ga0495601_0212289 Ga0495601_0212289_342_701 117
581 3300053084 Ga0495595_0117964 Ga0495595_0117964_13_372 117
582 3300053084 Ga0495595_0192342 Ga0495595_0192342_28_387 117
583 3300053085 Ga0495619_0084993 Ga0495619_0084993_83_442 117
584 3300053085 Ga0495619_0763871 Ga0495619_0763871_213_572 117
585 3300053117 Ga0500593_067582 Ga0500593_067582_391_750 117
586 3300053120 Ga0500597_140729 Ga0500597_140729_409_771 117
587 3300053136 Ga0500559_0544655 Ga0500559_0544655_76_432 117
588 3300053148 Ga0500590_003574 Ga0500590_003574_5807_6163 117
589 3300053155 Ga0500620_178222 Ga0500620_178222_345_701 117
590 3300053739 Ga0500587_002259 Ga0500587_002259_312_752 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04342

DMT_6

Putative member of DMT superfamily (DUF486)

42

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.6683 10 111
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.6495 10 117
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.6402 10 117
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6317 10 114
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.6234 10 111
ID Description Score Start End Superfamily
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7497 10 114 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7306 10 117 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7075 10 117 1.10.3730.20
af_Q3C1C7_10_111_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7059 11 116 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.6889 10 117 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A3L7XYB8-F1-model_v4 EamA domain-containing protein 0.9525 16 117 GO:0016020
AF-A0A517YNW5-F1-model_v4 DMT family protein 0.9319 9 117 GO:0016020
AF-A0A0Q6BMR0-F1-model_v4 DMT family protein 0.9263 6 117 GO:0016020
AF-A0L3W2-F1-model_v4 Transmembrane signal peptide protein 0.926 6 116 GO:0016020
AF-A0A143BBA2-F1-model_v4 Membrane protein 0.9255 4 117 GO:0016020

Feature Viewer

pLDDT pTM Quality
94.94 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map