F466962

General Info

Members Datasets Scaffolds Average Seq Length
590 252 590 314

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10169715|Ga0105249_101697152
Length 327
Sequence MSSPVKNPTPAPATPKSRIVFDNTSKFYGQVLGVNRVSLSIPPGITGLVGPNGSGKTTLMNLLTGLLRPTRGTVDVLGIPTDRPEALFRVLGYATQYDAFPRGLTGYELIYSFLRIYGFEHAEAAARTGKALERVNLTEAAGRKVAAYSKGMRQRIKLAQAIAHEPRVLVLDEPLNGLDPMARSEVIGLFREFADAGRHVIVSSHILHEVDLISDQVVLLNGGYVVAEGAIAGVRDEMEEEHPVQVRIRCDRPSLLAARVFAEDGAVEARLDDDGQGILVRTRNADRFHLLLNKIVMEDGVAIDAVVPADSDVRSVYQYLIGGEGKS

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 0.51
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10172793 3300005289 Bacteria 1281
2 Ga0065707_10129220 3300005295 Bacteria 1951
3 Ga0070683_100000944 3300005329 Bacteria 21627
4 Ga0070683_100001777 3300005329 Bacteria 16792
5 Ga0070683_100023325 3300005329 Bacteria 5534
6 Ga0070683_100055128 3300005329 Bacteria 3688
7 Ga0070670_100045892 3300005331 Bacteria 3756
8 Ga0070666_10019281 3300005335 Bacteria 4400
9 Ga0068868_100000476 3300005338 Bacteria 26629
10 Ga0070660_100121318 3300005339 Bacteria 2086
11 Ga0070689_100028952 3300005340 Bacteria 4189
12 Ga0070691_10002286 3300005341 Bacteria 8487
13 Ga0070661_100094147 3300005344 Bacteria 2220
14 Ga0070668_100220827 3300005347 Bacteria 1563
15 Ga0070669_100000006 3300005353 Bacteria 268982
16 Ga0070669_100023551 3300005353 Bacteria 4408
17 Ga0070669_100116165 3300005353 Bacteria 2036
18 Ga0070675_100000232 3300005354 Bacteria 35813
19 Ga0070675_100020829 3300005354 Bacteria 5233
20 Ga0070671_100021731 3300005355 Bacteria 5241
21 Ga0070671_100041998 3300005355 Bacteria 3801
22 Ga0070671_100306270 3300005355 Bacteria 1353
23 Ga0070674_100019822 3300005356 Bacteria 4281
24 Ga0070673_100003259 3300005364 Bacteria 10069
25 Ga0070673_100017408 3300005364 Bacteria 5109
26 Ga0070673_100044869 3300005364 Bacteria 3425
27 Ga0070673_100196175 3300005364 Bacteria 1737
28 Ga0070688_100022679 3300005365 Bacteria 3684
29 Ga0070667_100016966 3300005367 Bacteria 6028
30 Ga0070667_100021308 3300005367 Bacteria 5384
31 Ga0070667_100398714 3300005367 Bacteria 1252
32 Ga0070703_10000937 3300005406 Bacteria 9293
33 Ga0070709_10000029 3300005434 Bacteria 119772
34 Ga0070714_100126801 3300005435 Bacteria 2277
35 Ga0070714_100585867 3300005435 Bacteria 1070
36 Ga0070713_100000413 3300005436 Bacteria 27428
37 Ga0070713_100045250 3300005436 Bacteria 3605
38 Ga0070713_100046629 3300005436 Bacteria 3557
39 Ga0070710_10028073 3300005437 Unclassified 3007
40 Ga0070701_10107406 3300005438 Unclassified 1555
41 Ga0070711_100000027 3300005439 Bacteria 108952
42 Ga0070711_100088689 3300005439 Unclassified 2223
43 Ga0070711_100145102 3300005439 Bacteria 1784
44 Ga0070705_100000221 3300005440 Bacteria 33830
45 Ga0070694_100009684 3300005444 Bacteria 5917
46 Ga0070694_100090292 3300005444 Bacteria 2148
47 Ga0070694_100349029 3300005444 Bacteria 1146
48 Ga0070708_100022211 3300005445 Bacteria 5379
49 Ga0070708_100030146 3300005445 Bacteria 4687
50 Ga0070708_100106479 3300005445 Bacteria 2574
51 Ga0070678_100148909 3300005456 Unclassified 1883
52 Ga0070681_10001138 3300005458 Bacteria 22876
53 Ga0068867_100041415 3300005459 Bacteria 3366
54 Ga0068867_100053858 3300005459 Bacteria 2971
55 Ga0068867_100106341 3300005459 Unclassified 2149
56 Ga0068867_100281886 3300005459 Bacteria 1363
57 Ga0070685_10011334 3300005466 Bacteria 4669
58 Ga0070706_100000208 3300005467 Bacteria 72971
59 Ga0070706_100025236 3300005467 Bacteria 5471
60 Ga0070706_100148801 3300005467 Bacteria 2186
61 Ga0070707_100045880 3300005468 Bacteria 4182
62 Ga0070707_100541900 3300005468 Bacteria 1126
63 Ga0070699_100000029 3300005518 Bacteria 151185
64 Ga0070699_100296601 3300005518 Bacteria 1450
65 Ga0070679_100001167 3300005530 Bacteria 23012
66 Ga0070679_100319225 3300005530 Bacteria 1503
67 Ga0070684_100004866 3300005535 Bacteria 10258
68 Ga0070684_100036275 3300005535 Bacteria 4225
69 Ga0070684_100058093 3300005535 Bacteria 3380
70 Ga0070684_100072068 3300005535 Unclassified 3041
71 Ga0068853_100034323 3300005539 Bacteria 4306
72 Ga0068853_100433746 3300005539 Bacteria 1234
73 Ga0070672_100004478 3300005543 Bacteria 9152
74 Ga0070672_100032800 3300005543 Bacteria 3924
75 Ga0070672_100155943 3300005543 Unclassified 1891
76 Ga0070686_100007254 3300005544 Bacteria 6176
77 Ga0070686_100056532 3300005544 Bacteria 2517
78 Ga0070686_100090915 3300005544 Bacteria 2041
79 Ga0070695_100019093 3300005545 Bacteria 4170
80 Ga0070696_100000362 3300005546 Bacteria 27732
81 Ga0070696_100036675 3300005546 Bacteria 3381
82 Ga0070696_100217979 3300005546 Unclassified 1431
83 Ga0070693_100002949 3300005547 Bacteria 7870
84 Ga0070665_100000243 3300005548 Bacteria 90522
85 Ga0070704_100009781 3300005549 Bacteria 5812
86 Ga0070704_100092067 3300005549 Bacteria 2262
87 Ga0070704_100128133 3300005549 Bacteria 1962
88 Ga0070704_100170643 3300005549 Bacteria 1730
89 Ga0068855_100007475 3300005563 Bacteria 13230
90 Ga0068855_100013279 3300005563 Bacteria 9932
91 Ga0068855_100091750 3300005563 Unclassified 3503
92 Ga0068855_100165655 3300005563 Bacteria 2506
93 Ga0068855_100278951 3300005563 Unclassified 1856
94 Ga0070664_100000204 3300005564 Bacteria 42424
95 Ga0068857_100001209 3300005577 Bacteria 20133
96 Ga0068857_100091735 3300005577 Bacteria 2719
97 Ga0068857_100277809 3300005577 Bacteria 1540
98 Ga0068857_100297767 3300005577 Bacteria 1487
99 Ga0068854_100066640 3300005578 Unclassified 2621
100 Ga0068856_100001334 3300005614 Bacteria 25988
101 Ga0068852_100035625 3300005616 Bacteria 4154
102 Ga0068859_100013583 3300005617 Bacteria 8163
103 Ga0068859_100027194 3300005617 Bacteria 5738
104 Ga0068859_100049575 3300005617 Bacteria 4217
105 Ga0068859_100148694 3300005617 Unclassified 2418
106 Ga0068859_100193471 3300005617 Bacteria 2118
107 Ga0068859_100306994 3300005617 Bacteria 1680
108 Ga0068864_100000738 3300005618 Bacteria 27404
109 Ga0068864_100021616 3300005618 Bacteria 5388
110 Ga0068864_100186907 3300005618 Bacteria 1897
111 Ga0068864_100283606 3300005618 Bacteria 1547
112 Ga0068864_100351775 3300005618 Bacteria 1390
113 Ga0068861_100005078 3300005719 Bacteria 8877
114 Ga0068870_10030695 3300005840 Bacteria 2718
115 Ga0068863_100002245 3300005841 Bacteria 19182
116 Ga0068863_100010819 3300005841 Bacteria 8846
117 Ga0068863_100038929 3300005841 Bacteria 4524
118 Ga0068863_100184459 3300005841 Bacteria 2003
119 Ga0068858_100004232 3300005842 Bacteria 14127
120 Ga0068858_100076564 3300005842 Bacteria 3107
121 Ga0068858_100113081 3300005842 Bacteria 2535
122 Ga0068858_100165417 3300005842 Bacteria 2084
123 Ga0068860_100002569 3300005843 Bacteria 19000
124 Ga0068860_100007134 3300005843 Bacteria 11182
125 Ga0068860_100025653 3300005843 Bacteria 5685
126 Ga0068860_100129280 3300005843 Bacteria 2423
127 Ga0068860_100232199 3300005843 Bacteria 1793
128 Ga0068862_100008716 3300005844 Bacteria 8394
129 Ga0068862_100011595 3300005844 Bacteria 7272
130 Ga0068862_100025939 3300005844 Bacteria 4924
131 Ga0068862_100050568 3300005844 Bacteria 3553
132 Ga0070717_10003412 3300006028 Bacteria 11362
133 Ga0070717_10010368 3300006028 Bacteria 7033
134 Ga0075365_10016699 3300006038 Bacteria 4473
135 Ga0075368_10037287 3300006042 Bacteria 1901
136 Ga0075364_10019845 3300006051 Bacteria 4224
137 Ga0075364_10022064 3300006051 Bacteria 4017
138 Ga0070715_10000013 3300006163 Bacteria 155405
139 Ga0070716_100000018 3300006173 Bacteria 84686
140 Ga0070716_100003790 3300006173 Bacteria 7169
141 Ga0070716_100026042 3300006173 Unclassified 3128
142 Ga0070712_100000893 3300006175 Bacteria 17874
143 Ga0070712_100001442 3300006175 Bacteria 14518
144 Ga0070712_100091771 3300006175 Bacteria 2226
145 Ga0075362_10017713 3300006177 Bacteria 2938
146 Ga0075367_10002237 3300006178 Bacteria 8742
147 Ga0075366_10000973 3300006195 Bacteria 13996
148 Ga0097621_100018223 3300006237 Bacteria 5357
149 Ga0097621_100024703 3300006237 Bacteria 4695
150 Ga0097621_100066536 3300006237 Bacteria 2968
151 Ga0097621_100319934 3300006237 Bacteria 1374
152 Ga0097621_100359515 3300006237 Unclassified 1297
153 Ga0068871_100030839 3300006358 Unclassified 4226
154 Ga0068871_100076468 3300006358 Bacteria 2765
155 Ga0068871_100242745 3300006358 Bacteria 1567
156 Ga0075428_100001485 3300006844 Bacteria 25073
157 Ga0075428_100036814 3300006844 Bacteria 5388
158 Ga0075431_100015868 3300006847 Bacteria 7639
159 Ga0075431_100380951 3300006847 Bacteria 1415
160 Ga0075433_10003222 3300006852 Bacteria 12597
161 Ga0075433_10071431 3300006852 Bacteria 3051
162 Ga0075433_10171755 3300006852 Bacteria 1929
163 Ga0075434_100004737 3300006871 Bacteria 12304
164 Ga0075434_100048548 3300006871 Bacteria 4211
165 Ga0075434_100058799 3300006871 Bacteria 3821
166 Ga0075434_100249803 3300006871 Bacteria 1793
167 Ga0075434_100257020 3300006871 Bacteria 1765
168 Ga0075434_100358933 3300006871 Bacteria 1478
169 Ga0075434_100502717 3300006871 Bacteria 1233
170 Ga0068865_100042805 3300006881 Bacteria 3090
171 Ga0068865_100043585 3300006881 Bacteria 3067
172 Ga0068865_100095339 3300006881 Bacteria 2167
173 Ga0075436_100003047 3300006914 Bacteria 11487
174 Ga0075436_100071715 3300006914 Bacteria 2395
175 Ga0097620_100013583 3300006931 Bacteria 8163
176 Ga0097620_100027195 3300006931 Bacteria 5738
177 Ga0097620_100049573 3300006931 Bacteria 4217
178 Ga0097620_100148696 3300006931 Unclassified 2418
179 Ga0097620_100193472 3300006931 Bacteria 2118
180 Ga0097620_100306983 3300006931 Bacteria 1680
181 Ga0075435_100073906 3300007076 Bacteria 2787
182 Ga0075435_100095849 3300007076 Unclassified 2454
183 Ga0099794_10007949 3300007265 Bacteria 4384
184 Ga0105240_10011617 3300009093 Bacteria 12248
185 Ga0105240_10022682 3300009093 Bacteria 8317
186 Ga0105240_10062281 3300009093 Bacteria 4645
187 Ga0105240_10093738 3300009093 Bacteria 3664
188 Ga0111539_10003069 3300009094 Bacteria 22129
189 Ga0111539_10056627 3300009094 Bacteria 4658
190 Ga0111539_10152937 3300009094 Bacteria 2700
191 Ga0111539_10407522 3300009094 Unclassified 1583
192 Ga0105245_10002931 3300009098 Bacteria 15316
193 Ga0105245_10100446 3300009098 Bacteria 2676
194 Ga0105245_10119641 3300009098 Bacteria 2459
195 Ga0105245_10200331 3300009098 Unclassified 1917
196 Ga0105245_10204340 3300009098 Bacteria 1898
197 Ga0105245_10400432 3300009098 Unclassified 1371
198 Ga0114129_10000027 3300009147 Bacteria 112969
199 Ga0114129_10021567 3300009147 Bacteria 9144
200 Ga0114129_10093522 3300009147 Bacteria 4165
201 Ga0114129_10202857 3300009147 Bacteria 2685
202 Ga0105243_10039903 3300009148 Bacteria 3663
203 Ga0105243_10261947 3300009148 Bacteria 1548
204 Ga0105243_10321920 3300009148 Bacteria 1409
205 Ga0105243_10343787 3300009148 Bacteria 1368
206 Ga0105243_10503144 3300009148 Bacteria 1148
207 Ga0105241_10011888 3300009174 Bacteria 6397
208 Ga0105241_10087895 3300009174 Unclassified 2447
209 Ga0105241_10204423 3300009174 Unclassified 1651
210 Ga0105241_10303887 3300009174 Unclassified 1370
211 Ga0105241_10495924 3300009174 Unclassified 1088
212 Ga0105241_10534847 3300009174 Bacteria 1050
213 Ga0105242_10016280 3300009176 Bacteria 5781
214 Ga0105242_10035147 3300009176 Bacteria 4019
215 Ga0105242_10057251 3300009176 Bacteria 3191
216 Ga0105242_10416250 3300009176 Unclassified 1258
217 Ga0105248_10000562 3300009177 Bacteria 42094
218 Ga0105248_10001595 3300009177 Bacteria 25242
219 Ga0105248_10037993 3300009177 Bacteria 5386
220 Ga0105248_10051373 3300009177 Bacteria 4625
221 Ga0105248_10125138 3300009177 Unclassified 2900
222 Ga0105248_10202645 3300009177 Unclassified 2236
223 Ga0105248_10257940 3300009177 Bacteria 1963
224 Ga0105248_10360395 3300009177 Unclassified 1637
225 Ga0105237_10016662 3300009545 Bacteria 7632
226 Ga0105237_10024726 3300009545 Bacteria 6144
227 Ga0105237_10027240 3300009545 Bacteria 5836
228 Ga0105237_10079547 3300009545 Bacteria 3268
229 Ga0105237_10127964 3300009545 Bacteria 2534
230 Ga0105238_10002683 3300009551 Bacteria 17692
231 Ga0105238_10024681 3300009551 Bacteria 6128
232 Ga0105238_10038145 3300009551 Bacteria 4881
233 Ga0105238_10105987 3300009551 Unclassified 2793
234 Ga0105238_10133009 3300009551 Bacteria 2465
235 Ga0105249_10040144 3300009553 Bacteria 4250
236 Ga0105249_10169715 3300009553 Bacteria 2115
237 Ga0105249_10275134 3300009553 Bacteria 1679
238 Ga0105239_10009479 3300010375 Bacteria 10971
239 Ga0105239_10039974 3300010375 Bacteria 5138
240 Ga0105246_10014199 3300011119 Bacteria 5006
241 Ga0105246_10106680 3300011119 Bacteria 2050
242 Ga0157370_10010552 3300013104 Bacteria 9729
243 Ga0157370_10018572 3300013104 Bacteria 6989
244 Ga0157370_10278684 3300013104 Bacteria 1545
245 Ga0157370_10811585 3300013104 Bacteria 851
246 Ga0157369_10012340 3300013105 Bacteria 9700
247 Ga0157369_10031304 3300013105 Bacteria 5859
248 Ga0157369_10066392 3300013105 Bacteria 3881
249 Ga0157369_10080625 3300013105 Bacteria 3484
250 Ga0157374_10006261 3300013296 Bacteria 10091
251 Ga0157374_10038933 3300013296 Bacteria 4372
252 Ga0157374_10076946 3300013296 Bacteria 3156
253 Ga0157374_10158377 3300013296 Bacteria 2205
254 Ga0157378_10072565 3300013297 Unclassified 3093
255 Ga0157378_10111951 3300013297 Bacteria 2503
256 Ga0157378_10267362 3300013297 Bacteria 1643
257 Ga0157378_10430742 3300013297 Bacteria 1305
258 Ga0163162_10000995 3300013306 Bacteria 26367
259 Ga0163162_10002444 3300013306 Bacteria 17523
260 Ga0163162_10340480 3300013306 Bacteria 1632
261 Ga0163162_10499210 3300013306 Bacteria 1347
262 Ga0163162_10764339 3300013306 Bacteria 1085
263 Ga0157372_10003092 3300013307 Bacteria 17925
264 Ga0157372_10179286 3300013307 Bacteria 2452
265 Ga0157375_10004297 3300013308 Bacteria 12361
266 Ga0157375_10057940 3300013308 Bacteria 3831
267 Ga0157375_10144400 3300013308 Bacteria 2509
268 Ga0157375_10157345 3300013308 Unclassified 2412
269 Ga0163163_10007949 3300014325 Bacteria 9380
270 Ga0163163_10012832 3300014325 Bacteria 7645
271 Ga0163163_10016359 3300014325 Bacteria 6889
272 Ga0163163_10030465 3300014325 Bacteria 5199
273 Ga0163163_10056418 3300014325 Bacteria 3882
274 Ga0163163_10147316 3300014325 Bacteria 2398
275 Ga0157380_10081812 3300014326 Bacteria 2642
276 Ga0157380_10382664 3300014326 Bacteria 1328
277 Ga0157379_10000277 3300014968 Bacteria 40463
278 Ga0157376_10036831 3300014969 Bacteria 3966
279 Ga0157376_10088729 3300014969 Bacteria 2672
280 Ga0157376_10343933 3300014969 Bacteria 1425
281 Ga0157376_10484256 3300014969 Bacteria 1213
282 Ga0163161_10066834 3300017792 Bacteria 2625
283 Ga0213873_10018202 3300021358 Unclassified 1613
284 Ga0207653_10000261 3300025885 Bacteria 32960
285 Ga0207680_10008748 3300025903 Bacteria 4987
286 Ga0207680_10021498 3300025903 Bacteria 3492
287 Ga0207685_10000013 3300025905 Bacteria 186374
288 Ga0207699_10000002 3300025906 Bacteria 662194
289 Ga0207699_10000715 3300025906 Bacteria 15863
290 Ga0207699_10006244 3300025906 Bacteria 5754
291 Ga0207643_10009998 3300025908 Bacteria 5100
292 Ga0207684_10000248 3300025910 Bacteria 80978
293 Ga0207684_10033080 3300025910 Bacteria 4398
294 Ga0207684_10229641 3300025910 Bacteria 1601
295 Ga0207654_10006021 3300025911 Bacteria 6097
296 Ga0207654_10207488 3300025911 Unclassified 1293
297 Ga0207654_10312280 3300025911 Bacteria 1072
298 Ga0207707_10002195 3300025912 Bacteria 17680
299 Ga0207695_10000768 3300025913 Bacteria 61199
300 Ga0207695_10000789 3300025913 Bacteria 59517
301 Ga0207695_10011181 3300025913 Bacteria 10891
302 Ga0207695_10034350 3300025913 Bacteria 5516
303 Ga0207695_10071430 3300025913 Bacteria 3545
304 Ga0207695_10073553 3300025913 Bacteria 3482
305 Ga0207695_10129621 3300025913 Bacteria 2481
306 Ga0207671_10037938 3300025914 Bacteria 3572
307 Ga0207671_10043137 3300025914 Bacteria 3335
308 Ga0207671_10165531 3300025914 Bacteria 1714
309 Ga0207693_10000108 3300025915 Bacteria 75296
310 Ga0207693_10015198 3300025915 Bacteria 6178
311 Ga0207693_10103107 3300025915 Bacteria 2237
312 Ga0207663_10000006 3300025916 Bacteria 253740
313 Ga0207663_10065313 3300025916 Bacteria 2326
314 Ga0207663_10084339 3300025916 Bacteria 2090
315 Ga0207660_10113703 3300025917 Bacteria 2041
316 Ga0207662_10010850 3300025918 Bacteria 5035
317 Ga0207657_10121916 3300025919 Bacteria 2145
318 Ga0207649_10036108 3300025920 Bacteria 2974
319 Ga0207649_10113732 3300025920 Unclassified 1813
320 Ga0207652_10001481 3300025921 Bacteria 20767
321 Ga0207646_10094543 3300025922 Bacteria 2677
322 Ga0207681_10000006 3300025923 Bacteria 496979
323 Ga0207681_10071782 3300025923 Bacteria 2416
324 Ga0207694_10002477 3300025924 Bacteria 15029
325 Ga0207694_10003769 3300025924 Bacteria 12005
326 Ga0207694_10016496 3300025924 Bacteria 5578
327 Ga0207694_10033293 3300025924 Bacteria 3948
328 Ga0207694_10082371 3300025924 Bacteria 2529
329 Ga0207694_10373494 3300025924 Bacteria 1183
330 Ga0207650_10001625 3300025925 Bacteria 16035
331 Ga0207650_10014064 3300025925 Bacteria 5557
332 Ga0207659_10001985 3300025926 Bacteria 12106
333 Ga0207659_10004565 3300025926 Bacteria 8374
334 Ga0207687_10010708 3300025927 Bacteria 5989
335 Ga0207687_10023066 3300025927 Bacteria 4145
336 Ga0207687_10068590 3300025927 Bacteria 2526
337 Ga0207687_10082323 3300025927 Bacteria 2328
338 Ga0207700_10004544 3300025928 Bacteria 8200
339 Ga0207700_10005144 3300025928 Bacteria 7780
340 Ga0207700_10027875 3300025928 Bacteria 3961
341 Ga0207664_10048768 3300025929 Bacteria 3332
342 Ga0207664_10135579 3300025929 Bacteria 2077
343 Ga0207644_10013348 3300025931 Bacteria 5476
344 Ga0207644_10013545 3300025931 Bacteria 5440
345 Ga0207706_10505370 3300025933 Bacteria 1043
346 Ga0207686_10189956 3300025934 Bacteria 1463
347 Ga0207709_10083180 3300025935 Bacteria 2069
348 Ga0207709_10086840 3300025935 Bacteria 2032
349 Ga0207709_10107526 3300025935 Bacteria 1858
350 Ga0207704_10067114 3300025938 Bacteria 2255
351 Ga0207704_10148410 3300025938 Bacteria 1651
352 Ga0207704_10224185 3300025938 Bacteria 1393
353 Ga0207704_10252890 3300025938 Bacteria 1324
354 Ga0207665_10000022 3300025939 Bacteria 109003
355 Ga0207665_10001840 3300025939 Bacteria 14276
356 Ga0207665_10016609 3300025939 Bacteria 4836
357 Ga0207665_10083472 3300025939 Unclassified 2203
358 Ga0207691_10009274 3300025940 Bacteria 9441
359 Ga0207691_10102531 3300025940 Bacteria 2552
360 Ga0207691_10182177 3300025940 Unclassified 1835
361 Ga0207691_10375972 3300025940 Unclassified 1213
362 Ga0207711_10001521 3300025941 Bacteria 21549
363 Ga0207711_10005417 3300025941 Bacteria 10791
364 Ga0207711_10089791 3300025941 Unclassified 2700
365 Ga0207711_10093531 3300025941 Unclassified 2648
366 Ga0207711_10498922 3300025941 Bacteria 1134
367 Ga0207689_10068240 3300025942 Bacteria 2922
368 Ga0207689_10123920 3300025942 Bacteria 2126
369 Ga0207661_10001936 3300025944 Bacteria 14239
370 Ga0207661_10011769 3300025944 Bacteria 6352
371 Ga0207661_10035478 3300025944 Bacteria 3886
372 Ga0207679_10007116 3300025945 Bacteria 7089
373 Ga0207667_10002519 3300025949 Bacteria 22814
374 Ga0207667_10020639 3300025949 Bacteria 7322
375 Ga0207667_10242856 3300025949 Unclassified 1843
376 Ga0207667_10330499 3300025949 Unclassified 1556
377 Ga0207651_10007268 3300025960 Bacteria 5887
378 Ga0207651_10008592 3300025960 Bacteria 5526
379 Ga0207651_10060666 3300025960 Bacteria 2627
380 Ga0207651_10170412 3300025960 Bacteria 1716
381 Ga0207712_10096161 3300025961 Bacteria 2192
382 Ga0207712_10117064 3300025961 Bacteria 2009
383 Ga0207640_10065668 3300025981 Bacteria 2422
384 Ga0207640_10348174 3300025981 Bacteria 1189
385 Ga0207658_10006343 3300025986 Bacteria 8073
386 Ga0207677_10001963 3300026023 Bacteria 10892
387 Ga0207677_10134880 3300026023 Bacteria 1880
388 Ga0207703_10023698 3300026035 Bacteria 4827
389 Ga0207703_10035135 3300026035 Bacteria 3982
390 Ga0207703_10221055 3300026035 Bacteria 1693
391 Ga0207703_10298129 3300026035 Bacteria 1469
392 Ga0207703_10419345 3300026035 Bacteria 1245
393 Ga0207639_10180038 3300026041 Unclassified 1797
394 Ga0207678_10036717 3300026067 Bacteria 4265
395 Ga0207708_10021580 3300026075 Bacteria 4857
396 Ga0207702_10008454 3300026078 Bacteria 8682
397 Ga0207702_10129825 3300026078 Unclassified 2266
398 Ga0207641_10015607 3300026088 Bacteria 6225
399 Ga0207641_10065204 3300026088 Bacteria 3115
400 Ga0207641_10109940 3300026088 Bacteria 2442
401 Ga0207648_10004080 3300026089 Bacteria 15136
402 Ga0207648_10084079 3300026089 Bacteria 2776
403 Ga0207648_10121295 3300026089 Bacteria 2299
404 Ga0207676_10008022 3300026095 Bacteria 7506
405 Ga0207676_10168185 3300026095 Unclassified 1907
406 Ga0207676_10255315 3300026095 Bacteria 1580
407 Ga0207676_10349132 3300026095 Bacteria 1368
408 Ga0207674_10000072 3300026116 Bacteria 105507
409 Ga0207674_10025920 3300026116 Bacteria 6240
410 Ga0207674_10050816 3300026116 Bacteria 4234
411 Ga0207674_10205869 3300026116 Bacteria 1917
412 Ga0207674_10288045 3300026116 Bacteria 1591
413 Ga0207675_100009987 3300026118 Bacteria 8890
414 Ga0207683_10026551 3300026121 Bacteria 4998
415 Ga0207698_10009064 3300026142 Bacteria 6321
416 Ga0207428_10000311 3300027907 Bacteria 64550
417 Ga0207428_10018382 3300027907 Bacteria 5973
418 Ga0265356_1009368 3300028017 Unclassified 1104
419 Ga0268266_10000427 3300028379 Bacteria 63335
420 Ga0268266_10058649 3300028379 Bacteria 3315
421 Ga0268265_10039013 3300028380 Bacteria 3497
422 Ga0268265_10055000 3300028380 Bacteria 3022
423 Ga0268265_10061035 3300028380 Bacteria 2892
424 Ga0268265_10155007 3300028380 Unclassified 1937
425 Ga0268265_10172897 3300028380 Bacteria 1848
426 Ga0268264_10003384 3300028381 Bacteria 13773
427 Ga0268264_10007069 3300028381 Bacteria 9407
428 Ga0268264_10028839 3300028381 Bacteria 4543
429 Ga0268264_10056279 3300028381 Bacteria 3288
430 Ga0268264_10409214 3300028381 Bacteria 1305
431 Ga0265337_1048679 3300028556 Bacteria 1199
432 Ga0265338_10003647 3300028800 Bacteria 21449
433 Ga0265338_10017405 3300028800 Bacteria 7747
434 Ga0265338_10043786 3300028800 Bacteria 4145
435 Ga0265338_10086478 3300028800 Bacteria 2609
436 Ga0265762_1000133 3300030760 Bacteria 11173
437 Ga0265760_10018651 3300031090 Bacteria 1999
438 Ga0265332_10035138 3300031238 Bacteria 2177
439 Ga0265340_10095903 3300031247 Bacteria 1382
440 Ga0265339_10147259 3300031249 Bacteria 1193
441 Ga0265316_10147125 3300031344 Bacteria 1766
442 Ga0265313_10009783 3300031595 Bacteria 6177
443 Ga0265314_10009360 3300031711 Bacteria 8286
444 Ga0373934_0004171 3300035086 Bacteria 5331
445 Ga0373954_0007913 3300035118 Bacteria 4655
446 Ga0373955_0013608 3300035172 Bacteria 3939
447 Ga0373955_0016763 3300035172 Bacteria 3611
448 Ga0373955_0124159 3300035172 Bacteria 1503
449 Ga0373961_0035683 3300035241 Bacteria 1412
450 Ga0373935_0015647 3300035692 Bacteria 4588
451 Ga0373927_0007055 3300035695 Bacteria 7621
452 Ga0373947_0105702 3300035725 Bacteria 1774
453 Ga0373947_0178958 3300035725 Bacteria 1380
454 Ga0373937_0001861 3300036401 Bacteria 17743
455 Ga0373937_0002150 3300036401 Bacteria 16502
456 Ga0373937_0003162 3300036401 Bacteria 13782
457 Ga0373937_0053373 3300036401 Bacteria 3708
458 Ga0373937_0106917 3300036401 Bacteria 2601
459 Ga0436362_0058380 3300039453 Unclassified 2300
460 Ga0451807_0480303 3300041486 Bacteria 1807
461 Ga0451849_1474294 3300041505 Bacteria 1841
462 Ga0451577_0004594 3300042876 Bacteria 14503
463 Ga0451577_0015547 3300042876 Bacteria 7076
464 Ga0451577_0090976 3300042876 Bacteria 2723
465 Ga0453683_0259289 3300044673 Bacteria 1109
466 Ga0466963_0190448 3300044694 Bacteria 1433
467 Ga0453684_0032892 3300044712 Bacteria 7242
468 Ga0453684_0221537 3300044712 Bacteria 2191
469 Ga0451576_0051507 3300045051 Bacteria 4317
470 Ga0451576_0499113 3300045051 Bacteria 1278
471 Ga0495592_0005305 3300046454 Bacteria 9503
472 Ga0495629_0000035 3300046459 Bacteria 118597
473 Ga0495629_0040001 3300046459 Unclassified 3299
474 Ga0495629_0111163 3300046459 Bacteria 1910
475 Ga0495629_0152578 3300046459 Bacteria 1606
476 Ga0495629_0319557 3300046459 Bacteria 1061
477 Ga0495651_0031116 3300046462 Bacteria 4162
478 Ga0495651_0092374 3300046462 Bacteria 2267
479 Ga0495651_0218315 3300046462 Unclassified 1322
480 Ga0495580_0002919 3300046472 Bacteria 14687
481 Ga0495582_0033029 3300046473 Bacteria 2844
482 Ga0495639_0082077 3300046475 Bacteria 1503
483 Ga0495662_0014396 3300046476 Bacteria 3848
484 Ga0495662_0028261 3300046476 Bacteria 2708
485 Ga0495662_0035473 3300046476 Bacteria 2406
486 Ga0495664_0185993 3300046477 Unclassified 1259
487 Ga0495594_0017343 3300046499 Bacteria 3803
488 Ga0495594_0046943 3300046499 Unclassified 2372
489 Ga0495594_0190067 3300046499 Bacteria 1170
490 Ga0495608_0053321 3300046511 Bacteria 2676
491 Ga0495618_0094981 3300046514 Bacteria 1906
492 Ga0495628_0090609 3300046516 Bacteria 2367
493 Ga0495652_0063979 3300046529 Bacteria 3096
494 Ga0495652_0065122 3300046529 Bacteria 3063
495 Ga0495652_0109323 3300046529 Bacteria 2226
496 Ga0495652_0152311 3300046529 Bacteria 1805
497 Ga0495665_0063480 3300046531 Bacteria 1950
498 Ga0495640_0134316 3300046533 Unclassified 1599
499 Ga0495587_0018019 3300046536 Bacteria 4378
500 Ga0495587_0029341 3300046536 Bacteria 3339
501 Ga0495587_0232956 3300046536 Bacteria 1038
502 Ga0495645_0008623 3300046543 Bacteria 7119
503 Ga0495645_0043479 3300046543 Bacteria 3277
504 Ga0495667_0001172 3300046559 Bacteria 17119
505 Ga0495667_0009119 3300046559 Bacteria 6737
506 Ga0495667_0081597 3300046559 Bacteria 2102
507 Ga0495667_0087264 3300046559 Bacteria 2023
508 Ga0495634_0027000 3300046642 Bacteria 4000
509 Ga0495634_0034461 3300046642 Bacteria 3474
510 Ga0495635_0001362 3300046663 Bacteria 16266
511 Ga0495657_0000805 3300046675 Bacteria 27819
512 Ga0495657_0144569 3300046675 Bacteria 1480
513 Ga0495599_0029754 3300046678 Bacteria 3425
514 Ga0495599_0037075 3300046678 Bacteria 3063
515 Ga0495599_0061610 3300046678 Bacteria 2344
516 Ga0495623_0009717 3300046679 Bacteria 6243
517 Ga0495623_0084200 3300046679 Bacteria 1963
518 Ga0495623_0174739 3300046679 Unclassified 1252
519 Ga0495647_0034330 3300046681 Unclassified 1900
520 Ga0495647_0064080 3300046681 Bacteria 1457
521 Ga0495658_0000289 3300046683 Bacteria 28435
522 Ga0495658_0064070 3300046683 Bacteria 2117
523 Ga0495658_0213526 3300046683 Unclassified 1206
524 Ga0495613_0005125 3300046689 Bacteria 9834
525 Ga0495613_0039834 3300046689 Bacteria 3482
526 Ga0495613_0040098 3300046689 Bacteria 3470
527 Ga0495613_0177567 3300046689 Bacteria 1509
528 Ga0495613_0307884 3300046689 Bacteria 1095
529 Ga0495624_0216487 3300046690 Bacteria 1162
530 Ga0495671_0118441 3300046692 Bacteria 1293
531 Ga0495600_0210663 3300046809 Bacteria 1245
532 Ga0495581_0000568 3300047315 Bacteria 19217
533 Ga0495604_0045331 3300047317 Bacteria 3432
534 Ga0495636_0058105 3300047318 Bacteria 1630
535 Ga0495674_0046953 3300047319 Bacteria 3831
536 Ga0495674_0050886 3300047319 Unclassified 3654
537 Ga0495674_0163574 3300047319 Bacteria 1861
538 Ga0495674_0197549 3300047319 Bacteria 1670
539 Ga0495674_0228058 3300047319 Bacteria 1538
540 Ga0495676_0019102 3300047321 Bacteria 6034
541 Ga0495680_0003049 3300047322 Bacteria 16691
542 Ga0495680_0042468 3300047322 Bacteria 3607
543 Ga0495680_0209344 3300047322 Bacteria 1396
544 Ga0495675_0103944 3300047444 Bacteria 1776
545 Ga0495675_0189455 3300047444 Bacteria 1256
546 Ga0495684_0001338 3300047471 Bacteria 19834
547 Ga0495684_0022155 3300047471 Bacteria 4892
548 Ga0495684_0037796 3300047471 Bacteria 3703
549 Ga0495684_0058611 3300047471 Bacteria 2933
550 Ga0495684_0160452 3300047471 Bacteria 1677
551 Ga0495684_0190973 3300047471 Bacteria 1514
552 Ga0495684_0292158 3300047471 Bacteria 1173
553 Ga0495602_0005196 3300048088 Bacteria 13639
554 Ga0495602_0021680 3300048088 Bacteria 6314
555 Ga0495602_0160439 3300048088 Bacteria 1756
556 Ga0496100_0236953 3300048903 Bacteria 1345
557 Ga0496114_0000011 3300048917 Bacteria 348290
558 Ga0501067_0019173 3300049583 Bacteria 3786
559 Ga0501068_0133030 3300049584 Bacteria 1556
560 Ga0501075_0007778 3300049591 Bacteria 7440
561 Ga0501077_0000356 3300049593 Bacteria 27114
562 Ga0501080_0047736 3300049742 Bacteria 3986
563 Ga0501081_0081951 3300049743 Bacteria 2260
564 nmdc:mga03683_13355_c1 3300050489 Bacteria 3020
565 nmdc:mga00v17_26006_c1 3300050491 Bacteria 3406
566 nmdc:mga0yw44_26684_c1 3300050492 Bacteria 3302
567 nmdc:mga0k408_10429_c1 3300050493 Bacteria 5024
568 nmdc:mga06z11_24119_c1 3300050494 Bacteria 2866
569 nmdc:mga05p37_313_c1 3300050507 Bacteria 51243
570 nmdc:mga05p37_3554_c1 3300050507 Bacteria 18203
571 nmdc:mga05p37_81636_c1 3300050507 Unclassified 3215
572 nmdc:mga09592_14555_c1 3300050508 Bacteria 6420
573 nmdc:mga09592_20661_c1 3300050508 Bacteria 5418
574 nmdc:mga06r32_271238_c1 3300050510 Bacteria 1684
575 nmdc:mga06r32_965_c1 3300050510 Bacteria 25699
576 nmdc:mga08y16_38214_c1 3300050511 Bacteria 5042
577 nmdc:mga08y16_39273_c1 3300050511 Bacteria 4966
578 nmdc:mga08y16_49736_c1 3300050511 Bacteria 4386
579 nmdc:mga0n895_47774_c1 3300050512 Bacteria 4186
580 nmdc:mga0n895_507315_c1 3300050512 Bacteria 1215
581 nmdc:mga0n895_587641_c1 3300050512 Bacteria 1117
582 nmdc:mga0n895_71627_c1 3300050512 Bacteria 3437
583 nmdc:mga0rr50_84810_c1 3300050513 Unclassified 2453
584 nmdc:mga08x19_39_c1 3300050514 Bacteria 158844
585 nmdc:mga08x19_4971_c1 3300050514 Bacteria 7858
586 nmdc:mga0a205_177158_c1 3300050515 Bacteria 2027
587 nmdc:mga0a205_3117_c2 3300050515 Bacteria 14077
588 nmdc:mga0a205_69319_c1 3300050515 Bacteria 3405
589 Ga0501084_0152269 3300054114 Bacteria 1950
590 Ga0501082_0018891 3300060353 Bacteria 5938

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10278684 Ga0157370_102786841 263
2 3300013104 Ga0157370_10811585 Ga0157370_108115851 263
3 3300046462 Ga0495651_0218315 Ga0495651_0218315_23_826 263
4 3300046529 Ga0495652_0152311 Ga0495652_0152311_26_829 263
5 3300005530 Ga0070679_100319225 Ga0070679_1003192252 287
6 3300005563 Ga0068855_100165655 Ga0068855_1001656552 287
7 3300009093 Ga0105240_10022682 Ga0105240_100226822 287
8 3300009093 Ga0105240_10093738 Ga0105240_100937382 287
9 3300025913 Ga0207695_10129621 Ga0207695_101296212 287
10 3300005843 Ga0068860_100002569 Ga0068860_10000256915 293
11 3300028381 Ga0268264_10007069 Ga0268264_100070693 293
12 3300005444 Ga0070694_100009684 Ga0070694_1000096844 302
13 3300046690 Ga0495624_0216487 Ga0495624_0216487_143_1099 302
14 3300009545 Ga0105237_10079547 Ga0105237_100795472 304
15 3300025914 Ga0207671_10043137 Ga0207671_100431372 304
16 3300005295 Ga0065707_10129220 Ga0065707_101292202 305
17 3300009094 Ga0111539_10152937 Ga0111539_101529373 305
18 3300025939 Ga0207665_10016609 Ga0207665_100166096 305
19 3300035172 Ga0373955_0124159 Ga0373955_0124159_457_1389 305
20 3300046459 Ga0495629_0000035 Ga0495629_0000035_110973_111905 305
21 3300046459 Ga0495629_0111163 Ga0495629_0111163_90_1022 305
22 3300046476 Ga0495662_0028261 Ga0495662_0028261_1753_2685 305
23 3300046499 Ga0495594_0017343 Ga0495594_0017343_595_1527 305
24 3300046663 Ga0495635_0001362 Ga0495635_0001362_10115_11047 305
25 3300046681 Ga0495647_0064080 Ga0495647_0064080_315_1247 305
26 3300046683 Ga0495658_0000289 Ga0495658_0000289_23199_24131 305
27 3300046683 Ga0495658_0064070 Ga0495658_0064070_1057_1989 305
28 3300046689 Ga0495613_0040098 Ga0495613_0040098_2260_3192 305
29 3300047315 Ga0495581_0000568 Ga0495581_0000568_16809_17741 305
30 3300047321 Ga0495676_0019102 Ga0495676_0019102_3127_4059 305
31 3300047322 Ga0495680_0003049 Ga0495680_0003049_6650_7582 305
32 3300047322 Ga0495680_0209344 Ga0495680_0209344_157_1089 305
33 3300050511 nmdc:mga08y16_39273_c1 nmdc:mga08y16_39273_c1_1149_2081 305
34 3300005364 Ga0070673_100044869 Ga0070673_1000448693 306
35 3300005365 Ga0070688_100022679 Ga0070688_1000226794 306
36 3300005563 Ga0068855_100091750 Ga0068855_1000917503 306
37 3300005617 Ga0068859_100049575 Ga0068859_1000495753 306
38 3300005617 Ga0068859_100193471 Ga0068859_1001934712 306
39 3300006931 Ga0097620_100049573 Ga0097620_1000495733 306
40 3300006931 Ga0097620_100193472 Ga0097620_1001934722 306
41 3300009174 Ga0105241_10303887 Ga0105241_103038872 306
42 3300013105 Ga0157369_10080625 Ga0157369_100806252 306
43 3300025913 Ga0207695_10000789 Ga0207695_1000078958 306
44 3300025949 Ga0207667_10330499 Ga0207667_103304992 306
45 3300025960 Ga0207651_10060666 Ga0207651_100606662 306
46 3300026116 Ga0207674_10205869 Ga0207674_102058692 306
47 3300028380 Ga0268265_10061035 Ga0268265_100610352 306
48 3300031595 Ga0265313_10009783 Ga0265313_100097832 306
49 3300005329 Ga0070683_100000944 Ga0070683_1000009444 307
50 3300005329 Ga0070683_100001777 Ga0070683_1000017774 307
51 3300005329 Ga0070683_100023325 Ga0070683_1000233256 307
52 3300005329 Ga0070683_100055128 Ga0070683_1000551282 307
53 3300005335 Ga0070666_10019281 Ga0070666_100192815 307
54 3300005338 Ga0068868_100000476 Ga0068868_10000047622 307
55 3300005339 Ga0070660_100121318 Ga0070660_1001213181 307
56 3300005340 Ga0070689_100028952 Ga0070689_1000289522 307
57 3300005341 Ga0070691_10002286 Ga0070691_100022865 307
58 3300005344 Ga0070661_100094147 Ga0070661_1000941472 307
59 3300005355 Ga0070671_100041998 Ga0070671_1000419983 307
60 3300005364 Ga0070673_100017408 Ga0070673_1000174084 307
61 3300005367 Ga0070667_100016966 Ga0070667_1000169665 307
62 3300005435 Ga0070714_100126801 Ga0070714_1001268012 307
63 3300005435 Ga0070714_100585867 Ga0070714_1005858671 307
64 3300005436 Ga0070713_100000413 Ga0070713_10000041320 307
65 3300005436 Ga0070713_100045250 Ga0070713_1000452503 307
66 3300005437 Ga0070710_10028073 Ga0070710_100280732 307
67 3300005439 Ga0070711_100088689 Ga0070711_1000886892 307
68 3300005444 Ga0070694_100349029 Ga0070694_1003490291 307
69 3300005445 Ga0070708_100030146 Ga0070708_1000301462 307
70 3300005456 Ga0070678_100148909 Ga0070678_1001489092 307
71 3300005458 Ga0070681_10001138 Ga0070681_1000113818 307
72 3300005459 Ga0068867_100053858 Ga0068867_1000538583 307
73 3300005467 Ga0070706_100025236 Ga0070706_1000252363 307
74 3300005467 Ga0070706_100148801 Ga0070706_1001488012 307
75 3300005518 Ga0070699_100296601 Ga0070699_1002966012 307
76 3300005530 Ga0070679_100001167 Ga0070679_1000011674 307
77 3300005535 Ga0070684_100004866 Ga0070684_1000048666 307
78 3300005535 Ga0070684_100036275 Ga0070684_1000362754 307
79 3300005535 Ga0070684_100058093 Ga0070684_1000580934 307
80 3300005535 Ga0070684_100072068 Ga0070684_1000720683 307
81 3300005539 Ga0068853_100034323 Ga0068853_1000343233 307
82 3300005539 Ga0068853_100433746 Ga0068853_1004337462 307
83 3300005543 Ga0070672_100004478 Ga0070672_1000044788 307
84 3300005544 Ga0070686_100007254 Ga0070686_1000072543 307
85 3300005563 Ga0068855_100007475 Ga0068855_1000074752 307
86 3300005563 Ga0068855_100013279 Ga0068855_1000132795 307
87 3300005563 Ga0068855_100278951 Ga0068855_1002789512 307
88 3300005564 Ga0070664_100000204 Ga0070664_10000020413 307
89 3300005577 Ga0068857_100001209 Ga0068857_1000012099 307
90 3300005578 Ga0068854_100066640 Ga0068854_1000666402 307
91 3300005614 Ga0068856_100001334 Ga0068856_10000133420 307
92 3300005616 Ga0068852_100035625 Ga0068852_1000356253 307
93 3300005617 Ga0068859_100027194 Ga0068859_1000271943 307
94 3300005617 Ga0068859_100148694 Ga0068859_1001486942 307
95 3300005618 Ga0068864_100000738 Ga0068864_10000073821 307
96 3300005618 Ga0068864_100021616 Ga0068864_1000216165 307
97 3300005618 Ga0068864_100186907 Ga0068864_1001869072 307
98 3300005841 Ga0068863_100010819 Ga0068863_1000108197 307
99 3300005841 Ga0068863_100184459 Ga0068863_1001844592 307
100 3300005842 Ga0068858_100004232 Ga0068858_1000042325 307
101 3300005842 Ga0068858_100165417 Ga0068858_1001654172 307
102 3300005843 Ga0068860_100025653 Ga0068860_1000256534 307
103 3300005843 Ga0068860_100232199 Ga0068860_1002321992 307
104 3300006028 Ga0070717_10003412 Ga0070717_100034124 307
105 3300006173 Ga0070716_100003790 Ga0070716_1000037904 307
106 3300006173 Ga0070716_100026042 Ga0070716_1000260422 307
107 3300006175 Ga0070712_100000893 Ga0070712_10000089310 307
108 3300006175 Ga0070712_100001442 Ga0070712_1000014425 307
109 3300006237 Ga0097621_100024703 Ga0097621_1000247034 307
110 3300006237 Ga0097621_100066536 Ga0097621_1000665362 307
111 3300006237 Ga0097621_100319934 Ga0097621_1003199342 307
112 3300006237 Ga0097621_100359515 Ga0097621_1003595152 307
113 3300006358 Ga0068871_100030839 Ga0068871_1000308395 307
114 3300006358 Ga0068871_100242745 Ga0068871_1002427451 307
115 3300006871 Ga0075434_100502717 Ga0075434_1005027171 307
116 3300006881 Ga0068865_100095339 Ga0068865_1000953392 307
117 3300006931 Ga0097620_100027195 Ga0097620_1000271953 307
118 3300006931 Ga0097620_100148696 Ga0097620_1001486962 307
119 3300009093 Ga0105240_10011617 Ga0105240_100116176 307
120 3300009093 Ga0105240_10062281 Ga0105240_100622813 307
121 3300009098 Ga0105245_10002931 Ga0105245_100029313 307
122 3300009098 Ga0105245_10100446 Ga0105245_101004463 307
123 3300009098 Ga0105245_10200331 Ga0105245_102003312 307
124 3300009098 Ga0105245_10400432 Ga0105245_104004322 307
125 3300009148 Ga0105243_10261947 Ga0105243_102619472 307
126 3300009148 Ga0105243_10321920 Ga0105243_103219202 307
127 3300009148 Ga0105243_10503144 Ga0105243_105031442 307
128 3300009174 Ga0105241_10011888 Ga0105241_100118884 307
129 3300009174 Ga0105241_10087895 Ga0105241_100878952 307
130 3300009174 Ga0105241_10495924 Ga0105241_104959242 307
131 3300009174 Ga0105241_10534847 Ga0105241_105348472 307
132 3300009176 Ga0105242_10016280 Ga0105242_100162805 307
133 3300009176 Ga0105242_10035147 Ga0105242_100351474 307
134 3300009176 Ga0105242_10416250 Ga0105242_104162501 307
135 3300009177 Ga0105248_10001595 Ga0105248_100015954 307
136 3300009177 Ga0105248_10051373 Ga0105248_100513734 307
137 3300009177 Ga0105248_10202645 Ga0105248_102026452 307
138 3300009177 Ga0105248_10360395 Ga0105248_103603952 307
139 3300009545 Ga0105237_10016662 Ga0105237_100166624 307
140 3300009545 Ga0105237_10024726 Ga0105237_100247263 307
141 3300009545 Ga0105237_10127964 Ga0105237_101279642 307
142 3300009551 Ga0105238_10002683 Ga0105238_100026834 307
143 3300009551 Ga0105238_10038145 Ga0105238_100381452 307
144 3300009551 Ga0105238_10105987 Ga0105238_101059872 307
145 3300009551 Ga0105238_10133009 Ga0105238_101330092 307
146 3300010375 Ga0105239_10009479 Ga0105239_100094793 307
147 3300010375 Ga0105239_10039974 Ga0105239_100399744 307
148 3300011119 Ga0105246_10014199 Ga0105246_100141994 307
149 3300013104 Ga0157370_10010552 Ga0157370_100105526 307
150 3300013104 Ga0157370_10018572 Ga0157370_100185723 307
151 3300013105 Ga0157369_10012340 Ga0157369_100123404 307
152 3300013105 Ga0157369_10031304 Ga0157369_100313044 307
153 3300013105 Ga0157369_10066392 Ga0157369_100663923 307
154 3300013296 Ga0157374_10006261 Ga0157374_100062614 307
155 3300013296 Ga0157374_10076946 Ga0157374_100769462 307
156 3300013296 Ga0157374_10158377 Ga0157374_101583771 307
157 3300013297 Ga0157378_10072565 Ga0157378_100725652 307
158 3300013297 Ga0157378_10267362 Ga0157378_102673622 307
159 3300013306 Ga0163162_10002444 Ga0163162_1000244410 307
160 3300013306 Ga0163162_10764339 Ga0163162_107643392 307
161 3300013307 Ga0157372_10003092 Ga0157372_100030924 307
162 3300013307 Ga0157372_10179286 Ga0157372_101792863 307
163 3300013308 Ga0157375_10057940 Ga0157375_100579402 307
164 3300013308 Ga0157375_10157345 Ga0157375_101573452 307
165 3300014325 Ga0163163_10016359 Ga0163163_100163594 307
166 3300014325 Ga0163163_10030465 Ga0163163_100304654 307
167 3300014325 Ga0163163_10056418 Ga0163163_100564184 307
168 3300014325 Ga0163163_10147316 Ga0163163_101473163 307
169 3300014969 Ga0157376_10036831 Ga0157376_100368312 307
170 3300014969 Ga0157376_10343933 Ga0157376_103439332 307
171 3300021358 Ga0213873_10018202 Ga0213873_100182022 307
172 3300025903 Ga0207680_10008748 Ga0207680_100087482 307
173 3300025906 Ga0207699_10000715 Ga0207699_100007157 307
174 3300025906 Ga0207699_10006244 Ga0207699_100062443 307
175 3300025910 Ga0207684_10033080 Ga0207684_100330802 307
176 3300025911 Ga0207654_10006021 Ga0207654_100060214 307
177 3300025911 Ga0207654_10312280 Ga0207654_103122801 307
178 3300025912 Ga0207707_10002195 Ga0207707_1000219513 307
179 3300025913 Ga0207695_10000768 Ga0207695_1000076814 307
180 3300025913 Ga0207695_10073553 Ga0207695_100735533 307
181 3300025914 Ga0207671_10037938 Ga0207671_100379384 307
182 3300025914 Ga0207671_10165531 Ga0207671_101655312 307
183 3300025915 Ga0207693_10000108 Ga0207693_1000010836 307
184 3300025915 Ga0207693_10015198 Ga0207693_100151984 307
185 3300025916 Ga0207663_10084339 Ga0207663_100843392 307
186 3300025917 Ga0207660_10113703 Ga0207660_101137032 307
187 3300025919 Ga0207657_10121916 Ga0207657_101219163 307
188 3300025920 Ga0207649_10036108 Ga0207649_100361083 307
189 3300025920 Ga0207649_10113732 Ga0207649_101137322 307
190 3300025921 Ga0207652_10001481 Ga0207652_1000148115 307
191 3300025924 Ga0207694_10002477 Ga0207694_100024772 307
192 3300025924 Ga0207694_10003769 Ga0207694_100037693 307
193 3300025924 Ga0207694_10016496 Ga0207694_100164964 307
194 3300025924 Ga0207694_10082371 Ga0207694_100823713 307
195 3300025924 Ga0207694_10373494 Ga0207694_103734941 307
196 3300025925 Ga0207650_10001625 Ga0207650_100016256 307
197 3300025927 Ga0207687_10010708 Ga0207687_100107084 307
198 3300025927 Ga0207687_10023066 Ga0207687_100230663 307
199 3300025927 Ga0207687_10068590 Ga0207687_100685902 307
200 3300025927 Ga0207687_10082323 Ga0207687_100823233 307
201 3300025928 Ga0207700_10004544 Ga0207700_100045447 307
202 3300025928 Ga0207700_10005144 Ga0207700_100051447 307
203 3300025928 Ga0207700_10027875 Ga0207700_100278752 307
204 3300025929 Ga0207664_10048768 Ga0207664_100487684 307
205 3300025929 Ga0207664_10135579 Ga0207664_101355792 307
206 3300025931 Ga0207644_10013545 Ga0207644_100135453 307
207 3300025934 Ga0207686_10189956 Ga0207686_101899562 307
208 3300025935 Ga0207709_10083180 Ga0207709_100831802 307
209 3300025935 Ga0207709_10086840 Ga0207709_100868402 307
210 3300025938 Ga0207704_10224185 Ga0207704_102241851 307
211 3300025938 Ga0207704_10252890 Ga0207704_102528902 307
212 3300025939 Ga0207665_10001840 Ga0207665_100018409 307
213 3300025939 Ga0207665_10083472 Ga0207665_100834723 307
214 3300025940 Ga0207691_10009274 Ga0207691_100092743 307
215 3300025940 Ga0207691_10375972 Ga0207691_103759721 307
216 3300025941 Ga0207711_10005417 Ga0207711_100054176 307
217 3300025941 Ga0207711_10089791 Ga0207711_100897913 307
218 3300025942 Ga0207689_10068240 Ga0207689_100682402 307
219 3300025944 Ga0207661_10001936 Ga0207661_100019369 307
220 3300025944 Ga0207661_10011769 Ga0207661_100117693 307
221 3300025944 Ga0207661_10035478 Ga0207661_100354784 307
222 3300025945 Ga0207679_10007116 Ga0207679_100071167 307
223 3300025949 Ga0207667_10002519 Ga0207667_100025194 307
224 3300025949 Ga0207667_10020639 Ga0207667_100206395 307
225 3300025949 Ga0207667_10242856 Ga0207667_102428562 307
226 3300025960 Ga0207651_10008592 Ga0207651_100085926 307
227 3300025981 Ga0207640_10065668 Ga0207640_100656682 307
228 3300026023 Ga0207677_10001963 Ga0207677_100019635 307
229 3300026035 Ga0207703_10023698 Ga0207703_100236987 307
230 3300026035 Ga0207703_10298129 Ga0207703_102981292 307
231 3300026041 Ga0207639_10180038 Ga0207639_101800382 307
232 3300026078 Ga0207702_10008454 Ga0207702_100084543 307
233 3300026078 Ga0207702_10129825 Ga0207702_101298252 307
234 3300026089 Ga0207648_10084079 Ga0207648_100840792 307
235 3300026095 Ga0207676_10008022 Ga0207676_100080225 307
236 3300026095 Ga0207676_10168185 Ga0207676_101681852 307
237 3300026095 Ga0207676_10255315 Ga0207676_102553152 307
238 3300026116 Ga0207674_10000072 Ga0207674_1000007237 307
239 3300026116 Ga0207674_10025920 Ga0207674_100259205 307
240 3300026142 Ga0207698_10009064 Ga0207698_100090644 307
241 3300028017 Ga0265356_1009368 Ga0265356_10093681 307
242 3300028381 Ga0268264_10056279 Ga0268264_100562792 307
243 3300028800 Ga0265338_10043786 Ga0265338_100437862 307
244 3300030760 Ga0265762_1000133 Ga0265762_10001337 307
245 3300031247 Ga0265340_10095903 Ga0265340_100959032 307
246 3300031711 Ga0265314_10009360 Ga0265314_100093602 307
247 3300035086 Ga0373934_0004171 Ga0373934_0004171_4114_5052 307
248 3300035118 Ga0373954_0007913 Ga0373954_0007913_2855_3793 307
249 3300035172 Ga0373955_0013608 Ga0373955_0013608_2537_3475 307
250 3300035172 Ga0373955_0016763 Ga0373955_0016763_261_1199 307
251 3300035725 Ga0373947_0178958 Ga0373947_0178958_312_1250 307
252 3300036401 Ga0373937_0001861 Ga0373937_0001861_13376_14314 307
253 3300036401 Ga0373937_0002150 Ga0373937_0002150_13594_14532 307
254 3300036401 Ga0373937_0003162 Ga0373937_0003162_3506_4465 307
255 3300036401 Ga0373937_0053373 Ga0373937_0053373_166_1104 307
256 3300039453 Ga0436362_0058380 Ga0436362_0058380_422_1354 307
257 3300046454 Ga0495592_0005305 Ga0495592_0005305_5807_6745 307
258 3300046459 Ga0495629_0040001 Ga0495629_0040001_792_1730 307
259 3300046459 Ga0495629_0319557 Ga0495629_0319557_23_961 307
260 3300046473 Ga0495582_0033029 Ga0495582_0033029_1710_2660 307
261 3300046476 Ga0495662_0035473 Ga0495662_0035473_22_960 307
262 3300046499 Ga0495594_0046943 Ga0495594_0046943_369_1307 307
263 3300046499 Ga0495594_0190067 Ga0495594_0190067_67_1017 307
264 3300046514 Ga0495618_0094981 Ga0495618_0094981_222_1160 307
265 3300046529 Ga0495652_0063979 Ga0495652_0063979_359_1297 307
266 3300046536 Ga0495587_0029341 Ga0495587_0029341_1362_2321 307
267 3300046559 Ga0495667_0001172 Ga0495667_0001172_13683_14621 307
268 3300046675 Ga0495657_0000805 Ga0495657_0000805_9190_10128 307
269 3300046678 Ga0495599_0029754 Ga0495599_0029754_1825_2763 307
270 3300046678 Ga0495599_0061610 Ga0495599_0061610_1276_2214 307
271 3300046681 Ga0495647_0034330 Ga0495647_0034330_310_1248 307
272 3300046683 Ga0495658_0213526 Ga0495658_0213526_157_1095 307
273 3300046689 Ga0495613_0005125 Ga0495613_0005125_2898_3836 307
274 3300046689 Ga0495613_0177567 Ga0495613_0177567_11_949 307
275 3300046689 Ga0495613_0307884 Ga0495613_0307884_24_962 307
276 3300047318 Ga0495636_0058105 Ga0495636_0058105_122_1060 307
277 3300047319 Ga0495674_0050886 Ga0495674_0050886_1129_2067 307
278 3300047319 Ga0495674_0228058 Ga0495674_0228058_573_1523 307
279 3300047471 Ga0495684_0022155 Ga0495684_0022155_887_1825 307
280 3300047471 Ga0495684_0037796 Ga0495684_0037796_1787_2725 307
281 3300047471 Ga0495684_0190973 Ga0495684_0190973_119_1057 307
282 3300047471 Ga0495684_0292158 Ga0495684_0292158_203_1141 307
283 3300048088 Ga0495602_0005196 Ga0495602_0005196_10735_11694 307
284 3300048903 Ga0496100_0236953 Ga0496100_0236953_334_1272 307
285 3300049743 Ga0501081_0081951 Ga0501081_0081951_660_1592 307
286 3300050512 nmdc:mga0n895_587641_c1 nmdc:mga0n895_587641_c1_111_1049 307
287 3300005367 Ga0070667_100398714 Ga0070667_1003987142 308
288 3300006914 Ga0075436_100071715 Ga0075436_1000717152 308
289 3300009177 Ga0105248_10125138 Ga0105248_101251382 308
290 3300025913 Ga0207695_10071430 Ga0207695_100714303 308
291 3300025941 Ga0207711_10093531 Ga0207711_100935312 308
292 3300026035 Ga0207703_10221055 Ga0207703_102210552 308
293 3300028556 Ga0265337_1048679 Ga0265337_10486792 308
294 3300028800 Ga0265338_10017405 Ga0265338_100174052 308
295 3300028800 Ga0265338_10086478 Ga0265338_100864783 308
296 3300031090 Ga0265760_10018651 Ga0265760_100186512 308
297 3300031238 Ga0265332_10035138 Ga0265332_100351381 308
298 3300031344 Ga0265316_10147125 Ga0265316_101471252 308
299 3300035692 Ga0373935_0015647 Ga0373935_0015647_1844_2794 308
300 3300035695 Ga0373927_0007055 Ga0373927_0007055_5248_6201 308
301 3300042876 Ga0451577_0015547 Ga0451577_0015547_1434_2393 308
302 3300045051 Ga0451576_0051507 Ga0451576_0051507_3120_4061 308
303 3300046642 Ga0495634_0034461 Ga0495634_0034461_78_1019 308
304 3300050512 nmdc:mga0n895_47774_c1 nmdc:mga0n895_47774_c1_2571_3518 308
305 3300050514 nmdc:mga08x19_4971_c1 nmdc:mga08x19_4971_c1_5648_6595 308
306 3300005436 Ga0070713_100046629 Ga0070713_1000466294 309
307 3300005439 Ga0070711_100145102 Ga0070711_1001451022 309
308 3300006881 Ga0068865_100043585 Ga0068865_1000435853 309
309 3300009098 Ga0105245_10204340 Ga0105245_102043402 309
310 3300009545 Ga0105237_10027240 Ga0105237_100272404 309
311 3300009551 Ga0105238_10024681 Ga0105238_100246814 309
312 3300014325 Ga0163163_10012832 Ga0163163_100128324 309
313 3300025913 Ga0207695_10034350 Ga0207695_100343505 309
314 3300025916 Ga0207663_10065313 Ga0207663_100653132 309
315 3300025924 Ga0207694_10033293 Ga0207694_100332933 309
316 3300025938 Ga0207704_10148410 Ga0207704_101484102 309
317 3300028379 Ga0268266_10058649 Ga0268266_100586492 309
318 3300028381 Ga0268264_10409214 Ga0268264_104092142 309
319 3300028800 Ga0265338_10003647 Ga0265338_1000364714 309
320 3300031249 Ga0265339_10147259 Ga0265339_101472591 309
321 3300005364 Ga0070673_100196175 Ga0070673_1001961752 310
322 3300005617 Ga0068859_100306994 Ga0068859_1003069942 310
323 3300006028 Ga0070717_10010368 Ga0070717_100103682 310
324 3300006931 Ga0097620_100306983 Ga0097620_1003069832 310
325 3300009094 Ga0111539_10407522 Ga0111539_104075222 310
326 3300009177 Ga0105248_10257940 Ga0105248_102579401 310
327 3300013306 Ga0163162_10499210 Ga0163162_104992101 310
328 3300014969 Ga0157376_10088729 Ga0157376_100887292 310
329 3300014969 Ga0157376_10484256 Ga0157376_104842562 310
330 3300025941 Ga0207711_10498922 Ga0207711_104989221 310
331 3300025960 Ga0207651_10170412 Ga0207651_101704122 310
332 3300026088 Ga0207641_10065204 Ga0207641_100652042 310
333 3300026088 Ga0207641_10109940 Ga0207641_101099402 310
334 3300035725 Ga0373947_0105702 Ga0373947_0105702_252_1196 310
335 3300036401 Ga0373937_0106917 Ga0373937_0106917_1638_2582 310
336 3300041505 Ga0451849_1474294 Ga0451849_1474294_564_1511 310
337 3300045051 Ga0451576_0499113 Ga0451576_0499113_195_1151 310
338 3300046459 Ga0495629_0152578 Ga0495629_0152578_270_1238 310
339 3300046462 Ga0495651_0031116 Ga0495651_0031116_879_1847 310
340 3300046462 Ga0495651_0092374 Ga0495651_0092374_724_1668 310
341 3300046472 Ga0495580_0002919 Ga0495580_0002919_8170_9138 310
342 3300046476 Ga0495662_0014396 Ga0495662_0014396_1259_2203 310
343 3300046477 Ga0495664_0185993 Ga0495664_0185993_201_1145 310
344 3300046511 Ga0495608_0053321 Ga0495608_0053321_1370_2314 310
345 3300046516 Ga0495628_0090609 Ga0495628_0090609_273_1217 310
346 3300046529 Ga0495652_0065122 Ga0495652_0065122_1864_2808 310
347 3300046529 Ga0495652_0109323 Ga0495652_0109323_26_994 310
348 3300046531 Ga0495665_0063480 Ga0495665_0063480_478_1422 310
349 3300046533 Ga0495640_0134316 Ga0495640_0134316_635_1579 310
350 3300046536 Ga0495587_0018019 Ga0495587_0018019_1805_2749 310
351 3300046536 Ga0495587_0232956 Ga0495587_0232956_59_1015 310
352 3300046543 Ga0495645_0008623 Ga0495645_0008623_1649_2593 310
353 3300046543 Ga0495645_0043479 Ga0495645_0043479_1274_2218 310
354 3300046559 Ga0495667_0009119 Ga0495667_0009119_1840_2808 310
355 3300046559 Ga0495667_0081597 Ga0495667_0081597_553_1497 310
356 3300046559 Ga0495667_0087264 Ga0495667_0087264_25_969 310
357 3300046642 Ga0495634_0027000 Ga0495634_0027000_1938_2882 310
358 3300046675 Ga0495657_0144569 Ga0495657_0144569_345_1289 310
359 3300046678 Ga0495599_0037075 Ga0495599_0037075_191_1135 310
360 3300046679 Ga0495623_0009717 Ga0495623_0009717_141_1109 310
361 3300046679 Ga0495623_0084200 Ga0495623_0084200_822_1766 310
362 3300046679 Ga0495623_0174739 Ga0495623_0174739_207_1151 310
363 3300046689 Ga0495613_0039834 Ga0495613_0039834_1939_2883 310
364 3300046809 Ga0495600_0210663 Ga0495600_0210663_184_1128 310
365 3300047317 Ga0495604_0045331 Ga0495604_0045331_651_1619 310
366 3300047319 Ga0495674_0046953 Ga0495674_0046953_1936_2880 310
367 3300047319 Ga0495674_0163574 Ga0495674_0163574_860_1804 310
368 3300047319 Ga0495674_0197549 Ga0495674_0197549_699_1643 310
369 3300047322 Ga0495680_0042468 Ga0495680_0042468_624_1568 310
370 3300047444 Ga0495675_0103944 Ga0495675_0103944_51_1007 310
371 3300047444 Ga0495675_0189455 Ga0495675_0189455_35_979 310
372 3300047471 Ga0495684_0001338 Ga0495684_0001338_4131_5099 310
373 3300047471 Ga0495684_0058611 Ga0495684_0058611_97_1041 310
374 3300047471 Ga0495684_0160452 Ga0495684_0160452_645_1589 310
375 3300048088 Ga0495602_0021680 Ga0495602_0021680_645_1613 310
376 3300048088 Ga0495602_0160439 Ga0495602_0160439_635_1579 310
377 3300005331 Ga0070670_100045892 Ga0070670_1000458925 311
378 3300005347 Ga0070668_100220827 Ga0070668_1002208272 311
379 3300005353 Ga0070669_100116165 Ga0070669_1001161652 311
380 3300005354 Ga0070675_100000232 Ga0070675_1000002325 311
381 3300005354 Ga0070675_100020829 Ga0070675_1000208296 311
382 3300005355 Ga0070671_100021731 Ga0070671_1000217314 311
383 3300005355 Ga0070671_100306270 Ga0070671_1003062702 311
384 3300005356 Ga0070674_100019822 Ga0070674_1000198221 311
385 3300005364 Ga0070673_100003259 Ga0070673_1000032597 311
386 3300005367 Ga0070667_100021308 Ga0070667_1000213083 311
387 3300005445 Ga0070708_100022211 Ga0070708_1000222114 311
388 3300005445 Ga0070708_100106479 Ga0070708_1001064792 311
389 3300005459 Ga0068867_100041415 Ga0068867_1000414153 311
390 3300005459 Ga0068867_100106341 Ga0068867_1001063412 311
391 3300005466 Ga0070685_10011334 Ga0070685_100113344 311
392 3300005543 Ga0070672_100032800 Ga0070672_1000328004 311
393 3300005543 Ga0070672_100155943 Ga0070672_1001559432 311
394 3300005544 Ga0070686_100056532 Ga0070686_1000565322 311
395 3300005544 Ga0070686_100090915 Ga0070686_1000909152 311
396 3300005549 Ga0070704_100170643 Ga0070704_1001706432 311
397 3300005577 Ga0068857_100297767 Ga0068857_1002977672 311
398 3300005617 Ga0068859_100013583 Ga0068859_1000135836 311
399 3300005618 Ga0068864_100283606 Ga0068864_1002836062 311
400 3300005840 Ga0068870_10030695 Ga0068870_100306952 311
401 3300005841 Ga0068863_100002245 Ga0068863_10000224510 311
402 3300005841 Ga0068863_100038929 Ga0068863_1000389292 311
403 3300005842 Ga0068858_100076564 Ga0068858_1000765643 311
404 3300005842 Ga0068858_100113081 Ga0068858_1001130812 311
405 3300005843 Ga0068860_100007134 Ga0068860_1000071349 311
406 3300005844 Ga0068862_100025939 Ga0068862_1000259392 311
407 3300005844 Ga0068862_100050568 Ga0068862_1000505683 311
408 3300006038 Ga0075365_10016699 Ga0075365_100166993 311
409 3300006042 Ga0075368_10037287 Ga0075368_100372872 311
410 3300006051 Ga0075364_10019845 Ga0075364_100198453 311
411 3300006051 Ga0075364_10022064 Ga0075364_100220644 311
412 3300006177 Ga0075362_10017713 Ga0075362_100177133 311
413 3300006178 Ga0075367_10002237 Ga0075367_100022374 311
414 3300006195 Ga0075366_10000973 Ga0075366_100009735 311
415 3300006237 Ga0097621_100018223 Ga0097621_1000182234 311
416 3300006358 Ga0068871_100076468 Ga0068871_1000764682 311
417 3300006844 Ga0075428_100036814 Ga0075428_1000368144 311
418 3300006847 Ga0075431_100015868 Ga0075431_1000158685 311
419 3300006847 Ga0075431_100380951 Ga0075431_1003809512 311
420 3300006871 Ga0075434_100048548 Ga0075434_1000485484 311
421 3300006881 Ga0068865_100042805 Ga0068865_1000428053 311
422 3300006931 Ga0097620_100013583 Ga0097620_1000135833 311
423 3300007076 Ga0075435_100073906 Ga0075435_1000739062 311
424 3300009094 Ga0111539_10003069 Ga0111539_100030695 311
425 3300009098 Ga0105245_10119641 Ga0105245_101196412 311
426 3300009148 Ga0105243_10039903 Ga0105243_100399032 311
427 3300009176 Ga0105242_10057251 Ga0105242_100572512 311
428 3300009177 Ga0105248_10000562 Ga0105248_100005624 311
429 3300009177 Ga0105248_10037993 Ga0105248_100379934 311
430 3300009553 Ga0105249_10040144 Ga0105249_100401443 311
431 3300011119 Ga0105246_10106680 Ga0105246_101066802 311
432 3300013296 Ga0157374_10038933 Ga0157374_100389332 311
433 3300013297 Ga0157378_10111951 Ga0157378_101119513 311
434 3300013306 Ga0163162_10000995 Ga0163162_100009957 311
435 3300013306 Ga0163162_10340480 Ga0163162_103404802 311
436 3300013308 Ga0157375_10004297 Ga0157375_100042974 311
437 3300013308 Ga0157375_10144400 Ga0157375_101444002 311
438 3300014325 Ga0163163_10007949 Ga0163163_100079497 311
439 3300014326 Ga0157380_10382664 Ga0157380_103826641 311
440 3300014968 Ga0157379_10000277 Ga0157379_1000027741 311
441 3300017792 Ga0163161_10066834 Ga0163161_100668342 311
442 3300025903 Ga0207680_10021498 Ga0207680_100214984 311
443 3300025908 Ga0207643_10009998 Ga0207643_100099982 311
444 3300025910 Ga0207684_10229641 Ga0207684_102296412 311
445 3300025913 Ga0207695_10011181 Ga0207695_100111813 311
446 3300025918 Ga0207662_10010850 Ga0207662_100108503 311
447 3300025925 Ga0207650_10014064 Ga0207650_100140643 311
448 3300025926 Ga0207659_10001985 Ga0207659_100019859 311
449 3300025926 Ga0207659_10004565 Ga0207659_100045658 311
450 3300025931 Ga0207644_10013348 Ga0207644_100133482 311
451 3300025933 Ga0207706_10505370 Ga0207706_105053701 311
452 3300025935 Ga0207709_10107526 Ga0207709_101075262 311
453 3300025938 Ga0207704_10067114 Ga0207704_100671142 311
454 3300025940 Ga0207691_10102531 Ga0207691_101025312 311
455 3300025940 Ga0207691_10182177 Ga0207691_101821772 311
456 3300025941 Ga0207711_10001521 Ga0207711_1000152110 311
457 3300025942 Ga0207689_10123920 Ga0207689_101239203 311
458 3300025960 Ga0207651_10007268 Ga0207651_100072683 311
459 3300025961 Ga0207712_10096161 Ga0207712_100961613 311
460 3300025986 Ga0207658_10006343 Ga0207658_100063436 311
461 3300026023 Ga0207677_10134880 Ga0207677_101348802 311
462 3300026035 Ga0207703_10035135 Ga0207703_100351352 311
463 3300026035 Ga0207703_10419345 Ga0207703_104193452 311
464 3300026067 Ga0207678_10036717 Ga0207678_100367174 311
465 3300026075 Ga0207708_10021580 Ga0207708_100215803 311
466 3300026088 Ga0207641_10015607 Ga0207641_100156074 311
467 3300026089 Ga0207648_10004080 Ga0207648_100040806 311
468 3300026089 Ga0207648_10121295 Ga0207648_101212952 311
469 3300026116 Ga0207674_10288045 Ga0207674_102880454 311
470 3300026121 Ga0207683_10026551 Ga0207683_100265514 311
471 3300027907 Ga0207428_10000311 Ga0207428_100003116 311
472 3300027907 Ga0207428_10018382 Ga0207428_100183824 311
473 3300028380 Ga0268265_10039013 Ga0268265_100390133 311
474 3300028380 Ga0268265_10055000 Ga0268265_100550002 311
475 3300028381 Ga0268264_10003384 Ga0268264_1000338413 311
476 3300028381 Ga0268264_10028839 Ga0268264_100288393 311
477 3300042876 Ga0451577_0004594 Ga0451577_0004594_9517_10470 311
478 3300044694 Ga0466963_0190448 Ga0466963_0190448_163_1119 311
479 3300044712 Ga0453684_0221537 Ga0453684_0221537_66_1013 311
480 3300046475 Ga0495639_0082077 Ga0495639_0082077_356_1303 311
481 3300046692 Ga0495671_0118441 Ga0495671_0118441_53_1000 311
482 3300050489 nmdc:mga03683_13355_c1 nmdc:mga03683_13355_c1_1398_2345 311
483 3300050491 nmdc:mga00v17_26006_c1 nmdc:mga00v17_26006_c1_925_1872 311
484 3300050492 nmdc:mga0yw44_26684_c1 nmdc:mga0yw44_26684_c1_1431_2378 311
485 3300050493 nmdc:mga0k408_10429_c1 nmdc:mga0k408_10429_c1_925_1872 311
486 3300050494 nmdc:mga06z11_24119_c1 nmdc:mga06z11_24119_c1_1784_2731 311
487 3300050508 nmdc:mga09592_20661_c1 nmdc:mga09592_20661_c1_2339_3286 311
488 3300050510 nmdc:mga06r32_271238_c1 nmdc:mga06r32_271238_c1_420_1367 311
489 3300050510 nmdc:mga06r32_965_c1 nmdc:mga06r32_965_c1_1487_2434 311
490 3300050511 nmdc:mga08y16_38214_c1 nmdc:mga08y16_38214_c1_3043_3990 311
491 3300050512 nmdc:mga0n895_71627_c1 nmdc:mga0n895_71627_c1_1585_2532 311
492 3300054114 Ga0501084_0152269 Ga0501084_0152269_684_1631 311
493 3300005353 Ga0070669_100000006 Ga0070669_100000006189 312
494 3300005406 Ga0070703_10000937 Ga0070703_100009376 312
495 3300005434 Ga0070709_10000029 Ga0070709_1000002938 312
496 3300005439 Ga0070711_100000027 Ga0070711_10000002752 312
497 3300005440 Ga0070705_100000221 Ga0070705_10000022118 312
498 3300005467 Ga0070706_100000208 Ga0070706_10000020818 312
499 3300005468 Ga0070707_100541900 Ga0070707_1005419002 312
500 3300005518 Ga0070699_100000029 Ga0070699_100000029108 312
501 3300005545 Ga0070695_100019093 Ga0070695_1000190932 312
502 3300005546 Ga0070696_100000362 Ga0070696_10000036214 312
503 3300005546 Ga0070696_100036675 Ga0070696_1000366752 312
504 3300005547 Ga0070693_100002949 Ga0070693_1000029495 312
505 3300005549 Ga0070704_100128133 Ga0070704_1001281332 312
506 3300006173 Ga0070716_100000018 Ga0070716_1000000186 312
507 3300006175 Ga0070712_100091771 Ga0070712_1000917712 312
508 3300006844 Ga0075428_100001485 Ga0075428_10000148514 312
509 3300006852 Ga0075433_10071431 Ga0075433_100714312 312
510 3300006852 Ga0075433_10171755 Ga0075433_101717552 312
511 3300006871 Ga0075434_100249803 Ga0075434_1002498031 312
512 3300006871 Ga0075434_100257020 Ga0075434_1002570202 312
513 3300006914 Ga0075436_100003047 Ga0075436_1000030477 312
514 3300009094 Ga0111539_10056627 Ga0111539_100566274 312
515 3300009147 Ga0114129_10021567 Ga0114129_100215675 312
516 3300009147 Ga0114129_10093522 Ga0114129_100935221 312
517 3300009147 Ga0114129_10202857 Ga0114129_102028572 312
518 3300013297 Ga0157378_10430742 Ga0157378_104307422 312
519 3300025885 Ga0207653_10000261 Ga0207653_1000026114 312
520 3300025906 Ga0207699_10000002 Ga0207699_1000000280 312
521 3300025910 Ga0207684_10000248 Ga0207684_1000024832 312
522 3300025915 Ga0207693_10103107 Ga0207693_101031072 312
523 3300025916 Ga0207663_10000006 Ga0207663_1000000659 312
524 3300025923 Ga0207681_10000006 Ga0207681_1000000647 312
525 3300025939 Ga0207665_10000022 Ga0207665_1000002235 312
526 3300041486 Ga0451807_0480303 Ga0451807_0480303_322_1299 312
527 3300044673 Ga0453683_0259289 Ga0453683_0259289_28_978 312
528 3300049583 Ga0501067_0019173 Ga0501067_0019173_2109_3083 312
529 3300049591 Ga0501075_0007778 Ga0501075_0007778_5214_6188 312
530 3300049593 Ga0501077_0000356 Ga0501077_0000356_12356_13330 312
531 3300049742 Ga0501080_0047736 Ga0501080_0047736_2771_3745 312
532 3300050507 nmdc:mga05p37_313_c1 nmdc:mga05p37_313_c1_41376_42434 312
533 3300050507 nmdc:mga05p37_81636_c1 nmdc:mga05p37_81636_c1_881_1825 312
534 3300050508 nmdc:mga09592_14555_c1 nmdc:mga09592_14555_c1_1203_2156 312
535 3300050511 nmdc:mga08y16_49736_c1 nmdc:mga08y16_49736_c1_2439_3392 312
536 3300050512 nmdc:mga0n895_507315_c1 nmdc:mga0n895_507315_c1_197_1150 312
537 3300050514 nmdc:mga08x19_39_c1 nmdc:mga08x19_39_c1_39055_40005 312
538 3300050515 nmdc:mga0a205_177158_c1 nmdc:mga0a205_177158_c1_32_985 312
539 3300050515 nmdc:mga0a205_69319_c1 nmdc:mga0a205_69319_c1_183_1133 312
540 3300060353 Ga0501082_0018891 Ga0501082_0018891_2398_3372 312
541 3300005289 Ga0065704_10172793 Ga0065704_101727931 313
542 3300005353 Ga0070669_100023551 Ga0070669_1000235514 313
543 3300005438 Ga0070701_10107406 Ga0070701_101074062 313
544 3300005444 Ga0070694_100090292 Ga0070694_1000902922 313
545 3300005459 Ga0068867_100281886 Ga0068867_1002818862 313
546 3300005468 Ga0070707_100045880 Ga0070707_1000458803 313
547 3300005546 Ga0070696_100217979 Ga0070696_1002179792 313
548 3300005548 Ga0070665_100000243 Ga0070665_10000024360 313
549 3300005549 Ga0070704_100009781 Ga0070704_1000097814 313
550 3300005549 Ga0070704_100092067 Ga0070704_1000920672 313
551 3300005577 Ga0068857_100091735 Ga0068857_1000917353 313
552 3300005577 Ga0068857_100277809 Ga0068857_1002778091 313
553 3300005618 Ga0068864_100351775 Ga0068864_1003517752 313
554 3300005719 Ga0068861_100005078 Ga0068861_1000050785 313
555 3300005843 Ga0068860_100129280 Ga0068860_1001292802 313
556 3300005844 Ga0068862_100008716 Ga0068862_1000087162 313
557 3300005844 Ga0068862_100011595 Ga0068862_1000115955 313
558 3300006163 Ga0070715_10000013 Ga0070715_100000137 313
559 3300006852 Ga0075433_10003222 Ga0075433_100032222 313
560 3300006871 Ga0075434_100004737 Ga0075434_1000047372 313
561 3300006871 Ga0075434_100058799 Ga0075434_1000587994 313
562 3300006871 Ga0075434_100358933 Ga0075434_1003589332 313
563 3300007076 Ga0075435_100095849 Ga0075435_1000958492 313
564 3300007265 Ga0099794_10007949 Ga0099794_100079493 313
565 3300009147 Ga0114129_10000027 Ga0114129_1000002720 313
566 3300009148 Ga0105243_10343787 Ga0105243_103437872 313
567 3300009174 Ga0105241_10204423 Ga0105241_102044232 313
568 3300009553 Ga0105249_10169715 Ga0105249_101697152 313
569 3300009553 Ga0105249_10275134 Ga0105249_102751342 313
570 3300014326 Ga0157380_10081812 Ga0157380_100818123 313
571 3300025905 Ga0207685_10000013 Ga0207685_100000136 313
572 3300025911 Ga0207654_10207488 Ga0207654_102074882 313
573 3300025922 Ga0207646_10094543 Ga0207646_100945433 313
574 3300025923 Ga0207681_10071782 Ga0207681_100717822 313
575 3300025961 Ga0207712_10117064 Ga0207712_101170642 313
576 3300025981 Ga0207640_10348174 Ga0207640_103481741 313
577 3300026095 Ga0207676_10349132 Ga0207676_103491322 313
578 3300026116 Ga0207674_10050816 Ga0207674_100508163 313
579 3300026118 Ga0207675_100009987 Ga0207675_1000099875 313
580 3300028379 Ga0268266_10000427 Ga0268266_100004275 313
581 3300028380 Ga0268265_10155007 Ga0268265_101550072 313
582 3300028380 Ga0268265_10172897 Ga0268265_101728972 313
583 3300035241 Ga0373961_0035683 Ga0373961_0035683_124_1110 313
584 3300042876 Ga0451577_0090976 Ga0451577_0090976_593_1546 313
585 3300044712 Ga0453684_0032892 Ga0453684_0032892_2383_3336 313
586 3300048917 Ga0496114_0000011 Ga0496114_0000011_115656_116630 313
587 3300049584 Ga0501068_0133030 Ga0501068_0133030_108_1082 313
588 3300050507 nmdc:mga05p37_3554_c1 nmdc:mga05p37_3554_c1_14392_15351 313
589 3300050513 nmdc:mga0rr50_84810_c1 nmdc:mga0rr50_84810_c1_483_1442 313
590 3300050515 nmdc:mga0a205_3117_c2 nmdc:mga0a205_3117_c2_12580_13539 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

34

176

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

131

211

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9379 6 223
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9366 6 223
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9338 8 219
5lj6-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p6522) 0.9297 8 219
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9276 8 219
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 6 222 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9509 6 229 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 8 214 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9417 8 226 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9392 8 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0S9DLE0-F1-model_v4 ABC transporter domain-containing protein 0.9618 7 224 GO:0005524
GO:0016887
GO:0046677
AF-A0A7W7BQI4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9585 8 224 GO:0005524
GO:0016887
GO:0046677
AF-A0A4Q7PN08-F1-model_v4 deleted 0.956 8 226
AF-A0A2R9UI31-F1-model_v4 ABC transporter 0.9556 8 226 GO:0005524
GO:0016887
GO:0046677
AF-A0A1V5YM67-F1-model_v4 Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) 0.953 8 222 GO:0005524
GO:0016887
GO:0017004
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.75 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map