F466962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 252 | 590 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10169715|Ga0105249_101697152 |
| Length | 327 |
| Sequence | MSSPVKNPTPAPATPKSRIVFDNTSKFYGQVLGVNRVSLSIPPGITGLVGPNGSGKTTLMNLLTGLLRPTRGTVDVLGIPTDRPEALFRVLGYATQYDAFPRGLTGYELIYSFLRIYGFEHAEAAARTGKALERVNLTEAAGRKVAAYSKGMRQRIKLAQAIAHEPRVLVLDEPLNGLDPMARSEVIGLFREFADAGRHVIVSSHILHEVDLISDQVVLLNGGYVVAEGAIAGVRDEMEEEHPVQVRIRCDRPSLLAARVFAEDGAVEARLDDDGQGILVRTRNADRFHLLLNKIVMEDGVAIDAVVPADSDVRSVYQYLIGGEGKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 185 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 191 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 239 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 240 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 242 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 0 |
| Rhizoplane | 0.51 |
| Rhizosphere | 97.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10172793 | 3300005289 | Bacteria | 1281 |
| 2 | Ga0065707_10129220 | 3300005295 | Bacteria | 1951 |
| 3 | Ga0070683_100000944 | 3300005329 | Bacteria | 21627 |
| 4 | Ga0070683_100001777 | 3300005329 | Bacteria | 16792 |
| 5 | Ga0070683_100023325 | 3300005329 | Bacteria | 5534 |
| 6 | Ga0070683_100055128 | 3300005329 | Bacteria | 3688 |
| 7 | Ga0070670_100045892 | 3300005331 | Bacteria | 3756 |
| 8 | Ga0070666_10019281 | 3300005335 | Bacteria | 4400 |
| 9 | Ga0068868_100000476 | 3300005338 | Bacteria | 26629 |
| 10 | Ga0070660_100121318 | 3300005339 | Bacteria | 2086 |
| 11 | Ga0070689_100028952 | 3300005340 | Bacteria | 4189 |
| 12 | Ga0070691_10002286 | 3300005341 | Bacteria | 8487 |
| 13 | Ga0070661_100094147 | 3300005344 | Bacteria | 2220 |
| 14 | Ga0070668_100220827 | 3300005347 | Bacteria | 1563 |
| 15 | Ga0070669_100000006 | 3300005353 | Bacteria | 268982 |
| 16 | Ga0070669_100023551 | 3300005353 | Bacteria | 4408 |
| 17 | Ga0070669_100116165 | 3300005353 | Bacteria | 2036 |
| 18 | Ga0070675_100000232 | 3300005354 | Bacteria | 35813 |
| 19 | Ga0070675_100020829 | 3300005354 | Bacteria | 5233 |
| 20 | Ga0070671_100021731 | 3300005355 | Bacteria | 5241 |
| 21 | Ga0070671_100041998 | 3300005355 | Bacteria | 3801 |
| 22 | Ga0070671_100306270 | 3300005355 | Bacteria | 1353 |
| 23 | Ga0070674_100019822 | 3300005356 | Bacteria | 4281 |
| 24 | Ga0070673_100003259 | 3300005364 | Bacteria | 10069 |
| 25 | Ga0070673_100017408 | 3300005364 | Bacteria | 5109 |
| 26 | Ga0070673_100044869 | 3300005364 | Bacteria | 3425 |
| 27 | Ga0070673_100196175 | 3300005364 | Bacteria | 1737 |
| 28 | Ga0070688_100022679 | 3300005365 | Bacteria | 3684 |
| 29 | Ga0070667_100016966 | 3300005367 | Bacteria | 6028 |
| 30 | Ga0070667_100021308 | 3300005367 | Bacteria | 5384 |
| 31 | Ga0070667_100398714 | 3300005367 | Bacteria | 1252 |
| 32 | Ga0070703_10000937 | 3300005406 | Bacteria | 9293 |
| 33 | Ga0070709_10000029 | 3300005434 | Bacteria | 119772 |
| 34 | Ga0070714_100126801 | 3300005435 | Bacteria | 2277 |
| 35 | Ga0070714_100585867 | 3300005435 | Bacteria | 1070 |
| 36 | Ga0070713_100000413 | 3300005436 | Bacteria | 27428 |
| 37 | Ga0070713_100045250 | 3300005436 | Bacteria | 3605 |
| 38 | Ga0070713_100046629 | 3300005436 | Bacteria | 3557 |
| 39 | Ga0070710_10028073 | 3300005437 | Unclassified | 3007 |
| 40 | Ga0070701_10107406 | 3300005438 | Unclassified | 1555 |
| 41 | Ga0070711_100000027 | 3300005439 | Bacteria | 108952 |
| 42 | Ga0070711_100088689 | 3300005439 | Unclassified | 2223 |
| 43 | Ga0070711_100145102 | 3300005439 | Bacteria | 1784 |
| 44 | Ga0070705_100000221 | 3300005440 | Bacteria | 33830 |
| 45 | Ga0070694_100009684 | 3300005444 | Bacteria | 5917 |
| 46 | Ga0070694_100090292 | 3300005444 | Bacteria | 2148 |
| 47 | Ga0070694_100349029 | 3300005444 | Bacteria | 1146 |
| 48 | Ga0070708_100022211 | 3300005445 | Bacteria | 5379 |
| 49 | Ga0070708_100030146 | 3300005445 | Bacteria | 4687 |
| 50 | Ga0070708_100106479 | 3300005445 | Bacteria | 2574 |
| 51 | Ga0070678_100148909 | 3300005456 | Unclassified | 1883 |
| 52 | Ga0070681_10001138 | 3300005458 | Bacteria | 22876 |
| 53 | Ga0068867_100041415 | 3300005459 | Bacteria | 3366 |
| 54 | Ga0068867_100053858 | 3300005459 | Bacteria | 2971 |
| 55 | Ga0068867_100106341 | 3300005459 | Unclassified | 2149 |
| 56 | Ga0068867_100281886 | 3300005459 | Bacteria | 1363 |
| 57 | Ga0070685_10011334 | 3300005466 | Bacteria | 4669 |
| 58 | Ga0070706_100000208 | 3300005467 | Bacteria | 72971 |
| 59 | Ga0070706_100025236 | 3300005467 | Bacteria | 5471 |
| 60 | Ga0070706_100148801 | 3300005467 | Bacteria | 2186 |
| 61 | Ga0070707_100045880 | 3300005468 | Bacteria | 4182 |
| 62 | Ga0070707_100541900 | 3300005468 | Bacteria | 1126 |
| 63 | Ga0070699_100000029 | 3300005518 | Bacteria | 151185 |
| 64 | Ga0070699_100296601 | 3300005518 | Bacteria | 1450 |
| 65 | Ga0070679_100001167 | 3300005530 | Bacteria | 23012 |
| 66 | Ga0070679_100319225 | 3300005530 | Bacteria | 1503 |
| 67 | Ga0070684_100004866 | 3300005535 | Bacteria | 10258 |
| 68 | Ga0070684_100036275 | 3300005535 | Bacteria | 4225 |
| 69 | Ga0070684_100058093 | 3300005535 | Bacteria | 3380 |
| 70 | Ga0070684_100072068 | 3300005535 | Unclassified | 3041 |
| 71 | Ga0068853_100034323 | 3300005539 | Bacteria | 4306 |
| 72 | Ga0068853_100433746 | 3300005539 | Bacteria | 1234 |
| 73 | Ga0070672_100004478 | 3300005543 | Bacteria | 9152 |
| 74 | Ga0070672_100032800 | 3300005543 | Bacteria | 3924 |
| 75 | Ga0070672_100155943 | 3300005543 | Unclassified | 1891 |
| 76 | Ga0070686_100007254 | 3300005544 | Bacteria | 6176 |
| 77 | Ga0070686_100056532 | 3300005544 | Bacteria | 2517 |
| 78 | Ga0070686_100090915 | 3300005544 | Bacteria | 2041 |
| 79 | Ga0070695_100019093 | 3300005545 | Bacteria | 4170 |
| 80 | Ga0070696_100000362 | 3300005546 | Bacteria | 27732 |
| 81 | Ga0070696_100036675 | 3300005546 | Bacteria | 3381 |
| 82 | Ga0070696_100217979 | 3300005546 | Unclassified | 1431 |
| 83 | Ga0070693_100002949 | 3300005547 | Bacteria | 7870 |
| 84 | Ga0070665_100000243 | 3300005548 | Bacteria | 90522 |
| 85 | Ga0070704_100009781 | 3300005549 | Bacteria | 5812 |
| 86 | Ga0070704_100092067 | 3300005549 | Bacteria | 2262 |
| 87 | Ga0070704_100128133 | 3300005549 | Bacteria | 1962 |
| 88 | Ga0070704_100170643 | 3300005549 | Bacteria | 1730 |
| 89 | Ga0068855_100007475 | 3300005563 | Bacteria | 13230 |
| 90 | Ga0068855_100013279 | 3300005563 | Bacteria | 9932 |
| 91 | Ga0068855_100091750 | 3300005563 | Unclassified | 3503 |
| 92 | Ga0068855_100165655 | 3300005563 | Bacteria | 2506 |
| 93 | Ga0068855_100278951 | 3300005563 | Unclassified | 1856 |
| 94 | Ga0070664_100000204 | 3300005564 | Bacteria | 42424 |
| 95 | Ga0068857_100001209 | 3300005577 | Bacteria | 20133 |
| 96 | Ga0068857_100091735 | 3300005577 | Bacteria | 2719 |
| 97 | Ga0068857_100277809 | 3300005577 | Bacteria | 1540 |
| 98 | Ga0068857_100297767 | 3300005577 | Bacteria | 1487 |
| 99 | Ga0068854_100066640 | 3300005578 | Unclassified | 2621 |
| 100 | Ga0068856_100001334 | 3300005614 | Bacteria | 25988 |
| 101 | Ga0068852_100035625 | 3300005616 | Bacteria | 4154 |
| 102 | Ga0068859_100013583 | 3300005617 | Bacteria | 8163 |
| 103 | Ga0068859_100027194 | 3300005617 | Bacteria | 5738 |
| 104 | Ga0068859_100049575 | 3300005617 | Bacteria | 4217 |
| 105 | Ga0068859_100148694 | 3300005617 | Unclassified | 2418 |
| 106 | Ga0068859_100193471 | 3300005617 | Bacteria | 2118 |
| 107 | Ga0068859_100306994 | 3300005617 | Bacteria | 1680 |
| 108 | Ga0068864_100000738 | 3300005618 | Bacteria | 27404 |
| 109 | Ga0068864_100021616 | 3300005618 | Bacteria | 5388 |
| 110 | Ga0068864_100186907 | 3300005618 | Bacteria | 1897 |
| 111 | Ga0068864_100283606 | 3300005618 | Bacteria | 1547 |
| 112 | Ga0068864_100351775 | 3300005618 | Bacteria | 1390 |
| 113 | Ga0068861_100005078 | 3300005719 | Bacteria | 8877 |
| 114 | Ga0068870_10030695 | 3300005840 | Bacteria | 2718 |
| 115 | Ga0068863_100002245 | 3300005841 | Bacteria | 19182 |
| 116 | Ga0068863_100010819 | 3300005841 | Bacteria | 8846 |
| 117 | Ga0068863_100038929 | 3300005841 | Bacteria | 4524 |
| 118 | Ga0068863_100184459 | 3300005841 | Bacteria | 2003 |
| 119 | Ga0068858_100004232 | 3300005842 | Bacteria | 14127 |
| 120 | Ga0068858_100076564 | 3300005842 | Bacteria | 3107 |
| 121 | Ga0068858_100113081 | 3300005842 | Bacteria | 2535 |
| 122 | Ga0068858_100165417 | 3300005842 | Bacteria | 2084 |
| 123 | Ga0068860_100002569 | 3300005843 | Bacteria | 19000 |
| 124 | Ga0068860_100007134 | 3300005843 | Bacteria | 11182 |
| 125 | Ga0068860_100025653 | 3300005843 | Bacteria | 5685 |
| 126 | Ga0068860_100129280 | 3300005843 | Bacteria | 2423 |
| 127 | Ga0068860_100232199 | 3300005843 | Bacteria | 1793 |
| 128 | Ga0068862_100008716 | 3300005844 | Bacteria | 8394 |
| 129 | Ga0068862_100011595 | 3300005844 | Bacteria | 7272 |
| 130 | Ga0068862_100025939 | 3300005844 | Bacteria | 4924 |
| 131 | Ga0068862_100050568 | 3300005844 | Bacteria | 3553 |
| 132 | Ga0070717_10003412 | 3300006028 | Bacteria | 11362 |
| 133 | Ga0070717_10010368 | 3300006028 | Bacteria | 7033 |
| 134 | Ga0075365_10016699 | 3300006038 | Bacteria | 4473 |
| 135 | Ga0075368_10037287 | 3300006042 | Bacteria | 1901 |
| 136 | Ga0075364_10019845 | 3300006051 | Bacteria | 4224 |
| 137 | Ga0075364_10022064 | 3300006051 | Bacteria | 4017 |
| 138 | Ga0070715_10000013 | 3300006163 | Bacteria | 155405 |
| 139 | Ga0070716_100000018 | 3300006173 | Bacteria | 84686 |
| 140 | Ga0070716_100003790 | 3300006173 | Bacteria | 7169 |
| 141 | Ga0070716_100026042 | 3300006173 | Unclassified | 3128 |
| 142 | Ga0070712_100000893 | 3300006175 | Bacteria | 17874 |
| 143 | Ga0070712_100001442 | 3300006175 | Bacteria | 14518 |
| 144 | Ga0070712_100091771 | 3300006175 | Bacteria | 2226 |
| 145 | Ga0075362_10017713 | 3300006177 | Bacteria | 2938 |
| 146 | Ga0075367_10002237 | 3300006178 | Bacteria | 8742 |
| 147 | Ga0075366_10000973 | 3300006195 | Bacteria | 13996 |
| 148 | Ga0097621_100018223 | 3300006237 | Bacteria | 5357 |
| 149 | Ga0097621_100024703 | 3300006237 | Bacteria | 4695 |
| 150 | Ga0097621_100066536 | 3300006237 | Bacteria | 2968 |
| 151 | Ga0097621_100319934 | 3300006237 | Bacteria | 1374 |
| 152 | Ga0097621_100359515 | 3300006237 | Unclassified | 1297 |
| 153 | Ga0068871_100030839 | 3300006358 | Unclassified | 4226 |
| 154 | Ga0068871_100076468 | 3300006358 | Bacteria | 2765 |
| 155 | Ga0068871_100242745 | 3300006358 | Bacteria | 1567 |
| 156 | Ga0075428_100001485 | 3300006844 | Bacteria | 25073 |
| 157 | Ga0075428_100036814 | 3300006844 | Bacteria | 5388 |
| 158 | Ga0075431_100015868 | 3300006847 | Bacteria | 7639 |
| 159 | Ga0075431_100380951 | 3300006847 | Bacteria | 1415 |
| 160 | Ga0075433_10003222 | 3300006852 | Bacteria | 12597 |
| 161 | Ga0075433_10071431 | 3300006852 | Bacteria | 3051 |
| 162 | Ga0075433_10171755 | 3300006852 | Bacteria | 1929 |
| 163 | Ga0075434_100004737 | 3300006871 | Bacteria | 12304 |
| 164 | Ga0075434_100048548 | 3300006871 | Bacteria | 4211 |
| 165 | Ga0075434_100058799 | 3300006871 | Bacteria | 3821 |
| 166 | Ga0075434_100249803 | 3300006871 | Bacteria | 1793 |
| 167 | Ga0075434_100257020 | 3300006871 | Bacteria | 1765 |
| 168 | Ga0075434_100358933 | 3300006871 | Bacteria | 1478 |
| 169 | Ga0075434_100502717 | 3300006871 | Bacteria | 1233 |
| 170 | Ga0068865_100042805 | 3300006881 | Bacteria | 3090 |
| 171 | Ga0068865_100043585 | 3300006881 | Bacteria | 3067 |
| 172 | Ga0068865_100095339 | 3300006881 | Bacteria | 2167 |
| 173 | Ga0075436_100003047 | 3300006914 | Bacteria | 11487 |
| 174 | Ga0075436_100071715 | 3300006914 | Bacteria | 2395 |
| 175 | Ga0097620_100013583 | 3300006931 | Bacteria | 8163 |
| 176 | Ga0097620_100027195 | 3300006931 | Bacteria | 5738 |
| 177 | Ga0097620_100049573 | 3300006931 | Bacteria | 4217 |
| 178 | Ga0097620_100148696 | 3300006931 | Unclassified | 2418 |
| 179 | Ga0097620_100193472 | 3300006931 | Bacteria | 2118 |
| 180 | Ga0097620_100306983 | 3300006931 | Bacteria | 1680 |
| 181 | Ga0075435_100073906 | 3300007076 | Bacteria | 2787 |
| 182 | Ga0075435_100095849 | 3300007076 | Unclassified | 2454 |
| 183 | Ga0099794_10007949 | 3300007265 | Bacteria | 4384 |
| 184 | Ga0105240_10011617 | 3300009093 | Bacteria | 12248 |
| 185 | Ga0105240_10022682 | 3300009093 | Bacteria | 8317 |
| 186 | Ga0105240_10062281 | 3300009093 | Bacteria | 4645 |
| 187 | Ga0105240_10093738 | 3300009093 | Bacteria | 3664 |
| 188 | Ga0111539_10003069 | 3300009094 | Bacteria | 22129 |
| 189 | Ga0111539_10056627 | 3300009094 | Bacteria | 4658 |
| 190 | Ga0111539_10152937 | 3300009094 | Bacteria | 2700 |
| 191 | Ga0111539_10407522 | 3300009094 | Unclassified | 1583 |
| 192 | Ga0105245_10002931 | 3300009098 | Bacteria | 15316 |
| 193 | Ga0105245_10100446 | 3300009098 | Bacteria | 2676 |
| 194 | Ga0105245_10119641 | 3300009098 | Bacteria | 2459 |
| 195 | Ga0105245_10200331 | 3300009098 | Unclassified | 1917 |
| 196 | Ga0105245_10204340 | 3300009098 | Bacteria | 1898 |
| 197 | Ga0105245_10400432 | 3300009098 | Unclassified | 1371 |
| 198 | Ga0114129_10000027 | 3300009147 | Bacteria | 112969 |
| 199 | Ga0114129_10021567 | 3300009147 | Bacteria | 9144 |
| 200 | Ga0114129_10093522 | 3300009147 | Bacteria | 4165 |
| 201 | Ga0114129_10202857 | 3300009147 | Bacteria | 2685 |
| 202 | Ga0105243_10039903 | 3300009148 | Bacteria | 3663 |
| 203 | Ga0105243_10261947 | 3300009148 | Bacteria | 1548 |
| 204 | Ga0105243_10321920 | 3300009148 | Bacteria | 1409 |
| 205 | Ga0105243_10343787 | 3300009148 | Bacteria | 1368 |
| 206 | Ga0105243_10503144 | 3300009148 | Bacteria | 1148 |
| 207 | Ga0105241_10011888 | 3300009174 | Bacteria | 6397 |
| 208 | Ga0105241_10087895 | 3300009174 | Unclassified | 2447 |
| 209 | Ga0105241_10204423 | 3300009174 | Unclassified | 1651 |
| 210 | Ga0105241_10303887 | 3300009174 | Unclassified | 1370 |
| 211 | Ga0105241_10495924 | 3300009174 | Unclassified | 1088 |
| 212 | Ga0105241_10534847 | 3300009174 | Bacteria | 1050 |
| 213 | Ga0105242_10016280 | 3300009176 | Bacteria | 5781 |
| 214 | Ga0105242_10035147 | 3300009176 | Bacteria | 4019 |
| 215 | Ga0105242_10057251 | 3300009176 | Bacteria | 3191 |
| 216 | Ga0105242_10416250 | 3300009176 | Unclassified | 1258 |
| 217 | Ga0105248_10000562 | 3300009177 | Bacteria | 42094 |
| 218 | Ga0105248_10001595 | 3300009177 | Bacteria | 25242 |
| 219 | Ga0105248_10037993 | 3300009177 | Bacteria | 5386 |
| 220 | Ga0105248_10051373 | 3300009177 | Bacteria | 4625 |
| 221 | Ga0105248_10125138 | 3300009177 | Unclassified | 2900 |
| 222 | Ga0105248_10202645 | 3300009177 | Unclassified | 2236 |
| 223 | Ga0105248_10257940 | 3300009177 | Bacteria | 1963 |
| 224 | Ga0105248_10360395 | 3300009177 | Unclassified | 1637 |
| 225 | Ga0105237_10016662 | 3300009545 | Bacteria | 7632 |
| 226 | Ga0105237_10024726 | 3300009545 | Bacteria | 6144 |
| 227 | Ga0105237_10027240 | 3300009545 | Bacteria | 5836 |
| 228 | Ga0105237_10079547 | 3300009545 | Bacteria | 3268 |
| 229 | Ga0105237_10127964 | 3300009545 | Bacteria | 2534 |
| 230 | Ga0105238_10002683 | 3300009551 | Bacteria | 17692 |
| 231 | Ga0105238_10024681 | 3300009551 | Bacteria | 6128 |
| 232 | Ga0105238_10038145 | 3300009551 | Bacteria | 4881 |
| 233 | Ga0105238_10105987 | 3300009551 | Unclassified | 2793 |
| 234 | Ga0105238_10133009 | 3300009551 | Bacteria | 2465 |
| 235 | Ga0105249_10040144 | 3300009553 | Bacteria | 4250 |
| 236 | Ga0105249_10169715 | 3300009553 | Bacteria | 2115 |
| 237 | Ga0105249_10275134 | 3300009553 | Bacteria | 1679 |
| 238 | Ga0105239_10009479 | 3300010375 | Bacteria | 10971 |
| 239 | Ga0105239_10039974 | 3300010375 | Bacteria | 5138 |
| 240 | Ga0105246_10014199 | 3300011119 | Bacteria | 5006 |
| 241 | Ga0105246_10106680 | 3300011119 | Bacteria | 2050 |
| 242 | Ga0157370_10010552 | 3300013104 | Bacteria | 9729 |
| 243 | Ga0157370_10018572 | 3300013104 | Bacteria | 6989 |
| 244 | Ga0157370_10278684 | 3300013104 | Bacteria | 1545 |
| 245 | Ga0157370_10811585 | 3300013104 | Bacteria | 851 |
| 246 | Ga0157369_10012340 | 3300013105 | Bacteria | 9700 |
| 247 | Ga0157369_10031304 | 3300013105 | Bacteria | 5859 |
| 248 | Ga0157369_10066392 | 3300013105 | Bacteria | 3881 |
| 249 | Ga0157369_10080625 | 3300013105 | Bacteria | 3484 |
| 250 | Ga0157374_10006261 | 3300013296 | Bacteria | 10091 |
| 251 | Ga0157374_10038933 | 3300013296 | Bacteria | 4372 |
| 252 | Ga0157374_10076946 | 3300013296 | Bacteria | 3156 |
| 253 | Ga0157374_10158377 | 3300013296 | Bacteria | 2205 |
| 254 | Ga0157378_10072565 | 3300013297 | Unclassified | 3093 |
| 255 | Ga0157378_10111951 | 3300013297 | Bacteria | 2503 |
| 256 | Ga0157378_10267362 | 3300013297 | Bacteria | 1643 |
| 257 | Ga0157378_10430742 | 3300013297 | Bacteria | 1305 |
| 258 | Ga0163162_10000995 | 3300013306 | Bacteria | 26367 |
| 259 | Ga0163162_10002444 | 3300013306 | Bacteria | 17523 |
| 260 | Ga0163162_10340480 | 3300013306 | Bacteria | 1632 |
| 261 | Ga0163162_10499210 | 3300013306 | Bacteria | 1347 |
| 262 | Ga0163162_10764339 | 3300013306 | Bacteria | 1085 |
| 263 | Ga0157372_10003092 | 3300013307 | Bacteria | 17925 |
| 264 | Ga0157372_10179286 | 3300013307 | Bacteria | 2452 |
| 265 | Ga0157375_10004297 | 3300013308 | Bacteria | 12361 |
| 266 | Ga0157375_10057940 | 3300013308 | Bacteria | 3831 |
| 267 | Ga0157375_10144400 | 3300013308 | Bacteria | 2509 |
| 268 | Ga0157375_10157345 | 3300013308 | Unclassified | 2412 |
| 269 | Ga0163163_10007949 | 3300014325 | Bacteria | 9380 |
| 270 | Ga0163163_10012832 | 3300014325 | Bacteria | 7645 |
| 271 | Ga0163163_10016359 | 3300014325 | Bacteria | 6889 |
| 272 | Ga0163163_10030465 | 3300014325 | Bacteria | 5199 |
| 273 | Ga0163163_10056418 | 3300014325 | Bacteria | 3882 |
| 274 | Ga0163163_10147316 | 3300014325 | Bacteria | 2398 |
| 275 | Ga0157380_10081812 | 3300014326 | Bacteria | 2642 |
| 276 | Ga0157380_10382664 | 3300014326 | Bacteria | 1328 |
| 277 | Ga0157379_10000277 | 3300014968 | Bacteria | 40463 |
| 278 | Ga0157376_10036831 | 3300014969 | Bacteria | 3966 |
| 279 | Ga0157376_10088729 | 3300014969 | Bacteria | 2672 |
| 280 | Ga0157376_10343933 | 3300014969 | Bacteria | 1425 |
| 281 | Ga0157376_10484256 | 3300014969 | Bacteria | 1213 |
| 282 | Ga0163161_10066834 | 3300017792 | Bacteria | 2625 |
| 283 | Ga0213873_10018202 | 3300021358 | Unclassified | 1613 |
| 284 | Ga0207653_10000261 | 3300025885 | Bacteria | 32960 |
| 285 | Ga0207680_10008748 | 3300025903 | Bacteria | 4987 |
| 286 | Ga0207680_10021498 | 3300025903 | Bacteria | 3492 |
| 287 | Ga0207685_10000013 | 3300025905 | Bacteria | 186374 |
| 288 | Ga0207699_10000002 | 3300025906 | Bacteria | 662194 |
| 289 | Ga0207699_10000715 | 3300025906 | Bacteria | 15863 |
| 290 | Ga0207699_10006244 | 3300025906 | Bacteria | 5754 |
| 291 | Ga0207643_10009998 | 3300025908 | Bacteria | 5100 |
| 292 | Ga0207684_10000248 | 3300025910 | Bacteria | 80978 |
| 293 | Ga0207684_10033080 | 3300025910 | Bacteria | 4398 |
| 294 | Ga0207684_10229641 | 3300025910 | Bacteria | 1601 |
| 295 | Ga0207654_10006021 | 3300025911 | Bacteria | 6097 |
| 296 | Ga0207654_10207488 | 3300025911 | Unclassified | 1293 |
| 297 | Ga0207654_10312280 | 3300025911 | Bacteria | 1072 |
| 298 | Ga0207707_10002195 | 3300025912 | Bacteria | 17680 |
| 299 | Ga0207695_10000768 | 3300025913 | Bacteria | 61199 |
| 300 | Ga0207695_10000789 | 3300025913 | Bacteria | 59517 |
| 301 | Ga0207695_10011181 | 3300025913 | Bacteria | 10891 |
| 302 | Ga0207695_10034350 | 3300025913 | Bacteria | 5516 |
| 303 | Ga0207695_10071430 | 3300025913 | Bacteria | 3545 |
| 304 | Ga0207695_10073553 | 3300025913 | Bacteria | 3482 |
| 305 | Ga0207695_10129621 | 3300025913 | Bacteria | 2481 |
| 306 | Ga0207671_10037938 | 3300025914 | Bacteria | 3572 |
| 307 | Ga0207671_10043137 | 3300025914 | Bacteria | 3335 |
| 308 | Ga0207671_10165531 | 3300025914 | Bacteria | 1714 |
| 309 | Ga0207693_10000108 | 3300025915 | Bacteria | 75296 |
| 310 | Ga0207693_10015198 | 3300025915 | Bacteria | 6178 |
| 311 | Ga0207693_10103107 | 3300025915 | Bacteria | 2237 |
| 312 | Ga0207663_10000006 | 3300025916 | Bacteria | 253740 |
| 313 | Ga0207663_10065313 | 3300025916 | Bacteria | 2326 |
| 314 | Ga0207663_10084339 | 3300025916 | Bacteria | 2090 |
| 315 | Ga0207660_10113703 | 3300025917 | Bacteria | 2041 |
| 316 | Ga0207662_10010850 | 3300025918 | Bacteria | 5035 |
| 317 | Ga0207657_10121916 | 3300025919 | Bacteria | 2145 |
| 318 | Ga0207649_10036108 | 3300025920 | Bacteria | 2974 |
| 319 | Ga0207649_10113732 | 3300025920 | Unclassified | 1813 |
| 320 | Ga0207652_10001481 | 3300025921 | Bacteria | 20767 |
| 321 | Ga0207646_10094543 | 3300025922 | Bacteria | 2677 |
| 322 | Ga0207681_10000006 | 3300025923 | Bacteria | 496979 |
| 323 | Ga0207681_10071782 | 3300025923 | Bacteria | 2416 |
| 324 | Ga0207694_10002477 | 3300025924 | Bacteria | 15029 |
| 325 | Ga0207694_10003769 | 3300025924 | Bacteria | 12005 |
| 326 | Ga0207694_10016496 | 3300025924 | Bacteria | 5578 |
| 327 | Ga0207694_10033293 | 3300025924 | Bacteria | 3948 |
| 328 | Ga0207694_10082371 | 3300025924 | Bacteria | 2529 |
| 329 | Ga0207694_10373494 | 3300025924 | Bacteria | 1183 |
| 330 | Ga0207650_10001625 | 3300025925 | Bacteria | 16035 |
| 331 | Ga0207650_10014064 | 3300025925 | Bacteria | 5557 |
| 332 | Ga0207659_10001985 | 3300025926 | Bacteria | 12106 |
| 333 | Ga0207659_10004565 | 3300025926 | Bacteria | 8374 |
| 334 | Ga0207687_10010708 | 3300025927 | Bacteria | 5989 |
| 335 | Ga0207687_10023066 | 3300025927 | Bacteria | 4145 |
| 336 | Ga0207687_10068590 | 3300025927 | Bacteria | 2526 |
| 337 | Ga0207687_10082323 | 3300025927 | Bacteria | 2328 |
| 338 | Ga0207700_10004544 | 3300025928 | Bacteria | 8200 |
| 339 | Ga0207700_10005144 | 3300025928 | Bacteria | 7780 |
| 340 | Ga0207700_10027875 | 3300025928 | Bacteria | 3961 |
| 341 | Ga0207664_10048768 | 3300025929 | Bacteria | 3332 |
| 342 | Ga0207664_10135579 | 3300025929 | Bacteria | 2077 |
| 343 | Ga0207644_10013348 | 3300025931 | Bacteria | 5476 |
| 344 | Ga0207644_10013545 | 3300025931 | Bacteria | 5440 |
| 345 | Ga0207706_10505370 | 3300025933 | Bacteria | 1043 |
| 346 | Ga0207686_10189956 | 3300025934 | Bacteria | 1463 |
| 347 | Ga0207709_10083180 | 3300025935 | Bacteria | 2069 |
| 348 | Ga0207709_10086840 | 3300025935 | Bacteria | 2032 |
| 349 | Ga0207709_10107526 | 3300025935 | Bacteria | 1858 |
| 350 | Ga0207704_10067114 | 3300025938 | Bacteria | 2255 |
| 351 | Ga0207704_10148410 | 3300025938 | Bacteria | 1651 |
| 352 | Ga0207704_10224185 | 3300025938 | Bacteria | 1393 |
| 353 | Ga0207704_10252890 | 3300025938 | Bacteria | 1324 |
| 354 | Ga0207665_10000022 | 3300025939 | Bacteria | 109003 |
| 355 | Ga0207665_10001840 | 3300025939 | Bacteria | 14276 |
| 356 | Ga0207665_10016609 | 3300025939 | Bacteria | 4836 |
| 357 | Ga0207665_10083472 | 3300025939 | Unclassified | 2203 |
| 358 | Ga0207691_10009274 | 3300025940 | Bacteria | 9441 |
| 359 | Ga0207691_10102531 | 3300025940 | Bacteria | 2552 |
| 360 | Ga0207691_10182177 | 3300025940 | Unclassified | 1835 |
| 361 | Ga0207691_10375972 | 3300025940 | Unclassified | 1213 |
| 362 | Ga0207711_10001521 | 3300025941 | Bacteria | 21549 |
| 363 | Ga0207711_10005417 | 3300025941 | Bacteria | 10791 |
| 364 | Ga0207711_10089791 | 3300025941 | Unclassified | 2700 |
| 365 | Ga0207711_10093531 | 3300025941 | Unclassified | 2648 |
| 366 | Ga0207711_10498922 | 3300025941 | Bacteria | 1134 |
| 367 | Ga0207689_10068240 | 3300025942 | Bacteria | 2922 |
| 368 | Ga0207689_10123920 | 3300025942 | Bacteria | 2126 |
| 369 | Ga0207661_10001936 | 3300025944 | Bacteria | 14239 |
| 370 | Ga0207661_10011769 | 3300025944 | Bacteria | 6352 |
| 371 | Ga0207661_10035478 | 3300025944 | Bacteria | 3886 |
| 372 | Ga0207679_10007116 | 3300025945 | Bacteria | 7089 |
| 373 | Ga0207667_10002519 | 3300025949 | Bacteria | 22814 |
| 374 | Ga0207667_10020639 | 3300025949 | Bacteria | 7322 |
| 375 | Ga0207667_10242856 | 3300025949 | Unclassified | 1843 |
| 376 | Ga0207667_10330499 | 3300025949 | Unclassified | 1556 |
| 377 | Ga0207651_10007268 | 3300025960 | Bacteria | 5887 |
| 378 | Ga0207651_10008592 | 3300025960 | Bacteria | 5526 |
| 379 | Ga0207651_10060666 | 3300025960 | Bacteria | 2627 |
| 380 | Ga0207651_10170412 | 3300025960 | Bacteria | 1716 |
| 381 | Ga0207712_10096161 | 3300025961 | Bacteria | 2192 |
| 382 | Ga0207712_10117064 | 3300025961 | Bacteria | 2009 |
| 383 | Ga0207640_10065668 | 3300025981 | Bacteria | 2422 |
| 384 | Ga0207640_10348174 | 3300025981 | Bacteria | 1189 |
| 385 | Ga0207658_10006343 | 3300025986 | Bacteria | 8073 |
| 386 | Ga0207677_10001963 | 3300026023 | Bacteria | 10892 |
| 387 | Ga0207677_10134880 | 3300026023 | Bacteria | 1880 |
| 388 | Ga0207703_10023698 | 3300026035 | Bacteria | 4827 |
| 389 | Ga0207703_10035135 | 3300026035 | Bacteria | 3982 |
| 390 | Ga0207703_10221055 | 3300026035 | Bacteria | 1693 |
| 391 | Ga0207703_10298129 | 3300026035 | Bacteria | 1469 |
| 392 | Ga0207703_10419345 | 3300026035 | Bacteria | 1245 |
| 393 | Ga0207639_10180038 | 3300026041 | Unclassified | 1797 |
| 394 | Ga0207678_10036717 | 3300026067 | Bacteria | 4265 |
| 395 | Ga0207708_10021580 | 3300026075 | Bacteria | 4857 |
| 396 | Ga0207702_10008454 | 3300026078 | Bacteria | 8682 |
| 397 | Ga0207702_10129825 | 3300026078 | Unclassified | 2266 |
| 398 | Ga0207641_10015607 | 3300026088 | Bacteria | 6225 |
| 399 | Ga0207641_10065204 | 3300026088 | Bacteria | 3115 |
| 400 | Ga0207641_10109940 | 3300026088 | Bacteria | 2442 |
| 401 | Ga0207648_10004080 | 3300026089 | Bacteria | 15136 |
| 402 | Ga0207648_10084079 | 3300026089 | Bacteria | 2776 |
| 403 | Ga0207648_10121295 | 3300026089 | Bacteria | 2299 |
| 404 | Ga0207676_10008022 | 3300026095 | Bacteria | 7506 |
| 405 | Ga0207676_10168185 | 3300026095 | Unclassified | 1907 |
| 406 | Ga0207676_10255315 | 3300026095 | Bacteria | 1580 |
| 407 | Ga0207676_10349132 | 3300026095 | Bacteria | 1368 |
| 408 | Ga0207674_10000072 | 3300026116 | Bacteria | 105507 |
| 409 | Ga0207674_10025920 | 3300026116 | Bacteria | 6240 |
| 410 | Ga0207674_10050816 | 3300026116 | Bacteria | 4234 |
| 411 | Ga0207674_10205869 | 3300026116 | Bacteria | 1917 |
| 412 | Ga0207674_10288045 | 3300026116 | Bacteria | 1591 |
| 413 | Ga0207675_100009987 | 3300026118 | Bacteria | 8890 |
| 414 | Ga0207683_10026551 | 3300026121 | Bacteria | 4998 |
| 415 | Ga0207698_10009064 | 3300026142 | Bacteria | 6321 |
| 416 | Ga0207428_10000311 | 3300027907 | Bacteria | 64550 |
| 417 | Ga0207428_10018382 | 3300027907 | Bacteria | 5973 |
| 418 | Ga0265356_1009368 | 3300028017 | Unclassified | 1104 |
| 419 | Ga0268266_10000427 | 3300028379 | Bacteria | 63335 |
| 420 | Ga0268266_10058649 | 3300028379 | Bacteria | 3315 |
| 421 | Ga0268265_10039013 | 3300028380 | Bacteria | 3497 |
| 422 | Ga0268265_10055000 | 3300028380 | Bacteria | 3022 |
| 423 | Ga0268265_10061035 | 3300028380 | Bacteria | 2892 |
| 424 | Ga0268265_10155007 | 3300028380 | Unclassified | 1937 |
| 425 | Ga0268265_10172897 | 3300028380 | Bacteria | 1848 |
| 426 | Ga0268264_10003384 | 3300028381 | Bacteria | 13773 |
| 427 | Ga0268264_10007069 | 3300028381 | Bacteria | 9407 |
| 428 | Ga0268264_10028839 | 3300028381 | Bacteria | 4543 |
| 429 | Ga0268264_10056279 | 3300028381 | Bacteria | 3288 |
| 430 | Ga0268264_10409214 | 3300028381 | Bacteria | 1305 |
| 431 | Ga0265337_1048679 | 3300028556 | Bacteria | 1199 |
| 432 | Ga0265338_10003647 | 3300028800 | Bacteria | 21449 |
| 433 | Ga0265338_10017405 | 3300028800 | Bacteria | 7747 |
| 434 | Ga0265338_10043786 | 3300028800 | Bacteria | 4145 |
| 435 | Ga0265338_10086478 | 3300028800 | Bacteria | 2609 |
| 436 | Ga0265762_1000133 | 3300030760 | Bacteria | 11173 |
| 437 | Ga0265760_10018651 | 3300031090 | Bacteria | 1999 |
| 438 | Ga0265332_10035138 | 3300031238 | Bacteria | 2177 |
| 439 | Ga0265340_10095903 | 3300031247 | Bacteria | 1382 |
| 440 | Ga0265339_10147259 | 3300031249 | Bacteria | 1193 |
| 441 | Ga0265316_10147125 | 3300031344 | Bacteria | 1766 |
| 442 | Ga0265313_10009783 | 3300031595 | Bacteria | 6177 |
| 443 | Ga0265314_10009360 | 3300031711 | Bacteria | 8286 |
| 444 | Ga0373934_0004171 | 3300035086 | Bacteria | 5331 |
| 445 | Ga0373954_0007913 | 3300035118 | Bacteria | 4655 |
| 446 | Ga0373955_0013608 | 3300035172 | Bacteria | 3939 |
| 447 | Ga0373955_0016763 | 3300035172 | Bacteria | 3611 |
| 448 | Ga0373955_0124159 | 3300035172 | Bacteria | 1503 |
| 449 | Ga0373961_0035683 | 3300035241 | Bacteria | 1412 |
| 450 | Ga0373935_0015647 | 3300035692 | Bacteria | 4588 |
| 451 | Ga0373927_0007055 | 3300035695 | Bacteria | 7621 |
| 452 | Ga0373947_0105702 | 3300035725 | Bacteria | 1774 |
| 453 | Ga0373947_0178958 | 3300035725 | Bacteria | 1380 |
| 454 | Ga0373937_0001861 | 3300036401 | Bacteria | 17743 |
| 455 | Ga0373937_0002150 | 3300036401 | Bacteria | 16502 |
| 456 | Ga0373937_0003162 | 3300036401 | Bacteria | 13782 |
| 457 | Ga0373937_0053373 | 3300036401 | Bacteria | 3708 |
| 458 | Ga0373937_0106917 | 3300036401 | Bacteria | 2601 |
| 459 | Ga0436362_0058380 | 3300039453 | Unclassified | 2300 |
| 460 | Ga0451807_0480303 | 3300041486 | Bacteria | 1807 |
| 461 | Ga0451849_1474294 | 3300041505 | Bacteria | 1841 |
| 462 | Ga0451577_0004594 | 3300042876 | Bacteria | 14503 |
| 463 | Ga0451577_0015547 | 3300042876 | Bacteria | 7076 |
| 464 | Ga0451577_0090976 | 3300042876 | Bacteria | 2723 |
| 465 | Ga0453683_0259289 | 3300044673 | Bacteria | 1109 |
| 466 | Ga0466963_0190448 | 3300044694 | Bacteria | 1433 |
| 467 | Ga0453684_0032892 | 3300044712 | Bacteria | 7242 |
| 468 | Ga0453684_0221537 | 3300044712 | Bacteria | 2191 |
| 469 | Ga0451576_0051507 | 3300045051 | Bacteria | 4317 |
| 470 | Ga0451576_0499113 | 3300045051 | Bacteria | 1278 |
| 471 | Ga0495592_0005305 | 3300046454 | Bacteria | 9503 |
| 472 | Ga0495629_0000035 | 3300046459 | Bacteria | 118597 |
| 473 | Ga0495629_0040001 | 3300046459 | Unclassified | 3299 |
| 474 | Ga0495629_0111163 | 3300046459 | Bacteria | 1910 |
| 475 | Ga0495629_0152578 | 3300046459 | Bacteria | 1606 |
| 476 | Ga0495629_0319557 | 3300046459 | Bacteria | 1061 |
| 477 | Ga0495651_0031116 | 3300046462 | Bacteria | 4162 |
| 478 | Ga0495651_0092374 | 3300046462 | Bacteria | 2267 |
| 479 | Ga0495651_0218315 | 3300046462 | Unclassified | 1322 |
| 480 | Ga0495580_0002919 | 3300046472 | Bacteria | 14687 |
| 481 | Ga0495582_0033029 | 3300046473 | Bacteria | 2844 |
| 482 | Ga0495639_0082077 | 3300046475 | Bacteria | 1503 |
| 483 | Ga0495662_0014396 | 3300046476 | Bacteria | 3848 |
| 484 | Ga0495662_0028261 | 3300046476 | Bacteria | 2708 |
| 485 | Ga0495662_0035473 | 3300046476 | Bacteria | 2406 |
| 486 | Ga0495664_0185993 | 3300046477 | Unclassified | 1259 |
| 487 | Ga0495594_0017343 | 3300046499 | Bacteria | 3803 |
| 488 | Ga0495594_0046943 | 3300046499 | Unclassified | 2372 |
| 489 | Ga0495594_0190067 | 3300046499 | Bacteria | 1170 |
| 490 | Ga0495608_0053321 | 3300046511 | Bacteria | 2676 |
| 491 | Ga0495618_0094981 | 3300046514 | Bacteria | 1906 |
| 492 | Ga0495628_0090609 | 3300046516 | Bacteria | 2367 |
| 493 | Ga0495652_0063979 | 3300046529 | Bacteria | 3096 |
| 494 | Ga0495652_0065122 | 3300046529 | Bacteria | 3063 |
| 495 | Ga0495652_0109323 | 3300046529 | Bacteria | 2226 |
| 496 | Ga0495652_0152311 | 3300046529 | Bacteria | 1805 |
| 497 | Ga0495665_0063480 | 3300046531 | Bacteria | 1950 |
| 498 | Ga0495640_0134316 | 3300046533 | Unclassified | 1599 |
| 499 | Ga0495587_0018019 | 3300046536 | Bacteria | 4378 |
| 500 | Ga0495587_0029341 | 3300046536 | Bacteria | 3339 |
| 501 | Ga0495587_0232956 | 3300046536 | Bacteria | 1038 |
| 502 | Ga0495645_0008623 | 3300046543 | Bacteria | 7119 |
| 503 | Ga0495645_0043479 | 3300046543 | Bacteria | 3277 |
| 504 | Ga0495667_0001172 | 3300046559 | Bacteria | 17119 |
| 505 | Ga0495667_0009119 | 3300046559 | Bacteria | 6737 |
| 506 | Ga0495667_0081597 | 3300046559 | Bacteria | 2102 |
| 507 | Ga0495667_0087264 | 3300046559 | Bacteria | 2023 |
| 508 | Ga0495634_0027000 | 3300046642 | Bacteria | 4000 |
| 509 | Ga0495634_0034461 | 3300046642 | Bacteria | 3474 |
| 510 | Ga0495635_0001362 | 3300046663 | Bacteria | 16266 |
| 511 | Ga0495657_0000805 | 3300046675 | Bacteria | 27819 |
| 512 | Ga0495657_0144569 | 3300046675 | Bacteria | 1480 |
| 513 | Ga0495599_0029754 | 3300046678 | Bacteria | 3425 |
| 514 | Ga0495599_0037075 | 3300046678 | Bacteria | 3063 |
| 515 | Ga0495599_0061610 | 3300046678 | Bacteria | 2344 |
| 516 | Ga0495623_0009717 | 3300046679 | Bacteria | 6243 |
| 517 | Ga0495623_0084200 | 3300046679 | Bacteria | 1963 |
| 518 | Ga0495623_0174739 | 3300046679 | Unclassified | 1252 |
| 519 | Ga0495647_0034330 | 3300046681 | Unclassified | 1900 |
| 520 | Ga0495647_0064080 | 3300046681 | Bacteria | 1457 |
| 521 | Ga0495658_0000289 | 3300046683 | Bacteria | 28435 |
| 522 | Ga0495658_0064070 | 3300046683 | Bacteria | 2117 |
| 523 | Ga0495658_0213526 | 3300046683 | Unclassified | 1206 |
| 524 | Ga0495613_0005125 | 3300046689 | Bacteria | 9834 |
| 525 | Ga0495613_0039834 | 3300046689 | Bacteria | 3482 |
| 526 | Ga0495613_0040098 | 3300046689 | Bacteria | 3470 |
| 527 | Ga0495613_0177567 | 3300046689 | Bacteria | 1509 |
| 528 | Ga0495613_0307884 | 3300046689 | Bacteria | 1095 |
| 529 | Ga0495624_0216487 | 3300046690 | Bacteria | 1162 |
| 530 | Ga0495671_0118441 | 3300046692 | Bacteria | 1293 |
| 531 | Ga0495600_0210663 | 3300046809 | Bacteria | 1245 |
| 532 | Ga0495581_0000568 | 3300047315 | Bacteria | 19217 |
| 533 | Ga0495604_0045331 | 3300047317 | Bacteria | 3432 |
| 534 | Ga0495636_0058105 | 3300047318 | Bacteria | 1630 |
| 535 | Ga0495674_0046953 | 3300047319 | Bacteria | 3831 |
| 536 | Ga0495674_0050886 | 3300047319 | Unclassified | 3654 |
| 537 | Ga0495674_0163574 | 3300047319 | Bacteria | 1861 |
| 538 | Ga0495674_0197549 | 3300047319 | Bacteria | 1670 |
| 539 | Ga0495674_0228058 | 3300047319 | Bacteria | 1538 |
| 540 | Ga0495676_0019102 | 3300047321 | Bacteria | 6034 |
| 541 | Ga0495680_0003049 | 3300047322 | Bacteria | 16691 |
| 542 | Ga0495680_0042468 | 3300047322 | Bacteria | 3607 |
| 543 | Ga0495680_0209344 | 3300047322 | Bacteria | 1396 |
| 544 | Ga0495675_0103944 | 3300047444 | Bacteria | 1776 |
| 545 | Ga0495675_0189455 | 3300047444 | Bacteria | 1256 |
| 546 | Ga0495684_0001338 | 3300047471 | Bacteria | 19834 |
| 547 | Ga0495684_0022155 | 3300047471 | Bacteria | 4892 |
| 548 | Ga0495684_0037796 | 3300047471 | Bacteria | 3703 |
| 549 | Ga0495684_0058611 | 3300047471 | Bacteria | 2933 |
| 550 | Ga0495684_0160452 | 3300047471 | Bacteria | 1677 |
| 551 | Ga0495684_0190973 | 3300047471 | Bacteria | 1514 |
| 552 | Ga0495684_0292158 | 3300047471 | Bacteria | 1173 |
| 553 | Ga0495602_0005196 | 3300048088 | Bacteria | 13639 |
| 554 | Ga0495602_0021680 | 3300048088 | Bacteria | 6314 |
| 555 | Ga0495602_0160439 | 3300048088 | Bacteria | 1756 |
| 556 | Ga0496100_0236953 | 3300048903 | Bacteria | 1345 |
| 557 | Ga0496114_0000011 | 3300048917 | Bacteria | 348290 |
| 558 | Ga0501067_0019173 | 3300049583 | Bacteria | 3786 |
| 559 | Ga0501068_0133030 | 3300049584 | Bacteria | 1556 |
| 560 | Ga0501075_0007778 | 3300049591 | Bacteria | 7440 |
| 561 | Ga0501077_0000356 | 3300049593 | Bacteria | 27114 |
| 562 | Ga0501080_0047736 | 3300049742 | Bacteria | 3986 |
| 563 | Ga0501081_0081951 | 3300049743 | Bacteria | 2260 |
| 564 | nmdc:mga03683_13355_c1 | 3300050489 | Bacteria | 3020 |
| 565 | nmdc:mga00v17_26006_c1 | 3300050491 | Bacteria | 3406 |
| 566 | nmdc:mga0yw44_26684_c1 | 3300050492 | Bacteria | 3302 |
| 567 | nmdc:mga0k408_10429_c1 | 3300050493 | Bacteria | 5024 |
| 568 | nmdc:mga06z11_24119_c1 | 3300050494 | Bacteria | 2866 |
| 569 | nmdc:mga05p37_313_c1 | 3300050507 | Bacteria | 51243 |
| 570 | nmdc:mga05p37_3554_c1 | 3300050507 | Bacteria | 18203 |
| 571 | nmdc:mga05p37_81636_c1 | 3300050507 | Unclassified | 3215 |
| 572 | nmdc:mga09592_14555_c1 | 3300050508 | Bacteria | 6420 |
| 573 | nmdc:mga09592_20661_c1 | 3300050508 | Bacteria | 5418 |
| 574 | nmdc:mga06r32_271238_c1 | 3300050510 | Bacteria | 1684 |
| 575 | nmdc:mga06r32_965_c1 | 3300050510 | Bacteria | 25699 |
| 576 | nmdc:mga08y16_38214_c1 | 3300050511 | Bacteria | 5042 |
| 577 | nmdc:mga08y16_39273_c1 | 3300050511 | Bacteria | 4966 |
| 578 | nmdc:mga08y16_49736_c1 | 3300050511 | Bacteria | 4386 |
| 579 | nmdc:mga0n895_47774_c1 | 3300050512 | Bacteria | 4186 |
| 580 | nmdc:mga0n895_507315_c1 | 3300050512 | Bacteria | 1215 |
| 581 | nmdc:mga0n895_587641_c1 | 3300050512 | Bacteria | 1117 |
| 582 | nmdc:mga0n895_71627_c1 | 3300050512 | Bacteria | 3437 |
| 583 | nmdc:mga0rr50_84810_c1 | 3300050513 | Unclassified | 2453 |
| 584 | nmdc:mga08x19_39_c1 | 3300050514 | Bacteria | 158844 |
| 585 | nmdc:mga08x19_4971_c1 | 3300050514 | Bacteria | 7858 |
| 586 | nmdc:mga0a205_177158_c1 | 3300050515 | Bacteria | 2027 |
| 587 | nmdc:mga0a205_3117_c2 | 3300050515 | Bacteria | 14077 |
| 588 | nmdc:mga0a205_69319_c1 | 3300050515 | Bacteria | 3405 |
| 589 | Ga0501084_0152269 | 3300054114 | Bacteria | 1950 |
| 590 | Ga0501082_0018891 | 3300060353 | Bacteria | 5938 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10278684 | Ga0157370_102786841 | 263 |
| 2 | 3300013104 | Ga0157370_10811585 | Ga0157370_108115851 | 263 |
| 3 | 3300046462 | Ga0495651_0218315 | Ga0495651_0218315_23_826 | 263 |
| 4 | 3300046529 | Ga0495652_0152311 | Ga0495652_0152311_26_829 | 263 |
| 5 | 3300005530 | Ga0070679_100319225 | Ga0070679_1003192252 | 287 |
| 6 | 3300005563 | Ga0068855_100165655 | Ga0068855_1001656552 | 287 |
| 7 | 3300009093 | Ga0105240_10022682 | Ga0105240_100226822 | 287 |
| 8 | 3300009093 | Ga0105240_10093738 | Ga0105240_100937382 | 287 |
| 9 | 3300025913 | Ga0207695_10129621 | Ga0207695_101296212 | 287 |
| 10 | 3300005843 | Ga0068860_100002569 | Ga0068860_10000256915 | 293 |
| 11 | 3300028381 | Ga0268264_10007069 | Ga0268264_100070693 | 293 |
| 12 | 3300005444 | Ga0070694_100009684 | Ga0070694_1000096844 | 302 |
| 13 | 3300046690 | Ga0495624_0216487 | Ga0495624_0216487_143_1099 | 302 |
| 14 | 3300009545 | Ga0105237_10079547 | Ga0105237_100795472 | 304 |
| 15 | 3300025914 | Ga0207671_10043137 | Ga0207671_100431372 | 304 |
| 16 | 3300005295 | Ga0065707_10129220 | Ga0065707_101292202 | 305 |
| 17 | 3300009094 | Ga0111539_10152937 | Ga0111539_101529373 | 305 |
| 18 | 3300025939 | Ga0207665_10016609 | Ga0207665_100166096 | 305 |
| 19 | 3300035172 | Ga0373955_0124159 | Ga0373955_0124159_457_1389 | 305 |
| 20 | 3300046459 | Ga0495629_0000035 | Ga0495629_0000035_110973_111905 | 305 |
| 21 | 3300046459 | Ga0495629_0111163 | Ga0495629_0111163_90_1022 | 305 |
| 22 | 3300046476 | Ga0495662_0028261 | Ga0495662_0028261_1753_2685 | 305 |
| 23 | 3300046499 | Ga0495594_0017343 | Ga0495594_0017343_595_1527 | 305 |
| 24 | 3300046663 | Ga0495635_0001362 | Ga0495635_0001362_10115_11047 | 305 |
| 25 | 3300046681 | Ga0495647_0064080 | Ga0495647_0064080_315_1247 | 305 |
| 26 | 3300046683 | Ga0495658_0000289 | Ga0495658_0000289_23199_24131 | 305 |
| 27 | 3300046683 | Ga0495658_0064070 | Ga0495658_0064070_1057_1989 | 305 |
| 28 | 3300046689 | Ga0495613_0040098 | Ga0495613_0040098_2260_3192 | 305 |
| 29 | 3300047315 | Ga0495581_0000568 | Ga0495581_0000568_16809_17741 | 305 |
| 30 | 3300047321 | Ga0495676_0019102 | Ga0495676_0019102_3127_4059 | 305 |
| 31 | 3300047322 | Ga0495680_0003049 | Ga0495680_0003049_6650_7582 | 305 |
| 32 | 3300047322 | Ga0495680_0209344 | Ga0495680_0209344_157_1089 | 305 |
| 33 | 3300050511 | nmdc:mga08y16_39273_c1 | nmdc:mga08y16_39273_c1_1149_2081 | 305 |
| 34 | 3300005364 | Ga0070673_100044869 | Ga0070673_1000448693 | 306 |
| 35 | 3300005365 | Ga0070688_100022679 | Ga0070688_1000226794 | 306 |
| 36 | 3300005563 | Ga0068855_100091750 | Ga0068855_1000917503 | 306 |
| 37 | 3300005617 | Ga0068859_100049575 | Ga0068859_1000495753 | 306 |
| 38 | 3300005617 | Ga0068859_100193471 | Ga0068859_1001934712 | 306 |
| 39 | 3300006931 | Ga0097620_100049573 | Ga0097620_1000495733 | 306 |
| 40 | 3300006931 | Ga0097620_100193472 | Ga0097620_1001934722 | 306 |
| 41 | 3300009174 | Ga0105241_10303887 | Ga0105241_103038872 | 306 |
| 42 | 3300013105 | Ga0157369_10080625 | Ga0157369_100806252 | 306 |
| 43 | 3300025913 | Ga0207695_10000789 | Ga0207695_1000078958 | 306 |
| 44 | 3300025949 | Ga0207667_10330499 | Ga0207667_103304992 | 306 |
| 45 | 3300025960 | Ga0207651_10060666 | Ga0207651_100606662 | 306 |
| 46 | 3300026116 | Ga0207674_10205869 | Ga0207674_102058692 | 306 |
| 47 | 3300028380 | Ga0268265_10061035 | Ga0268265_100610352 | 306 |
| 48 | 3300031595 | Ga0265313_10009783 | Ga0265313_100097832 | 306 |
| 49 | 3300005329 | Ga0070683_100000944 | Ga0070683_1000009444 | 307 |
| 50 | 3300005329 | Ga0070683_100001777 | Ga0070683_1000017774 | 307 |
| 51 | 3300005329 | Ga0070683_100023325 | Ga0070683_1000233256 | 307 |
| 52 | 3300005329 | Ga0070683_100055128 | Ga0070683_1000551282 | 307 |
| 53 | 3300005335 | Ga0070666_10019281 | Ga0070666_100192815 | 307 |
| 54 | 3300005338 | Ga0068868_100000476 | Ga0068868_10000047622 | 307 |
| 55 | 3300005339 | Ga0070660_100121318 | Ga0070660_1001213181 | 307 |
| 56 | 3300005340 | Ga0070689_100028952 | Ga0070689_1000289522 | 307 |
| 57 | 3300005341 | Ga0070691_10002286 | Ga0070691_100022865 | 307 |
| 58 | 3300005344 | Ga0070661_100094147 | Ga0070661_1000941472 | 307 |
| 59 | 3300005355 | Ga0070671_100041998 | Ga0070671_1000419983 | 307 |
| 60 | 3300005364 | Ga0070673_100017408 | Ga0070673_1000174084 | 307 |
| 61 | 3300005367 | Ga0070667_100016966 | Ga0070667_1000169665 | 307 |
| 62 | 3300005435 | Ga0070714_100126801 | Ga0070714_1001268012 | 307 |
| 63 | 3300005435 | Ga0070714_100585867 | Ga0070714_1005858671 | 307 |
| 64 | 3300005436 | Ga0070713_100000413 | Ga0070713_10000041320 | 307 |
| 65 | 3300005436 | Ga0070713_100045250 | Ga0070713_1000452503 | 307 |
| 66 | 3300005437 | Ga0070710_10028073 | Ga0070710_100280732 | 307 |
| 67 | 3300005439 | Ga0070711_100088689 | Ga0070711_1000886892 | 307 |
| 68 | 3300005444 | Ga0070694_100349029 | Ga0070694_1003490291 | 307 |
| 69 | 3300005445 | Ga0070708_100030146 | Ga0070708_1000301462 | 307 |
| 70 | 3300005456 | Ga0070678_100148909 | Ga0070678_1001489092 | 307 |
| 71 | 3300005458 | Ga0070681_10001138 | Ga0070681_1000113818 | 307 |
| 72 | 3300005459 | Ga0068867_100053858 | Ga0068867_1000538583 | 307 |
| 73 | 3300005467 | Ga0070706_100025236 | Ga0070706_1000252363 | 307 |
| 74 | 3300005467 | Ga0070706_100148801 | Ga0070706_1001488012 | 307 |
| 75 | 3300005518 | Ga0070699_100296601 | Ga0070699_1002966012 | 307 |
| 76 | 3300005530 | Ga0070679_100001167 | Ga0070679_1000011674 | 307 |
| 77 | 3300005535 | Ga0070684_100004866 | Ga0070684_1000048666 | 307 |
| 78 | 3300005535 | Ga0070684_100036275 | Ga0070684_1000362754 | 307 |
| 79 | 3300005535 | Ga0070684_100058093 | Ga0070684_1000580934 | 307 |
| 80 | 3300005535 | Ga0070684_100072068 | Ga0070684_1000720683 | 307 |
| 81 | 3300005539 | Ga0068853_100034323 | Ga0068853_1000343233 | 307 |
| 82 | 3300005539 | Ga0068853_100433746 | Ga0068853_1004337462 | 307 |
| 83 | 3300005543 | Ga0070672_100004478 | Ga0070672_1000044788 | 307 |
| 84 | 3300005544 | Ga0070686_100007254 | Ga0070686_1000072543 | 307 |
| 85 | 3300005563 | Ga0068855_100007475 | Ga0068855_1000074752 | 307 |
| 86 | 3300005563 | Ga0068855_100013279 | Ga0068855_1000132795 | 307 |
| 87 | 3300005563 | Ga0068855_100278951 | Ga0068855_1002789512 | 307 |
| 88 | 3300005564 | Ga0070664_100000204 | Ga0070664_10000020413 | 307 |
| 89 | 3300005577 | Ga0068857_100001209 | Ga0068857_1000012099 | 307 |
| 90 | 3300005578 | Ga0068854_100066640 | Ga0068854_1000666402 | 307 |
| 91 | 3300005614 | Ga0068856_100001334 | Ga0068856_10000133420 | 307 |
| 92 | 3300005616 | Ga0068852_100035625 | Ga0068852_1000356253 | 307 |
| 93 | 3300005617 | Ga0068859_100027194 | Ga0068859_1000271943 | 307 |
| 94 | 3300005617 | Ga0068859_100148694 | Ga0068859_1001486942 | 307 |
| 95 | 3300005618 | Ga0068864_100000738 | Ga0068864_10000073821 | 307 |
| 96 | 3300005618 | Ga0068864_100021616 | Ga0068864_1000216165 | 307 |
| 97 | 3300005618 | Ga0068864_100186907 | Ga0068864_1001869072 | 307 |
| 98 | 3300005841 | Ga0068863_100010819 | Ga0068863_1000108197 | 307 |
| 99 | 3300005841 | Ga0068863_100184459 | Ga0068863_1001844592 | 307 |
| 100 | 3300005842 | Ga0068858_100004232 | Ga0068858_1000042325 | 307 |
| 101 | 3300005842 | Ga0068858_100165417 | Ga0068858_1001654172 | 307 |
| 102 | 3300005843 | Ga0068860_100025653 | Ga0068860_1000256534 | 307 |
| 103 | 3300005843 | Ga0068860_100232199 | Ga0068860_1002321992 | 307 |
| 104 | 3300006028 | Ga0070717_10003412 | Ga0070717_100034124 | 307 |
| 105 | 3300006173 | Ga0070716_100003790 | Ga0070716_1000037904 | 307 |
| 106 | 3300006173 | Ga0070716_100026042 | Ga0070716_1000260422 | 307 |
| 107 | 3300006175 | Ga0070712_100000893 | Ga0070712_10000089310 | 307 |
| 108 | 3300006175 | Ga0070712_100001442 | Ga0070712_1000014425 | 307 |
| 109 | 3300006237 | Ga0097621_100024703 | Ga0097621_1000247034 | 307 |
| 110 | 3300006237 | Ga0097621_100066536 | Ga0097621_1000665362 | 307 |
| 111 | 3300006237 | Ga0097621_100319934 | Ga0097621_1003199342 | 307 |
| 112 | 3300006237 | Ga0097621_100359515 | Ga0097621_1003595152 | 307 |
| 113 | 3300006358 | Ga0068871_100030839 | Ga0068871_1000308395 | 307 |
| 114 | 3300006358 | Ga0068871_100242745 | Ga0068871_1002427451 | 307 |
| 115 | 3300006871 | Ga0075434_100502717 | Ga0075434_1005027171 | 307 |
| 116 | 3300006881 | Ga0068865_100095339 | Ga0068865_1000953392 | 307 |
| 117 | 3300006931 | Ga0097620_100027195 | Ga0097620_1000271953 | 307 |
| 118 | 3300006931 | Ga0097620_100148696 | Ga0097620_1001486962 | 307 |
| 119 | 3300009093 | Ga0105240_10011617 | Ga0105240_100116176 | 307 |
| 120 | 3300009093 | Ga0105240_10062281 | Ga0105240_100622813 | 307 |
| 121 | 3300009098 | Ga0105245_10002931 | Ga0105245_100029313 | 307 |
| 122 | 3300009098 | Ga0105245_10100446 | Ga0105245_101004463 | 307 |
| 123 | 3300009098 | Ga0105245_10200331 | Ga0105245_102003312 | 307 |
| 124 | 3300009098 | Ga0105245_10400432 | Ga0105245_104004322 | 307 |
| 125 | 3300009148 | Ga0105243_10261947 | Ga0105243_102619472 | 307 |
| 126 | 3300009148 | Ga0105243_10321920 | Ga0105243_103219202 | 307 |
| 127 | 3300009148 | Ga0105243_10503144 | Ga0105243_105031442 | 307 |
| 128 | 3300009174 | Ga0105241_10011888 | Ga0105241_100118884 | 307 |
| 129 | 3300009174 | Ga0105241_10087895 | Ga0105241_100878952 | 307 |
| 130 | 3300009174 | Ga0105241_10495924 | Ga0105241_104959242 | 307 |
| 131 | 3300009174 | Ga0105241_10534847 | Ga0105241_105348472 | 307 |
| 132 | 3300009176 | Ga0105242_10016280 | Ga0105242_100162805 | 307 |
| 133 | 3300009176 | Ga0105242_10035147 | Ga0105242_100351474 | 307 |
| 134 | 3300009176 | Ga0105242_10416250 | Ga0105242_104162501 | 307 |
| 135 | 3300009177 | Ga0105248_10001595 | Ga0105248_100015954 | 307 |
| 136 | 3300009177 | Ga0105248_10051373 | Ga0105248_100513734 | 307 |
| 137 | 3300009177 | Ga0105248_10202645 | Ga0105248_102026452 | 307 |
| 138 | 3300009177 | Ga0105248_10360395 | Ga0105248_103603952 | 307 |
| 139 | 3300009545 | Ga0105237_10016662 | Ga0105237_100166624 | 307 |
| 140 | 3300009545 | Ga0105237_10024726 | Ga0105237_100247263 | 307 |
| 141 | 3300009545 | Ga0105237_10127964 | Ga0105237_101279642 | 307 |
| 142 | 3300009551 | Ga0105238_10002683 | Ga0105238_100026834 | 307 |
| 143 | 3300009551 | Ga0105238_10038145 | Ga0105238_100381452 | 307 |
| 144 | 3300009551 | Ga0105238_10105987 | Ga0105238_101059872 | 307 |
| 145 | 3300009551 | Ga0105238_10133009 | Ga0105238_101330092 | 307 |
| 146 | 3300010375 | Ga0105239_10009479 | Ga0105239_100094793 | 307 |
| 147 | 3300010375 | Ga0105239_10039974 | Ga0105239_100399744 | 307 |
| 148 | 3300011119 | Ga0105246_10014199 | Ga0105246_100141994 | 307 |
| 149 | 3300013104 | Ga0157370_10010552 | Ga0157370_100105526 | 307 |
| 150 | 3300013104 | Ga0157370_10018572 | Ga0157370_100185723 | 307 |
| 151 | 3300013105 | Ga0157369_10012340 | Ga0157369_100123404 | 307 |
| 152 | 3300013105 | Ga0157369_10031304 | Ga0157369_100313044 | 307 |
| 153 | 3300013105 | Ga0157369_10066392 | Ga0157369_100663923 | 307 |
| 154 | 3300013296 | Ga0157374_10006261 | Ga0157374_100062614 | 307 |
| 155 | 3300013296 | Ga0157374_10076946 | Ga0157374_100769462 | 307 |
| 156 | 3300013296 | Ga0157374_10158377 | Ga0157374_101583771 | 307 |
| 157 | 3300013297 | Ga0157378_10072565 | Ga0157378_100725652 | 307 |
| 158 | 3300013297 | Ga0157378_10267362 | Ga0157378_102673622 | 307 |
| 159 | 3300013306 | Ga0163162_10002444 | Ga0163162_1000244410 | 307 |
| 160 | 3300013306 | Ga0163162_10764339 | Ga0163162_107643392 | 307 |
| 161 | 3300013307 | Ga0157372_10003092 | Ga0157372_100030924 | 307 |
| 162 | 3300013307 | Ga0157372_10179286 | Ga0157372_101792863 | 307 |
| 163 | 3300013308 | Ga0157375_10057940 | Ga0157375_100579402 | 307 |
| 164 | 3300013308 | Ga0157375_10157345 | Ga0157375_101573452 | 307 |
| 165 | 3300014325 | Ga0163163_10016359 | Ga0163163_100163594 | 307 |
| 166 | 3300014325 | Ga0163163_10030465 | Ga0163163_100304654 | 307 |
| 167 | 3300014325 | Ga0163163_10056418 | Ga0163163_100564184 | 307 |
| 168 | 3300014325 | Ga0163163_10147316 | Ga0163163_101473163 | 307 |
| 169 | 3300014969 | Ga0157376_10036831 | Ga0157376_100368312 | 307 |
| 170 | 3300014969 | Ga0157376_10343933 | Ga0157376_103439332 | 307 |
| 171 | 3300021358 | Ga0213873_10018202 | Ga0213873_100182022 | 307 |
| 172 | 3300025903 | Ga0207680_10008748 | Ga0207680_100087482 | 307 |
| 173 | 3300025906 | Ga0207699_10000715 | Ga0207699_100007157 | 307 |
| 174 | 3300025906 | Ga0207699_10006244 | Ga0207699_100062443 | 307 |
| 175 | 3300025910 | Ga0207684_10033080 | Ga0207684_100330802 | 307 |
| 176 | 3300025911 | Ga0207654_10006021 | Ga0207654_100060214 | 307 |
| 177 | 3300025911 | Ga0207654_10312280 | Ga0207654_103122801 | 307 |
| 178 | 3300025912 | Ga0207707_10002195 | Ga0207707_1000219513 | 307 |
| 179 | 3300025913 | Ga0207695_10000768 | Ga0207695_1000076814 | 307 |
| 180 | 3300025913 | Ga0207695_10073553 | Ga0207695_100735533 | 307 |
| 181 | 3300025914 | Ga0207671_10037938 | Ga0207671_100379384 | 307 |
| 182 | 3300025914 | Ga0207671_10165531 | Ga0207671_101655312 | 307 |
| 183 | 3300025915 | Ga0207693_10000108 | Ga0207693_1000010836 | 307 |
| 184 | 3300025915 | Ga0207693_10015198 | Ga0207693_100151984 | 307 |
| 185 | 3300025916 | Ga0207663_10084339 | Ga0207663_100843392 | 307 |
| 186 | 3300025917 | Ga0207660_10113703 | Ga0207660_101137032 | 307 |
| 187 | 3300025919 | Ga0207657_10121916 | Ga0207657_101219163 | 307 |
| 188 | 3300025920 | Ga0207649_10036108 | Ga0207649_100361083 | 307 |
| 189 | 3300025920 | Ga0207649_10113732 | Ga0207649_101137322 | 307 |
| 190 | 3300025921 | Ga0207652_10001481 | Ga0207652_1000148115 | 307 |
| 191 | 3300025924 | Ga0207694_10002477 | Ga0207694_100024772 | 307 |
| 192 | 3300025924 | Ga0207694_10003769 | Ga0207694_100037693 | 307 |
| 193 | 3300025924 | Ga0207694_10016496 | Ga0207694_100164964 | 307 |
| 194 | 3300025924 | Ga0207694_10082371 | Ga0207694_100823713 | 307 |
| 195 | 3300025924 | Ga0207694_10373494 | Ga0207694_103734941 | 307 |
| 196 | 3300025925 | Ga0207650_10001625 | Ga0207650_100016256 | 307 |
| 197 | 3300025927 | Ga0207687_10010708 | Ga0207687_100107084 | 307 |
| 198 | 3300025927 | Ga0207687_10023066 | Ga0207687_100230663 | 307 |
| 199 | 3300025927 | Ga0207687_10068590 | Ga0207687_100685902 | 307 |
| 200 | 3300025927 | Ga0207687_10082323 | Ga0207687_100823233 | 307 |
| 201 | 3300025928 | Ga0207700_10004544 | Ga0207700_100045447 | 307 |
| 202 | 3300025928 | Ga0207700_10005144 | Ga0207700_100051447 | 307 |
| 203 | 3300025928 | Ga0207700_10027875 | Ga0207700_100278752 | 307 |
| 204 | 3300025929 | Ga0207664_10048768 | Ga0207664_100487684 | 307 |
| 205 | 3300025929 | Ga0207664_10135579 | Ga0207664_101355792 | 307 |
| 206 | 3300025931 | Ga0207644_10013545 | Ga0207644_100135453 | 307 |
| 207 | 3300025934 | Ga0207686_10189956 | Ga0207686_101899562 | 307 |
| 208 | 3300025935 | Ga0207709_10083180 | Ga0207709_100831802 | 307 |
| 209 | 3300025935 | Ga0207709_10086840 | Ga0207709_100868402 | 307 |
| 210 | 3300025938 | Ga0207704_10224185 | Ga0207704_102241851 | 307 |
| 211 | 3300025938 | Ga0207704_10252890 | Ga0207704_102528902 | 307 |
| 212 | 3300025939 | Ga0207665_10001840 | Ga0207665_100018409 | 307 |
| 213 | 3300025939 | Ga0207665_10083472 | Ga0207665_100834723 | 307 |
| 214 | 3300025940 | Ga0207691_10009274 | Ga0207691_100092743 | 307 |
| 215 | 3300025940 | Ga0207691_10375972 | Ga0207691_103759721 | 307 |
| 216 | 3300025941 | Ga0207711_10005417 | Ga0207711_100054176 | 307 |
| 217 | 3300025941 | Ga0207711_10089791 | Ga0207711_100897913 | 307 |
| 218 | 3300025942 | Ga0207689_10068240 | Ga0207689_100682402 | 307 |
| 219 | 3300025944 | Ga0207661_10001936 | Ga0207661_100019369 | 307 |
| 220 | 3300025944 | Ga0207661_10011769 | Ga0207661_100117693 | 307 |
| 221 | 3300025944 | Ga0207661_10035478 | Ga0207661_100354784 | 307 |
| 222 | 3300025945 | Ga0207679_10007116 | Ga0207679_100071167 | 307 |
| 223 | 3300025949 | Ga0207667_10002519 | Ga0207667_100025194 | 307 |
| 224 | 3300025949 | Ga0207667_10020639 | Ga0207667_100206395 | 307 |
| 225 | 3300025949 | Ga0207667_10242856 | Ga0207667_102428562 | 307 |
| 226 | 3300025960 | Ga0207651_10008592 | Ga0207651_100085926 | 307 |
| 227 | 3300025981 | Ga0207640_10065668 | Ga0207640_100656682 | 307 |
| 228 | 3300026023 | Ga0207677_10001963 | Ga0207677_100019635 | 307 |
| 229 | 3300026035 | Ga0207703_10023698 | Ga0207703_100236987 | 307 |
| 230 | 3300026035 | Ga0207703_10298129 | Ga0207703_102981292 | 307 |
| 231 | 3300026041 | Ga0207639_10180038 | Ga0207639_101800382 | 307 |
| 232 | 3300026078 | Ga0207702_10008454 | Ga0207702_100084543 | 307 |
| 233 | 3300026078 | Ga0207702_10129825 | Ga0207702_101298252 | 307 |
| 234 | 3300026089 | Ga0207648_10084079 | Ga0207648_100840792 | 307 |
| 235 | 3300026095 | Ga0207676_10008022 | Ga0207676_100080225 | 307 |
| 236 | 3300026095 | Ga0207676_10168185 | Ga0207676_101681852 | 307 |
| 237 | 3300026095 | Ga0207676_10255315 | Ga0207676_102553152 | 307 |
| 238 | 3300026116 | Ga0207674_10000072 | Ga0207674_1000007237 | 307 |
| 239 | 3300026116 | Ga0207674_10025920 | Ga0207674_100259205 | 307 |
| 240 | 3300026142 | Ga0207698_10009064 | Ga0207698_100090644 | 307 |
| 241 | 3300028017 | Ga0265356_1009368 | Ga0265356_10093681 | 307 |
| 242 | 3300028381 | Ga0268264_10056279 | Ga0268264_100562792 | 307 |
| 243 | 3300028800 | Ga0265338_10043786 | Ga0265338_100437862 | 307 |
| 244 | 3300030760 | Ga0265762_1000133 | Ga0265762_10001337 | 307 |
| 245 | 3300031247 | Ga0265340_10095903 | Ga0265340_100959032 | 307 |
| 246 | 3300031711 | Ga0265314_10009360 | Ga0265314_100093602 | 307 |
| 247 | 3300035086 | Ga0373934_0004171 | Ga0373934_0004171_4114_5052 | 307 |
| 248 | 3300035118 | Ga0373954_0007913 | Ga0373954_0007913_2855_3793 | 307 |
| 249 | 3300035172 | Ga0373955_0013608 | Ga0373955_0013608_2537_3475 | 307 |
| 250 | 3300035172 | Ga0373955_0016763 | Ga0373955_0016763_261_1199 | 307 |
| 251 | 3300035725 | Ga0373947_0178958 | Ga0373947_0178958_312_1250 | 307 |
| 252 | 3300036401 | Ga0373937_0001861 | Ga0373937_0001861_13376_14314 | 307 |
| 253 | 3300036401 | Ga0373937_0002150 | Ga0373937_0002150_13594_14532 | 307 |
| 254 | 3300036401 | Ga0373937_0003162 | Ga0373937_0003162_3506_4465 | 307 |
| 255 | 3300036401 | Ga0373937_0053373 | Ga0373937_0053373_166_1104 | 307 |
| 256 | 3300039453 | Ga0436362_0058380 | Ga0436362_0058380_422_1354 | 307 |
| 257 | 3300046454 | Ga0495592_0005305 | Ga0495592_0005305_5807_6745 | 307 |
| 258 | 3300046459 | Ga0495629_0040001 | Ga0495629_0040001_792_1730 | 307 |
| 259 | 3300046459 | Ga0495629_0319557 | Ga0495629_0319557_23_961 | 307 |
| 260 | 3300046473 | Ga0495582_0033029 | Ga0495582_0033029_1710_2660 | 307 |
| 261 | 3300046476 | Ga0495662_0035473 | Ga0495662_0035473_22_960 | 307 |
| 262 | 3300046499 | Ga0495594_0046943 | Ga0495594_0046943_369_1307 | 307 |
| 263 | 3300046499 | Ga0495594_0190067 | Ga0495594_0190067_67_1017 | 307 |
| 264 | 3300046514 | Ga0495618_0094981 | Ga0495618_0094981_222_1160 | 307 |
| 265 | 3300046529 | Ga0495652_0063979 | Ga0495652_0063979_359_1297 | 307 |
| 266 | 3300046536 | Ga0495587_0029341 | Ga0495587_0029341_1362_2321 | 307 |
| 267 | 3300046559 | Ga0495667_0001172 | Ga0495667_0001172_13683_14621 | 307 |
| 268 | 3300046675 | Ga0495657_0000805 | Ga0495657_0000805_9190_10128 | 307 |
| 269 | 3300046678 | Ga0495599_0029754 | Ga0495599_0029754_1825_2763 | 307 |
| 270 | 3300046678 | Ga0495599_0061610 | Ga0495599_0061610_1276_2214 | 307 |
| 271 | 3300046681 | Ga0495647_0034330 | Ga0495647_0034330_310_1248 | 307 |
| 272 | 3300046683 | Ga0495658_0213526 | Ga0495658_0213526_157_1095 | 307 |
| 273 | 3300046689 | Ga0495613_0005125 | Ga0495613_0005125_2898_3836 | 307 |
| 274 | 3300046689 | Ga0495613_0177567 | Ga0495613_0177567_11_949 | 307 |
| 275 | 3300046689 | Ga0495613_0307884 | Ga0495613_0307884_24_962 | 307 |
| 276 | 3300047318 | Ga0495636_0058105 | Ga0495636_0058105_122_1060 | 307 |
| 277 | 3300047319 | Ga0495674_0050886 | Ga0495674_0050886_1129_2067 | 307 |
| 278 | 3300047319 | Ga0495674_0228058 | Ga0495674_0228058_573_1523 | 307 |
| 279 | 3300047471 | Ga0495684_0022155 | Ga0495684_0022155_887_1825 | 307 |
| 280 | 3300047471 | Ga0495684_0037796 | Ga0495684_0037796_1787_2725 | 307 |
| 281 | 3300047471 | Ga0495684_0190973 | Ga0495684_0190973_119_1057 | 307 |
| 282 | 3300047471 | Ga0495684_0292158 | Ga0495684_0292158_203_1141 | 307 |
| 283 | 3300048088 | Ga0495602_0005196 | Ga0495602_0005196_10735_11694 | 307 |
| 284 | 3300048903 | Ga0496100_0236953 | Ga0496100_0236953_334_1272 | 307 |
| 285 | 3300049743 | Ga0501081_0081951 | Ga0501081_0081951_660_1592 | 307 |
| 286 | 3300050512 | nmdc:mga0n895_587641_c1 | nmdc:mga0n895_587641_c1_111_1049 | 307 |
| 287 | 3300005367 | Ga0070667_100398714 | Ga0070667_1003987142 | 308 |
| 288 | 3300006914 | Ga0075436_100071715 | Ga0075436_1000717152 | 308 |
| 289 | 3300009177 | Ga0105248_10125138 | Ga0105248_101251382 | 308 |
| 290 | 3300025913 | Ga0207695_10071430 | Ga0207695_100714303 | 308 |
| 291 | 3300025941 | Ga0207711_10093531 | Ga0207711_100935312 | 308 |
| 292 | 3300026035 | Ga0207703_10221055 | Ga0207703_102210552 | 308 |
| 293 | 3300028556 | Ga0265337_1048679 | Ga0265337_10486792 | 308 |
| 294 | 3300028800 | Ga0265338_10017405 | Ga0265338_100174052 | 308 |
| 295 | 3300028800 | Ga0265338_10086478 | Ga0265338_100864783 | 308 |
| 296 | 3300031090 | Ga0265760_10018651 | Ga0265760_100186512 | 308 |
| 297 | 3300031238 | Ga0265332_10035138 | Ga0265332_100351381 | 308 |
| 298 | 3300031344 | Ga0265316_10147125 | Ga0265316_101471252 | 308 |
| 299 | 3300035692 | Ga0373935_0015647 | Ga0373935_0015647_1844_2794 | 308 |
| 300 | 3300035695 | Ga0373927_0007055 | Ga0373927_0007055_5248_6201 | 308 |
| 301 | 3300042876 | Ga0451577_0015547 | Ga0451577_0015547_1434_2393 | 308 |
| 302 | 3300045051 | Ga0451576_0051507 | Ga0451576_0051507_3120_4061 | 308 |
| 303 | 3300046642 | Ga0495634_0034461 | Ga0495634_0034461_78_1019 | 308 |
| 304 | 3300050512 | nmdc:mga0n895_47774_c1 | nmdc:mga0n895_47774_c1_2571_3518 | 308 |
| 305 | 3300050514 | nmdc:mga08x19_4971_c1 | nmdc:mga08x19_4971_c1_5648_6595 | 308 |
| 306 | 3300005436 | Ga0070713_100046629 | Ga0070713_1000466294 | 309 |
| 307 | 3300005439 | Ga0070711_100145102 | Ga0070711_1001451022 | 309 |
| 308 | 3300006881 | Ga0068865_100043585 | Ga0068865_1000435853 | 309 |
| 309 | 3300009098 | Ga0105245_10204340 | Ga0105245_102043402 | 309 |
| 310 | 3300009545 | Ga0105237_10027240 | Ga0105237_100272404 | 309 |
| 311 | 3300009551 | Ga0105238_10024681 | Ga0105238_100246814 | 309 |
| 312 | 3300014325 | Ga0163163_10012832 | Ga0163163_100128324 | 309 |
| 313 | 3300025913 | Ga0207695_10034350 | Ga0207695_100343505 | 309 |
| 314 | 3300025916 | Ga0207663_10065313 | Ga0207663_100653132 | 309 |
| 315 | 3300025924 | Ga0207694_10033293 | Ga0207694_100332933 | 309 |
| 316 | 3300025938 | Ga0207704_10148410 | Ga0207704_101484102 | 309 |
| 317 | 3300028379 | Ga0268266_10058649 | Ga0268266_100586492 | 309 |
| 318 | 3300028381 | Ga0268264_10409214 | Ga0268264_104092142 | 309 |
| 319 | 3300028800 | Ga0265338_10003647 | Ga0265338_1000364714 | 309 |
| 320 | 3300031249 | Ga0265339_10147259 | Ga0265339_101472591 | 309 |
| 321 | 3300005364 | Ga0070673_100196175 | Ga0070673_1001961752 | 310 |
| 322 | 3300005617 | Ga0068859_100306994 | Ga0068859_1003069942 | 310 |
| 323 | 3300006028 | Ga0070717_10010368 | Ga0070717_100103682 | 310 |
| 324 | 3300006931 | Ga0097620_100306983 | Ga0097620_1003069832 | 310 |
| 325 | 3300009094 | Ga0111539_10407522 | Ga0111539_104075222 | 310 |
| 326 | 3300009177 | Ga0105248_10257940 | Ga0105248_102579401 | 310 |
| 327 | 3300013306 | Ga0163162_10499210 | Ga0163162_104992101 | 310 |
| 328 | 3300014969 | Ga0157376_10088729 | Ga0157376_100887292 | 310 |
| 329 | 3300014969 | Ga0157376_10484256 | Ga0157376_104842562 | 310 |
| 330 | 3300025941 | Ga0207711_10498922 | Ga0207711_104989221 | 310 |
| 331 | 3300025960 | Ga0207651_10170412 | Ga0207651_101704122 | 310 |
| 332 | 3300026088 | Ga0207641_10065204 | Ga0207641_100652042 | 310 |
| 333 | 3300026088 | Ga0207641_10109940 | Ga0207641_101099402 | 310 |
| 334 | 3300035725 | Ga0373947_0105702 | Ga0373947_0105702_252_1196 | 310 |
| 335 | 3300036401 | Ga0373937_0106917 | Ga0373937_0106917_1638_2582 | 310 |
| 336 | 3300041505 | Ga0451849_1474294 | Ga0451849_1474294_564_1511 | 310 |
| 337 | 3300045051 | Ga0451576_0499113 | Ga0451576_0499113_195_1151 | 310 |
| 338 | 3300046459 | Ga0495629_0152578 | Ga0495629_0152578_270_1238 | 310 |
| 339 | 3300046462 | Ga0495651_0031116 | Ga0495651_0031116_879_1847 | 310 |
| 340 | 3300046462 | Ga0495651_0092374 | Ga0495651_0092374_724_1668 | 310 |
| 341 | 3300046472 | Ga0495580_0002919 | Ga0495580_0002919_8170_9138 | 310 |
| 342 | 3300046476 | Ga0495662_0014396 | Ga0495662_0014396_1259_2203 | 310 |
| 343 | 3300046477 | Ga0495664_0185993 | Ga0495664_0185993_201_1145 | 310 |
| 344 | 3300046511 | Ga0495608_0053321 | Ga0495608_0053321_1370_2314 | 310 |
| 345 | 3300046516 | Ga0495628_0090609 | Ga0495628_0090609_273_1217 | 310 |
| 346 | 3300046529 | Ga0495652_0065122 | Ga0495652_0065122_1864_2808 | 310 |
| 347 | 3300046529 | Ga0495652_0109323 | Ga0495652_0109323_26_994 | 310 |
| 348 | 3300046531 | Ga0495665_0063480 | Ga0495665_0063480_478_1422 | 310 |
| 349 | 3300046533 | Ga0495640_0134316 | Ga0495640_0134316_635_1579 | 310 |
| 350 | 3300046536 | Ga0495587_0018019 | Ga0495587_0018019_1805_2749 | 310 |
| 351 | 3300046536 | Ga0495587_0232956 | Ga0495587_0232956_59_1015 | 310 |
| 352 | 3300046543 | Ga0495645_0008623 | Ga0495645_0008623_1649_2593 | 310 |
| 353 | 3300046543 | Ga0495645_0043479 | Ga0495645_0043479_1274_2218 | 310 |
| 354 | 3300046559 | Ga0495667_0009119 | Ga0495667_0009119_1840_2808 | 310 |
| 355 | 3300046559 | Ga0495667_0081597 | Ga0495667_0081597_553_1497 | 310 |
| 356 | 3300046559 | Ga0495667_0087264 | Ga0495667_0087264_25_969 | 310 |
| 357 | 3300046642 | Ga0495634_0027000 | Ga0495634_0027000_1938_2882 | 310 |
| 358 | 3300046675 | Ga0495657_0144569 | Ga0495657_0144569_345_1289 | 310 |
| 359 | 3300046678 | Ga0495599_0037075 | Ga0495599_0037075_191_1135 | 310 |
| 360 | 3300046679 | Ga0495623_0009717 | Ga0495623_0009717_141_1109 | 310 |
| 361 | 3300046679 | Ga0495623_0084200 | Ga0495623_0084200_822_1766 | 310 |
| 362 | 3300046679 | Ga0495623_0174739 | Ga0495623_0174739_207_1151 | 310 |
| 363 | 3300046689 | Ga0495613_0039834 | Ga0495613_0039834_1939_2883 | 310 |
| 364 | 3300046809 | Ga0495600_0210663 | Ga0495600_0210663_184_1128 | 310 |
| 365 | 3300047317 | Ga0495604_0045331 | Ga0495604_0045331_651_1619 | 310 |
| 366 | 3300047319 | Ga0495674_0046953 | Ga0495674_0046953_1936_2880 | 310 |
| 367 | 3300047319 | Ga0495674_0163574 | Ga0495674_0163574_860_1804 | 310 |
| 368 | 3300047319 | Ga0495674_0197549 | Ga0495674_0197549_699_1643 | 310 |
| 369 | 3300047322 | Ga0495680_0042468 | Ga0495680_0042468_624_1568 | 310 |
| 370 | 3300047444 | Ga0495675_0103944 | Ga0495675_0103944_51_1007 | 310 |
| 371 | 3300047444 | Ga0495675_0189455 | Ga0495675_0189455_35_979 | 310 |
| 372 | 3300047471 | Ga0495684_0001338 | Ga0495684_0001338_4131_5099 | 310 |
| 373 | 3300047471 | Ga0495684_0058611 | Ga0495684_0058611_97_1041 | 310 |
| 374 | 3300047471 | Ga0495684_0160452 | Ga0495684_0160452_645_1589 | 310 |
| 375 | 3300048088 | Ga0495602_0021680 | Ga0495602_0021680_645_1613 | 310 |
| 376 | 3300048088 | Ga0495602_0160439 | Ga0495602_0160439_635_1579 | 310 |
| 377 | 3300005331 | Ga0070670_100045892 | Ga0070670_1000458925 | 311 |
| 378 | 3300005347 | Ga0070668_100220827 | Ga0070668_1002208272 | 311 |
| 379 | 3300005353 | Ga0070669_100116165 | Ga0070669_1001161652 | 311 |
| 380 | 3300005354 | Ga0070675_100000232 | Ga0070675_1000002325 | 311 |
| 381 | 3300005354 | Ga0070675_100020829 | Ga0070675_1000208296 | 311 |
| 382 | 3300005355 | Ga0070671_100021731 | Ga0070671_1000217314 | 311 |
| 383 | 3300005355 | Ga0070671_100306270 | Ga0070671_1003062702 | 311 |
| 384 | 3300005356 | Ga0070674_100019822 | Ga0070674_1000198221 | 311 |
| 385 | 3300005364 | Ga0070673_100003259 | Ga0070673_1000032597 | 311 |
| 386 | 3300005367 | Ga0070667_100021308 | Ga0070667_1000213083 | 311 |
| 387 | 3300005445 | Ga0070708_100022211 | Ga0070708_1000222114 | 311 |
| 388 | 3300005445 | Ga0070708_100106479 | Ga0070708_1001064792 | 311 |
| 389 | 3300005459 | Ga0068867_100041415 | Ga0068867_1000414153 | 311 |
| 390 | 3300005459 | Ga0068867_100106341 | Ga0068867_1001063412 | 311 |
| 391 | 3300005466 | Ga0070685_10011334 | Ga0070685_100113344 | 311 |
| 392 | 3300005543 | Ga0070672_100032800 | Ga0070672_1000328004 | 311 |
| 393 | 3300005543 | Ga0070672_100155943 | Ga0070672_1001559432 | 311 |
| 394 | 3300005544 | Ga0070686_100056532 | Ga0070686_1000565322 | 311 |
| 395 | 3300005544 | Ga0070686_100090915 | Ga0070686_1000909152 | 311 |
| 396 | 3300005549 | Ga0070704_100170643 | Ga0070704_1001706432 | 311 |
| 397 | 3300005577 | Ga0068857_100297767 | Ga0068857_1002977672 | 311 |
| 398 | 3300005617 | Ga0068859_100013583 | Ga0068859_1000135836 | 311 |
| 399 | 3300005618 | Ga0068864_100283606 | Ga0068864_1002836062 | 311 |
| 400 | 3300005840 | Ga0068870_10030695 | Ga0068870_100306952 | 311 |
| 401 | 3300005841 | Ga0068863_100002245 | Ga0068863_10000224510 | 311 |
| 402 | 3300005841 | Ga0068863_100038929 | Ga0068863_1000389292 | 311 |
| 403 | 3300005842 | Ga0068858_100076564 | Ga0068858_1000765643 | 311 |
| 404 | 3300005842 | Ga0068858_100113081 | Ga0068858_1001130812 | 311 |
| 405 | 3300005843 | Ga0068860_100007134 | Ga0068860_1000071349 | 311 |
| 406 | 3300005844 | Ga0068862_100025939 | Ga0068862_1000259392 | 311 |
| 407 | 3300005844 | Ga0068862_100050568 | Ga0068862_1000505683 | 311 |
| 408 | 3300006038 | Ga0075365_10016699 | Ga0075365_100166993 | 311 |
| 409 | 3300006042 | Ga0075368_10037287 | Ga0075368_100372872 | 311 |
| 410 | 3300006051 | Ga0075364_10019845 | Ga0075364_100198453 | 311 |
| 411 | 3300006051 | Ga0075364_10022064 | Ga0075364_100220644 | 311 |
| 412 | 3300006177 | Ga0075362_10017713 | Ga0075362_100177133 | 311 |
| 413 | 3300006178 | Ga0075367_10002237 | Ga0075367_100022374 | 311 |
| 414 | 3300006195 | Ga0075366_10000973 | Ga0075366_100009735 | 311 |
| 415 | 3300006237 | Ga0097621_100018223 | Ga0097621_1000182234 | 311 |
| 416 | 3300006358 | Ga0068871_100076468 | Ga0068871_1000764682 | 311 |
| 417 | 3300006844 | Ga0075428_100036814 | Ga0075428_1000368144 | 311 |
| 418 | 3300006847 | Ga0075431_100015868 | Ga0075431_1000158685 | 311 |
| 419 | 3300006847 | Ga0075431_100380951 | Ga0075431_1003809512 | 311 |
| 420 | 3300006871 | Ga0075434_100048548 | Ga0075434_1000485484 | 311 |
| 421 | 3300006881 | Ga0068865_100042805 | Ga0068865_1000428053 | 311 |
| 422 | 3300006931 | Ga0097620_100013583 | Ga0097620_1000135833 | 311 |
| 423 | 3300007076 | Ga0075435_100073906 | Ga0075435_1000739062 | 311 |
| 424 | 3300009094 | Ga0111539_10003069 | Ga0111539_100030695 | 311 |
| 425 | 3300009098 | Ga0105245_10119641 | Ga0105245_101196412 | 311 |
| 426 | 3300009148 | Ga0105243_10039903 | Ga0105243_100399032 | 311 |
| 427 | 3300009176 | Ga0105242_10057251 | Ga0105242_100572512 | 311 |
| 428 | 3300009177 | Ga0105248_10000562 | Ga0105248_100005624 | 311 |
| 429 | 3300009177 | Ga0105248_10037993 | Ga0105248_100379934 | 311 |
| 430 | 3300009553 | Ga0105249_10040144 | Ga0105249_100401443 | 311 |
| 431 | 3300011119 | Ga0105246_10106680 | Ga0105246_101066802 | 311 |
| 432 | 3300013296 | Ga0157374_10038933 | Ga0157374_100389332 | 311 |
| 433 | 3300013297 | Ga0157378_10111951 | Ga0157378_101119513 | 311 |
| 434 | 3300013306 | Ga0163162_10000995 | Ga0163162_100009957 | 311 |
| 435 | 3300013306 | Ga0163162_10340480 | Ga0163162_103404802 | 311 |
| 436 | 3300013308 | Ga0157375_10004297 | Ga0157375_100042974 | 311 |
| 437 | 3300013308 | Ga0157375_10144400 | Ga0157375_101444002 | 311 |
| 438 | 3300014325 | Ga0163163_10007949 | Ga0163163_100079497 | 311 |
| 439 | 3300014326 | Ga0157380_10382664 | Ga0157380_103826641 | 311 |
| 440 | 3300014968 | Ga0157379_10000277 | Ga0157379_1000027741 | 311 |
| 441 | 3300017792 | Ga0163161_10066834 | Ga0163161_100668342 | 311 |
| 442 | 3300025903 | Ga0207680_10021498 | Ga0207680_100214984 | 311 |
| 443 | 3300025908 | Ga0207643_10009998 | Ga0207643_100099982 | 311 |
| 444 | 3300025910 | Ga0207684_10229641 | Ga0207684_102296412 | 311 |
| 445 | 3300025913 | Ga0207695_10011181 | Ga0207695_100111813 | 311 |
| 446 | 3300025918 | Ga0207662_10010850 | Ga0207662_100108503 | 311 |
| 447 | 3300025925 | Ga0207650_10014064 | Ga0207650_100140643 | 311 |
| 448 | 3300025926 | Ga0207659_10001985 | Ga0207659_100019859 | 311 |
| 449 | 3300025926 | Ga0207659_10004565 | Ga0207659_100045658 | 311 |
| 450 | 3300025931 | Ga0207644_10013348 | Ga0207644_100133482 | 311 |
| 451 | 3300025933 | Ga0207706_10505370 | Ga0207706_105053701 | 311 |
| 452 | 3300025935 | Ga0207709_10107526 | Ga0207709_101075262 | 311 |
| 453 | 3300025938 | Ga0207704_10067114 | Ga0207704_100671142 | 311 |
| 454 | 3300025940 | Ga0207691_10102531 | Ga0207691_101025312 | 311 |
| 455 | 3300025940 | Ga0207691_10182177 | Ga0207691_101821772 | 311 |
| 456 | 3300025941 | Ga0207711_10001521 | Ga0207711_1000152110 | 311 |
| 457 | 3300025942 | Ga0207689_10123920 | Ga0207689_101239203 | 311 |
| 458 | 3300025960 | Ga0207651_10007268 | Ga0207651_100072683 | 311 |
| 459 | 3300025961 | Ga0207712_10096161 | Ga0207712_100961613 | 311 |
| 460 | 3300025986 | Ga0207658_10006343 | Ga0207658_100063436 | 311 |
| 461 | 3300026023 | Ga0207677_10134880 | Ga0207677_101348802 | 311 |
| 462 | 3300026035 | Ga0207703_10035135 | Ga0207703_100351352 | 311 |
| 463 | 3300026035 | Ga0207703_10419345 | Ga0207703_104193452 | 311 |
| 464 | 3300026067 | Ga0207678_10036717 | Ga0207678_100367174 | 311 |
| 465 | 3300026075 | Ga0207708_10021580 | Ga0207708_100215803 | 311 |
| 466 | 3300026088 | Ga0207641_10015607 | Ga0207641_100156074 | 311 |
| 467 | 3300026089 | Ga0207648_10004080 | Ga0207648_100040806 | 311 |
| 468 | 3300026089 | Ga0207648_10121295 | Ga0207648_101212952 | 311 |
| 469 | 3300026116 | Ga0207674_10288045 | Ga0207674_102880454 | 311 |
| 470 | 3300026121 | Ga0207683_10026551 | Ga0207683_100265514 | 311 |
| 471 | 3300027907 | Ga0207428_10000311 | Ga0207428_100003116 | 311 |
| 472 | 3300027907 | Ga0207428_10018382 | Ga0207428_100183824 | 311 |
| 473 | 3300028380 | Ga0268265_10039013 | Ga0268265_100390133 | 311 |
| 474 | 3300028380 | Ga0268265_10055000 | Ga0268265_100550002 | 311 |
| 475 | 3300028381 | Ga0268264_10003384 | Ga0268264_1000338413 | 311 |
| 476 | 3300028381 | Ga0268264_10028839 | Ga0268264_100288393 | 311 |
| 477 | 3300042876 | Ga0451577_0004594 | Ga0451577_0004594_9517_10470 | 311 |
| 478 | 3300044694 | Ga0466963_0190448 | Ga0466963_0190448_163_1119 | 311 |
| 479 | 3300044712 | Ga0453684_0221537 | Ga0453684_0221537_66_1013 | 311 |
| 480 | 3300046475 | Ga0495639_0082077 | Ga0495639_0082077_356_1303 | 311 |
| 481 | 3300046692 | Ga0495671_0118441 | Ga0495671_0118441_53_1000 | 311 |
| 482 | 3300050489 | nmdc:mga03683_13355_c1 | nmdc:mga03683_13355_c1_1398_2345 | 311 |
| 483 | 3300050491 | nmdc:mga00v17_26006_c1 | nmdc:mga00v17_26006_c1_925_1872 | 311 |
| 484 | 3300050492 | nmdc:mga0yw44_26684_c1 | nmdc:mga0yw44_26684_c1_1431_2378 | 311 |
| 485 | 3300050493 | nmdc:mga0k408_10429_c1 | nmdc:mga0k408_10429_c1_925_1872 | 311 |
| 486 | 3300050494 | nmdc:mga06z11_24119_c1 | nmdc:mga06z11_24119_c1_1784_2731 | 311 |
| 487 | 3300050508 | nmdc:mga09592_20661_c1 | nmdc:mga09592_20661_c1_2339_3286 | 311 |
| 488 | 3300050510 | nmdc:mga06r32_271238_c1 | nmdc:mga06r32_271238_c1_420_1367 | 311 |
| 489 | 3300050510 | nmdc:mga06r32_965_c1 | nmdc:mga06r32_965_c1_1487_2434 | 311 |
| 490 | 3300050511 | nmdc:mga08y16_38214_c1 | nmdc:mga08y16_38214_c1_3043_3990 | 311 |
| 491 | 3300050512 | nmdc:mga0n895_71627_c1 | nmdc:mga0n895_71627_c1_1585_2532 | 311 |
| 492 | 3300054114 | Ga0501084_0152269 | Ga0501084_0152269_684_1631 | 311 |
| 493 | 3300005353 | Ga0070669_100000006 | Ga0070669_100000006189 | 312 |
| 494 | 3300005406 | Ga0070703_10000937 | Ga0070703_100009376 | 312 |
| 495 | 3300005434 | Ga0070709_10000029 | Ga0070709_1000002938 | 312 |
| 496 | 3300005439 | Ga0070711_100000027 | Ga0070711_10000002752 | 312 |
| 497 | 3300005440 | Ga0070705_100000221 | Ga0070705_10000022118 | 312 |
| 498 | 3300005467 | Ga0070706_100000208 | Ga0070706_10000020818 | 312 |
| 499 | 3300005468 | Ga0070707_100541900 | Ga0070707_1005419002 | 312 |
| 500 | 3300005518 | Ga0070699_100000029 | Ga0070699_100000029108 | 312 |
| 501 | 3300005545 | Ga0070695_100019093 | Ga0070695_1000190932 | 312 |
| 502 | 3300005546 | Ga0070696_100000362 | Ga0070696_10000036214 | 312 |
| 503 | 3300005546 | Ga0070696_100036675 | Ga0070696_1000366752 | 312 |
| 504 | 3300005547 | Ga0070693_100002949 | Ga0070693_1000029495 | 312 |
| 505 | 3300005549 | Ga0070704_100128133 | Ga0070704_1001281332 | 312 |
| 506 | 3300006173 | Ga0070716_100000018 | Ga0070716_1000000186 | 312 |
| 507 | 3300006175 | Ga0070712_100091771 | Ga0070712_1000917712 | 312 |
| 508 | 3300006844 | Ga0075428_100001485 | Ga0075428_10000148514 | 312 |
| 509 | 3300006852 | Ga0075433_10071431 | Ga0075433_100714312 | 312 |
| 510 | 3300006852 | Ga0075433_10171755 | Ga0075433_101717552 | 312 |
| 511 | 3300006871 | Ga0075434_100249803 | Ga0075434_1002498031 | 312 |
| 512 | 3300006871 | Ga0075434_100257020 | Ga0075434_1002570202 | 312 |
| 513 | 3300006914 | Ga0075436_100003047 | Ga0075436_1000030477 | 312 |
| 514 | 3300009094 | Ga0111539_10056627 | Ga0111539_100566274 | 312 |
| 515 | 3300009147 | Ga0114129_10021567 | Ga0114129_100215675 | 312 |
| 516 | 3300009147 | Ga0114129_10093522 | Ga0114129_100935221 | 312 |
| 517 | 3300009147 | Ga0114129_10202857 | Ga0114129_102028572 | 312 |
| 518 | 3300013297 | Ga0157378_10430742 | Ga0157378_104307422 | 312 |
| 519 | 3300025885 | Ga0207653_10000261 | Ga0207653_1000026114 | 312 |
| 520 | 3300025906 | Ga0207699_10000002 | Ga0207699_1000000280 | 312 |
| 521 | 3300025910 | Ga0207684_10000248 | Ga0207684_1000024832 | 312 |
| 522 | 3300025915 | Ga0207693_10103107 | Ga0207693_101031072 | 312 |
| 523 | 3300025916 | Ga0207663_10000006 | Ga0207663_1000000659 | 312 |
| 524 | 3300025923 | Ga0207681_10000006 | Ga0207681_1000000647 | 312 |
| 525 | 3300025939 | Ga0207665_10000022 | Ga0207665_1000002235 | 312 |
| 526 | 3300041486 | Ga0451807_0480303 | Ga0451807_0480303_322_1299 | 312 |
| 527 | 3300044673 | Ga0453683_0259289 | Ga0453683_0259289_28_978 | 312 |
| 528 | 3300049583 | Ga0501067_0019173 | Ga0501067_0019173_2109_3083 | 312 |
| 529 | 3300049591 | Ga0501075_0007778 | Ga0501075_0007778_5214_6188 | 312 |
| 530 | 3300049593 | Ga0501077_0000356 | Ga0501077_0000356_12356_13330 | 312 |
| 531 | 3300049742 | Ga0501080_0047736 | Ga0501080_0047736_2771_3745 | 312 |
| 532 | 3300050507 | nmdc:mga05p37_313_c1 | nmdc:mga05p37_313_c1_41376_42434 | 312 |
| 533 | 3300050507 | nmdc:mga05p37_81636_c1 | nmdc:mga05p37_81636_c1_881_1825 | 312 |
| 534 | 3300050508 | nmdc:mga09592_14555_c1 | nmdc:mga09592_14555_c1_1203_2156 | 312 |
| 535 | 3300050511 | nmdc:mga08y16_49736_c1 | nmdc:mga08y16_49736_c1_2439_3392 | 312 |
| 536 | 3300050512 | nmdc:mga0n895_507315_c1 | nmdc:mga0n895_507315_c1_197_1150 | 312 |
| 537 | 3300050514 | nmdc:mga08x19_39_c1 | nmdc:mga08x19_39_c1_39055_40005 | 312 |
| 538 | 3300050515 | nmdc:mga0a205_177158_c1 | nmdc:mga0a205_177158_c1_32_985 | 312 |
| 539 | 3300050515 | nmdc:mga0a205_69319_c1 | nmdc:mga0a205_69319_c1_183_1133 | 312 |
| 540 | 3300060353 | Ga0501082_0018891 | Ga0501082_0018891_2398_3372 | 312 |
| 541 | 3300005289 | Ga0065704_10172793 | Ga0065704_101727931 | 313 |
| 542 | 3300005353 | Ga0070669_100023551 | Ga0070669_1000235514 | 313 |
| 543 | 3300005438 | Ga0070701_10107406 | Ga0070701_101074062 | 313 |
| 544 | 3300005444 | Ga0070694_100090292 | Ga0070694_1000902922 | 313 |
| 545 | 3300005459 | Ga0068867_100281886 | Ga0068867_1002818862 | 313 |
| 546 | 3300005468 | Ga0070707_100045880 | Ga0070707_1000458803 | 313 |
| 547 | 3300005546 | Ga0070696_100217979 | Ga0070696_1002179792 | 313 |
| 548 | 3300005548 | Ga0070665_100000243 | Ga0070665_10000024360 | 313 |
| 549 | 3300005549 | Ga0070704_100009781 | Ga0070704_1000097814 | 313 |
| 550 | 3300005549 | Ga0070704_100092067 | Ga0070704_1000920672 | 313 |
| 551 | 3300005577 | Ga0068857_100091735 | Ga0068857_1000917353 | 313 |
| 552 | 3300005577 | Ga0068857_100277809 | Ga0068857_1002778091 | 313 |
| 553 | 3300005618 | Ga0068864_100351775 | Ga0068864_1003517752 | 313 |
| 554 | 3300005719 | Ga0068861_100005078 | Ga0068861_1000050785 | 313 |
| 555 | 3300005843 | Ga0068860_100129280 | Ga0068860_1001292802 | 313 |
| 556 | 3300005844 | Ga0068862_100008716 | Ga0068862_1000087162 | 313 |
| 557 | 3300005844 | Ga0068862_100011595 | Ga0068862_1000115955 | 313 |
| 558 | 3300006163 | Ga0070715_10000013 | Ga0070715_100000137 | 313 |
| 559 | 3300006852 | Ga0075433_10003222 | Ga0075433_100032222 | 313 |
| 560 | 3300006871 | Ga0075434_100004737 | Ga0075434_1000047372 | 313 |
| 561 | 3300006871 | Ga0075434_100058799 | Ga0075434_1000587994 | 313 |
| 562 | 3300006871 | Ga0075434_100358933 | Ga0075434_1003589332 | 313 |
| 563 | 3300007076 | Ga0075435_100095849 | Ga0075435_1000958492 | 313 |
| 564 | 3300007265 | Ga0099794_10007949 | Ga0099794_100079493 | 313 |
| 565 | 3300009147 | Ga0114129_10000027 | Ga0114129_1000002720 | 313 |
| 566 | 3300009148 | Ga0105243_10343787 | Ga0105243_103437872 | 313 |
| 567 | 3300009174 | Ga0105241_10204423 | Ga0105241_102044232 | 313 |
| 568 | 3300009553 | Ga0105249_10169715 | Ga0105249_101697152 | 313 |
| 569 | 3300009553 | Ga0105249_10275134 | Ga0105249_102751342 | 313 |
| 570 | 3300014326 | Ga0157380_10081812 | Ga0157380_100818123 | 313 |
| 571 | 3300025905 | Ga0207685_10000013 | Ga0207685_100000136 | 313 |
| 572 | 3300025911 | Ga0207654_10207488 | Ga0207654_102074882 | 313 |
| 573 | 3300025922 | Ga0207646_10094543 | Ga0207646_100945433 | 313 |
| 574 | 3300025923 | Ga0207681_10071782 | Ga0207681_100717822 | 313 |
| 575 | 3300025961 | Ga0207712_10117064 | Ga0207712_101170642 | 313 |
| 576 | 3300025981 | Ga0207640_10348174 | Ga0207640_103481741 | 313 |
| 577 | 3300026095 | Ga0207676_10349132 | Ga0207676_103491322 | 313 |
| 578 | 3300026116 | Ga0207674_10050816 | Ga0207674_100508163 | 313 |
| 579 | 3300026118 | Ga0207675_100009987 | Ga0207675_1000099875 | 313 |
| 580 | 3300028379 | Ga0268266_10000427 | Ga0268266_100004275 | 313 |
| 581 | 3300028380 | Ga0268265_10155007 | Ga0268265_101550072 | 313 |
| 582 | 3300028380 | Ga0268265_10172897 | Ga0268265_101728972 | 313 |
| 583 | 3300035241 | Ga0373961_0035683 | Ga0373961_0035683_124_1110 | 313 |
| 584 | 3300042876 | Ga0451577_0090976 | Ga0451577_0090976_593_1546 | 313 |
| 585 | 3300044712 | Ga0453684_0032892 | Ga0453684_0032892_2383_3336 | 313 |
| 586 | 3300048917 | Ga0496114_0000011 | Ga0496114_0000011_115656_116630 | 313 |
| 587 | 3300049584 | Ga0501068_0133030 | Ga0501068_0133030_108_1082 | 313 |
| 588 | 3300050507 | nmdc:mga05p37_3554_c1 | nmdc:mga05p37_3554_c1_14392_15351 | 313 |
| 589 | 3300050513 | nmdc:mga0rr50_84810_c1 | nmdc:mga0rr50_84810_c1_483_1442 | 313 |
| 590 | 3300050515 | nmdc:mga0a205_3117_c2 | nmdc:mga0a205_3117_c2_12580_13539 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x41-assembly1.cif.gz_B | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9379 | 6 | 223 |
| 5x41-assembly2.cif.gz_D | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9366 | 6 | 223 |
| 5lil-assembly1.cif.gz_B | structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) | 0.9338 | 8 | 219 |
| 5lj6-assembly1.cif.gz_A | structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p6522) | 0.9297 | 8 | 219 |
| 5lj7-assembly1.cif.gz_B | structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) | 0.9276 | 8 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58429_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9585 | 6 | 222 | 3.40.50.300 |
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9509 | 6 | 229 | 3.40.50.300 |
| af_P0A9R7_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9464 | 8 | 214 | 3.40.50.300 |
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9417 | 8 | 226 | 3.40.50.300 |
| af_Q9VDR4_479_718_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9392 | 8 | 224 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S9DLE0-F1-model_v4 | ABC transporter domain-containing protein | 0.9618 | 7 | 224 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A7W7BQI4-F1-model_v4 | ABC-2 type transport system ATP-binding protein | 0.9585 | 8 | 224 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A4Q7PN08-F1-model_v4 | deleted | 0.956 | 8 | 226 |
|
| AF-A0A2R9UI31-F1-model_v4 | ABC transporter | 0.9556 | 8 | 226 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A1V5YM67-F1-model_v4 | Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) | 0.953 | 8 | 222 |
GO:0005524
GO:0016887 GO:0017004 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar