F466933

General Info

Members Datasets Scaffolds Average Seq Length
590 245 1180 358

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10089610|Ga0065712_100896103
Length 398
Sequence VSVLVSTSRERLHDRWGTLARASCVLAVLLLAPGGAMSPRAQGQTSQTLQIYVVDVEGGNATLFVAPSGESLLIDSGNGGSQGAALANAVRDAGRIVAASNDAGITRIDHLITTHWHSDHFGGMAELASRLPIRHFIDHGTNAPDDFAHAAADEFLRNTYPTLIAKGTHTIVQPGDRVAVAGLDVLVLTSAGRTISNASPGAGRSNPLCAEFQPGQNNAEDPLSVGVLVSFGSFRAVHLGDLTKNKEFELACPANRIGTVQMMLGLHHGVDSSNSRVLVHALHPRVAIMNNGTRKGGQPDVMKTLHSSPGLEDLWQMHFSELSGQEYTVPGMFIANVTDNPAQAMTVAPAQAPEAGAAAPPAPVHNGPAFWIKVSAHNDGSFVVTNARNGFSKTYGLQ

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.69
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 17.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10089610 3300005290 Bacteria 2462
2 JGI24746J21847_1002927 3300001977 Bacteria 2685
3 JGI24751J29686_10003066 3300002459 Bacteria 3367
4 JGI25406J46586_10000430 3300003203 Bacteria 19367
5 JGI25406J46586_10009242 3300003203 Bacteria 4420
6 Ga0065712_10004931 3300005290 Bacteria 4875
7 Ga0065707_10090576 3300005295 Bacteria 4112
8 Ga0070676_10013100 3300005328 Unclassified 4543
9 Ga0070676_10097480 3300005328 Bacteria 1811
10 Ga0070683_100004982 3300005329 Bacteria 11025
11 Ga0070683_100093197 3300005329 Bacteria 2829
12 Ga0070683_100094551 3300005329 Bacteria 2809
13 Ga0070683_100109059 3300005329 Bacteria 2611
14 Ga0070690_100014571 3300005330 Bacteria 4666
15 Ga0070690_100077128 3300005330 Bacteria 2175
16 Ga0070670_100015239 3300005331 Bacteria 6598
17 Ga0070670_100074553 3300005331 Bacteria 2915
18 Ga0070670_100144453 3300005331 Archaea 2058
19 Ga0070670_100158354 3300005331 Unclassified 1962
20 Ga0070670_100346139 3300005331 Bacteria 1305
21 Ga0070677_10027815 3300005333 Unclassified 2132
22 Ga0070677_10073110 3300005333 Bacteria 1448
23 Ga0068869_100004937 3300005334 Bacteria 8342
24 Ga0068869_100110555 3300005334 Unclassified 2090
25 Ga0068869_100172614 3300005334 Unclassified 1690
26 Ga0068869_100392719 3300005334 Unclassified 1139
27 Ga0070666_10007266 3300005335 Bacteria 6829
28 Ga0070680_100192840 3300005336 Bacteria 1717
29 Ga0070680_100237071 3300005336 Bacteria 1541
30 Ga0068868_100000842 3300005338 Bacteria 20767
31 Ga0068868_100096488 3300005338 Bacteria 2388
32 Ga0070660_100051681 3300005339 Bacteria 3166
33 Ga0070689_100016254 3300005340 Bacteria 5443
34 Ga0070661_100068921 3300005344 Bacteria 2600
35 Ga0070661_100146491 3300005344 Bacteria 1783
36 Ga0070668_100086820 3300005347 Bacteria 2460
37 Ga0070668_100280173 3300005347 Unclassified 1392
38 Ga0070669_100001792 3300005353 Bacteria 15431
39 Ga0070669_100074042 3300005353 Unclassified 2524
40 Ga0070669_100086584 3300005353 Bacteria 2341
41 Ga0070675_100001745 3300005354 Bacteria 16047
42 Ga0070675_100266935 3300005354 Unclassified 1501
43 Ga0070671_100008794 3300005355 Bacteria 8099
44 Ga0070671_100363735 3300005355 Unclassified 1235
45 Ga0070674_100000398 3300005356 Bacteria 21822
46 Ga0070674_100005830 3300005356 Bacteria 7158
47 Ga0070673_100053416 3300005364 Bacteria 3173
48 Ga0070673_100114809 3300005364 Bacteria 2238
49 Ga0070688_100046472 3300005365 Bacteria 2688
50 Ga0070659_100150730 3300005366 Unclassified 1897
51 Ga0070667_100005755 3300005367 Bacteria 10355
52 Ga0070667_100016468 3300005367 Bacteria 6117
53 Ga0070713_100015964 3300005436 Bacteria 5635
54 Ga0070713_100121346 3300005436 Bacteria 2293
55 Ga0070713_100361037 3300005436 Bacteria 1350
56 Ga0070701_10002642 3300005438 Bacteria 6949
57 Ga0070711_100246175 3300005439 Bacteria 1400
58 Ga0070700_100025296 3300005441 Bacteria 3496
59 Ga0070708_100070661 3300005445 Bacteria 3141
60 Ga0070678_100002386 3300005456 Bacteria 10277
61 Ga0070678_100023636 3300005456 Bacteria 4100
62 Ga0070678_100026714 3300005456 Bacteria 3908
63 Ga0070678_100045643 3300005456 Bacteria 3136
64 Ga0070681_10020639 3300005458 Bacteria 6601
65 Ga0070681_10049331 3300005458 Unclassified 4205
66 Ga0070681_10356579 3300005458 Bacteria 1373
67 Ga0068867_100012685 3300005459 Bacteria 5961
68 Ga0068867_100027849 3300005459 Unclassified 4065
69 Ga0068867_100091181 3300005459 Unclassified 2313
70 Ga0068867_100093925 3300005459 Bacteria 2280
71 Ga0068867_100096537 3300005459 Bacteria 2251
72 Ga0070685_10016659 3300005466 Bacteria 3920
73 Ga0070685_10037951 3300005466 Bacteria 2730
74 Ga0070707_100024664 3300005468 Bacteria 5698
75 Ga0070707_100193351 3300005468 Bacteria 1984
76 Ga0070707_100260360 3300005468 Bacteria 1687
77 Ga0070698_100007135 3300005471 Bacteria 12101
78 Ga0070698_100097497 3300005471 Bacteria 2916
79 Ga0070699_100024273 3300005518 Bacteria 5224
80 Ga0070684_100046098 3300005535 Bacteria 3777
81 Ga0070684_100107107 3300005535 Bacteria 2503
82 Ga0070697_100021082 3300005536 Bacteria 5161
83 Ga0068853_100095541 3300005539 Unclassified 2621
84 Ga0068853_100147721 3300005539 Unclassified 2114
85 Ga0070672_100046757 3300005543 Bacteria 3354
86 Ga0070672_100088147 3300005543 Bacteria 2498
87 Ga0070686_100013973 3300005544 Bacteria 4613
88 Ga0070686_100036646 3300005544 Bacteria 3039
89 Ga0070686_100073761 3300005544 Bacteria 2241
90 Ga0070665_100027478 3300005548 Bacteria 5731
91 Ga0070665_100030203 3300005548 Bacteria 5454
92 Ga0070704_100103489 3300005549 Bacteria 2151
93 Ga0070704_100133745 3300005549 Bacteria 1926
94 Ga0068855_100017546 3300005563 Bacteria 8607
95 Ga0068855_100033115 3300005563 Bacteria 6169
96 Ga0068855_100077358 3300005563 Bacteria 3861
97 Ga0070664_100001279 3300005564 Bacteria 20137
98 Ga0070664_100047152 3300005564 Bacteria 3640
99 Ga0068857_100016419 3300005577 Bacteria 6487
100 Ga0068857_100164812 3300005577 Bacteria 2012
101 Ga0068857_100221239 3300005577 Unclassified 1729
102 Ga0070702_100038550 3300005615 Bacteria 2662
103 Ga0068852_100041483 3300005616 Bacteria 3890
104 Ga0068859_100041070 3300005617 Bacteria 4646
105 Ga0068864_100012101 3300005618 Bacteria 7128
106 Ga0068866_10005372 3300005718 Bacteria 5285
107 Ga0068866_10134242 3300005718 Unclassified 1412
108 Ga0068861_100015113 3300005719 Bacteria 5432
109 Ga0068861_100208280 3300005719 Bacteria 1646
110 Ga0068851_10037897 3300005834 Bacteria 2418
111 Ga0068870_10000405 3300005840 Bacteria 16239
112 Ga0068870_10006753 3300005840 Bacteria 5083
113 Ga0068863_100002123 3300005841 Bacteria 19662
114 Ga0068863_100003125 3300005841 Bacteria 16343
115 Ga0068863_100031979 3300005841 Bacteria 5018
116 Ga0068863_100038678 3300005841 Bacteria 4538
117 Ga0068858_100017587 3300005842 Bacteria 6704
118 Ga0068858_100044047 3300005842 Bacteria 4137
119 Ga0068858_100104809 3300005842 Bacteria 2639
120 Ga0068858_100444329 3300005842 Bacteria 1249
121 Ga0068860_100002477 3300005843 Bacteria 19367
122 Ga0068860_100015441 3300005843 Bacteria 7459
123 Ga0068860_100034107 3300005843 Unclassified 4881
124 Ga0068860_100055834 3300005843 Bacteria 3754
125 Ga0068860_100321525 3300005843 Bacteria 1519
126 Ga0068862_100004998 3300005844 Bacteria 11159
127 Ga0081539_10000122 3300005985 Bacteria 183393
128 Ga0081539_10000251 3300005985 Bacteria 125220
129 Ga0070717_10177940 3300006028 Bacteria 1853
130 Ga0070717_10272990 3300006028 Bacteria 1498
131 Ga0070712_100108966 3300006175 Bacteria 2063
132 Ga0097621_100007742 3300006237 Bacteria 7701
133 Ga0097621_100023118 3300006237 Bacteria 4835
134 Ga0097621_100067493 3300006237 Bacteria 2948
135 Ga0097621_100074637 3300006237 Unclassified 2809
136 Ga0097621_100105454 3300006237 Bacteria 2377
137 Ga0097621_100116408 3300006237 Unclassified 2264
138 Ga0097621_100195107 3300006237 Bacteria 1755
139 Ga0068871_100004876 3300006358 Bacteria 9372
140 Ga0068871_100009464 3300006358 Bacteria 7062
141 Ga0068871_100010225 3300006358 Bacteria 6835
142 Ga0068871_100030430 3300006358 Unclassified 4251
143 Ga0068871_100046058 3300006358 Bacteria 3512
144 Ga0068871_100064951 3300006358 Unclassified 2988
145 Ga0068871_100072426 3300006358 Unclassified 2838
146 Ga0068871_100078666 3300006358 Bacteria 2727
147 Ga0068871_100168612 3300006358 Unclassified 1875
148 Ga0075428_100003005 3300006844 Bacteria 18413
149 Ga0075428_100039893 3300006844 Bacteria 5167
150 Ga0075428_100054344 3300006844 Bacteria 4389
151 Ga0075428_100099052 3300006844 Unclassified 3178
152 Ga0075428_100152266 3300006844 Bacteria 2512
153 Ga0075428_100211064 3300006844 Bacteria 2098
154 Ga0075430_100014426 3300006846 Bacteria 6731
155 Ga0075431_100002723 3300006847 Bacteria 17145
156 Ga0075431_100037654 3300006847 Unclassified 4981
157 Ga0075431_100059848 3300006847 Unclassified 3930
158 Ga0075431_100098975 3300006847 Bacteria 3010
159 Ga0075431_100219342 3300006847 Bacteria 1940
160 Ga0075433_10000344 3300006852 Bacteria 28940
161 Ga0075433_10003396 3300006852 Bacteria 12299
162 Ga0075433_10009032 3300006852 Bacteria 7961
163 Ga0075433_10015358 3300006852 Bacteria 6278
164 Ga0075434_100001014 3300006871 Bacteria 22835
165 Ga0075434_100001216 3300006871 Bacteria 21379
166 Ga0075434_100006259 3300006871 Bacteria 10902
167 Ga0075434_100023917 3300006871 Bacteria 5963
168 Ga0075434_100033355 3300006871 Bacteria 5081
169 Ga0075434_100070617 3300006871 Bacteria 3483
170 Ga0075429_100017698 3300006880 Bacteria 6163
171 Ga0075429_100068672 3300006880 Unclassified 3085
172 Ga0075429_100087759 3300006880 Unclassified 2711
173 Ga0075429_100103266 3300006880 Bacteria 2489
174 Ga0075429_100125482 3300006880 Unclassified 2244
175 Ga0068865_100007873 3300006881 Bacteria 6577
176 Ga0068865_100041112 3300006881 Unclassified 3145
177 Ga0068865_100044792 3300006881 Bacteria 3030
178 Ga0068865_100046934 3300006881 Bacteria 2966
179 Ga0068865_100053007 3300006881 Bacteria 2814
180 Ga0075436_100000332 3300006914 Bacteria 30123
181 Ga0097620_100041071 3300006931 Bacteria 4646
182 Ga0075435_100001020 3300007076 Bacteria 17737
183 Ga0075435_100033286 3300007076 Bacteria 4074
184 Ga0099795_10001739 3300007788 Bacteria 4864
185 Ga0105240_10012502 3300009093 Bacteria 11714
186 Ga0105240_10012890 3300009093 Bacteria 11512
187 Ga0105240_10036427 3300009093 Bacteria 6329
188 Ga0105240_10059660 3300009093 Bacteria 4760
189 Ga0105240_10155739 3300009093 Bacteria 2718
190 Ga0111539_10006253 3300009094 Bacteria 15369
191 Ga0111539_10037283 3300009094 Bacteria 5872
192 Ga0111539_10062616 3300009094 Bacteria 4403
193 Ga0111539_10117956 3300009094 Bacteria 3110
194 Ga0111539_10184952 3300009094 Bacteria 2433
195 Ga0111539_10465295 3300009094 Bacteria 1472
196 Ga0105245_10000949 3300009098 Bacteria 26362
197 Ga0105245_10003870 3300009098 Bacteria 13319
198 Ga0105245_10011597 3300009098 Bacteria 7677
199 Ga0105245_10041457 3300009098 Bacteria 4104
200 Ga0105247_10001768 3300009101 Bacteria 15203
201 Ga0105247_10003584 3300009101 Bacteria 10075
202 Ga0114129_10001421 3300009147 Bacteria 32301
203 Ga0114129_10033916 3300009147 Bacteria 7210
204 Ga0114129_10054712 3300009147 Bacteria 5594
205 Ga0114129_10072566 3300009147 Bacteria 4798
206 Ga0114129_10086191 3300009147 Bacteria 4356
207 Ga0114129_10162233 3300009147 Bacteria 3052
208 Ga0114129_10176413 3300009147 Unclassified 2911
209 Ga0114129_10237269 3300009147 Unclassified 2453
210 Ga0105243_10049572 3300009148 Unclassified 3313
211 Ga0105241_10052595 3300009174 Unclassified 3110
212 Ga0105242_10002675 3300009176 Bacteria 13960
213 Ga0105242_10006994 3300009176 Bacteria 8711
214 Ga0105242_10013202 3300009176 Bacteria 6375
215 Ga0105242_10015151 3300009176 Bacteria 5986
216 Ga0105242_10038149 3300009176 Bacteria 3862
217 Ga0105242_10067825 3300009176 Bacteria 2950
218 Ga0105242_10112055 3300009176 Unclassified 2327
219 Ga0105242_10419414 3300009176 Bacteria 1254
220 Ga0105248_10006158 3300009177 Bacteria 13152
221 Ga0105248_10011934 3300009177 Bacteria 9583
222 Ga0105248_10030414 3300009177 Bacteria 6029
223 Ga0105248_10059443 3300009177 Bacteria 4294
224 Ga0105248_10064279 3300009177 Bacteria 4120
225 Ga0105248_10349393 3300009177 Bacteria 1665
226 Ga0105248_10361518 3300009177 Bacteria 1634
227 Ga0105237_10012329 3300009545 Bacteria 9006
228 Ga0105237_10125593 3300009545 Bacteria 2560
229 Ga0105238_10016996 3300009551 Bacteria 7385
230 Ga0105238_10017473 3300009551 Bacteria 7291
231 Ga0105238_10017757 3300009551 Bacteria 7233
232 Ga0105238_10035851 3300009551 Bacteria 5042
233 Ga0105238_10040969 3300009551 Unclassified 4692
234 Ga0105238_10115118 3300009551 Unclassified 2668
235 Ga0105249_10001171 3300009553 Bacteria 23227
236 Ga0105239_10015991 3300010375 Bacteria 8304
237 Ga0105239_10124943 3300010375 Bacteria 2859
238 Ga0105239_10459369 3300010375 Bacteria 1445
239 Ga0105246_10004092 3300011119 Bacteria 8852
240 Ga0105246_10122378 3300011119 Unclassified 1930
241 Ga0105246_10150372 3300011119 Bacteria 1762
242 Ga0157370_10006049 3300013104 Bacteria 13440
243 Ga0157369_10039397 3300013105 Bacteria 5164
244 Ga0157374_10007751 3300013296 Bacteria 9166
245 Ga0157374_10025252 3300013296 Bacteria 5331
246 Ga0157374_10096834 3300013296 Bacteria 2822
247 Ga0157378_10002085 3300013297 Bacteria 17882
248 Ga0157378_10004684 3300013297 Bacteria 12001
249 Ga0157378_10387108 3300013297 Unclassified 1374
250 Ga0163162_10005026 3300013306 Bacteria 12741
251 Ga0163162_10183980 3300013306 Bacteria 2216
252 Ga0157372_10269187 3300013307 Unclassified 1979
253 Ga0157375_10004978 3300013308 Bacteria 11553
254 Ga0157375_10014616 3300013308 Bacteria 7010
255 Ga0157375_10090385 3300013308 Bacteria 3120
256 Ga0157375_10130508 3300013308 Unclassified 2632
257 Ga0157375_10133540 3300013308 Bacteria 2603
258 Ga0157375_10232420 3300013308 Unclassified 2003
259 Ga0157375_10298145 3300013308 Bacteria 1776
260 Ga0163163_10005882 3300014325 Bacteria 10669
261 Ga0163163_10012356 3300014325 Bacteria 7780
262 Ga0163163_10017914 3300014325 Bacteria 6615
263 Ga0163163_10036988 3300014325 Bacteria 4746
264 Ga0163163_10072213 3300014325 Bacteria 3440
265 Ga0163163_10218158 3300014325 Bacteria 1956
266 Ga0163163_10522346 3300014325 Unclassified 1249
267 Ga0157380_10009800 3300014326 Bacteria 6878
268 Ga0157380_10052158 3300014326 Unclassified 3237
269 Ga0157380_10061105 3300014326 Bacteria 3014
270 Ga0157380_10067443 3300014326 Unclassified 2881
271 Ga0157380_10082440 3300014326 Unclassified 2632
272 Ga0157380_10128582 3300014326 Bacteria 2158
273 Ga0157380_10131661 3300014326 Unclassified 2135
274 Ga0157380_10138289 3300014326 Bacteria 2088
275 Ga0157380_10220582 3300014326 Bacteria 1696
276 Ga0157379_10023147 3300014968 Bacteria 5509
277 Ga0157379_10049144 3300014968 Bacteria 3766
278 Ga0157379_10084269 3300014968 Bacteria 2849
279 Ga0157379_10139432 3300014968 Bacteria 2186
280 Ga0157376_10003275 3300014969 Bacteria 11142
281 Ga0157376_10017821 3300014969 Bacteria 5427
282 Ga0157376_10177969 3300014969 Unclassified 1942
283 Ga0157376_10392637 3300014969 Bacteria 1339
284 Ga0163161_10019557 3300017792 Bacteria 4752
285 Ga0163161_10154873 3300017792 Bacteria 1744
286 Ga0207697_10002120 3300025315 Bacteria 10408
287 Ga0207697_10047647 3300025315 Unclassified 1767
288 Ga0207682_10002489 3300025893 Bacteria 8235
289 Ga0207682_10028556 3300025893 Unclassified 2227
290 Ga0207682_10032330 3300025893 Bacteria 2103
291 Ga0207642_10013916 3300025899 Unclassified 2952
292 Ga0207710_10004263 3300025900 Bacteria 6261
293 Ga0207688_10004088 3300025901 Bacteria 7951
294 Ga0207688_10024925 3300025901 Bacteria 3282
295 Ga0207680_10013271 3300025903 Bacteria 4227
296 Ga0207680_10135279 3300025903 Bacteria 1628
297 Ga0207645_10004479 3300025907 Bacteria 10335
298 Ga0207645_10036178 3300025907 Bacteria 3170
299 Ga0207645_10060891 3300025907 Unclassified 2411
300 Ga0207643_10000334 3300025908 Bacteria 32146
301 Ga0207643_10012867 3300025908 Bacteria 4523
302 Ga0207654_10006617 3300025911 Bacteria 5829
303 Ga0207707_10039965 3300025912 Unclassified 4098
304 Ga0207695_10052545 3300025913 Bacteria 4268
305 Ga0207671_10040602 3300025914 Unclassified 3444
306 Ga0207671_10043249 3300025914 Bacteria 3331
307 Ga0207663_10158340 3300025916 Bacteria 1596
308 Ga0207660_10087352 3300025917 Bacteria 2304
309 Ga0207662_10065340 3300025918 Bacteria 2191
310 Ga0207646_10010308 3300025922 Bacteria 9141
311 Ga0207646_10012641 3300025922 Bacteria 8103
312 Ga0207646_10142907 3300025922 Bacteria 2156
313 Ga0207681_10008307 3300025923 Bacteria 6348
314 Ga0207681_10012668 3300025923 Bacteria 5207
315 Ga0207694_10010415 3300025924 Bacteria 7010
316 Ga0207694_10011149 3300025924 Bacteria 6786
317 Ga0207694_10025105 3300025924 Bacteria 4528
318 Ga0207650_10013258 3300025925 Bacteria 5703
319 Ga0207650_10038298 3300025925 Unclassified 3501
320 Ga0207650_10069067 3300025925 Bacteria 2654
321 Ga0207659_10001986 3300025926 Bacteria 12099
322 Ga0207659_10013259 3300025926 Bacteria 5272
323 Ga0207659_10104872 3300025926 Bacteria 2138
324 Ga0207687_10005369 3300025927 Bacteria 8477
325 Ga0207687_10006186 3300025927 Bacteria 7923
326 Ga0207687_10006305 3300025927 Bacteria 7841
327 Ga0207687_10007984 3300025927 Bacteria 6927
328 Ga0207687_10018057 3300025927 Bacteria 4653
329 Ga0207700_10132303 3300025928 Bacteria 2038
330 Ga0207644_10003331 3300025931 Bacteria 10366
331 Ga0207644_10020218 3300025931 Unclassified 4524
332 Ga0207644_10057573 3300025931 Bacteria 2807
333 Ga0207706_10008337 3300025933 Bacteria 9557
334 Ga0207706_10055242 3300025933 Bacteria 3503
335 Ga0207706_10095442 3300025933 Bacteria 2616
336 Ga0207686_10007949 3300025934 Bacteria 5718
337 Ga0207686_10012521 3300025934 Bacteria 4665
338 Ga0207686_10043792 3300025934 Bacteria 2745
339 Ga0207686_10080384 3300025934 Unclassified 2125
340 Ga0207709_10061329 3300025935 Unclassified 2350
341 Ga0207669_10007534 3300025937 Bacteria 5042
342 Ga0207669_10020672 3300025937 Unclassified 3458
343 Ga0207704_10013941 3300025938 Unclassified 4044
344 Ga0207704_10026861 3300025938 Bacteria 3164
345 Ga0207704_10053014 3300025938 Bacteria 2462
346 Ga0207704_10060521 3300025938 Bacteria 2343
347 Ga0207691_10003520 3300025940 Bacteria 15234
348 Ga0207691_10005378 3300025940 Bacteria 12362
349 Ga0207711_10012772 3300025941 Bacteria 6977
350 Ga0207711_10030507 3300025941 Unclassified 4547
351 Ga0207711_10059488 3300025941 Unclassified 3290
352 Ga0207711_10090866 3300025941 Bacteria 2685
353 Ga0207711_10140675 3300025941 Unclassified 2171
354 Ga0207689_10000493 3300025942 Bacteria 37382
355 Ga0207689_10122703 3300025942 Unclassified 2137
356 Ga0207689_10128222 3300025942 Bacteria 2087
357 Ga0207689_10343979 3300025942 Unclassified 1239
358 Ga0207661_10062217 3300025944 Unclassified 3019
359 Ga0207661_10085861 3300025944 Bacteria 2610
360 Ga0207661_10129075 3300025944 Bacteria 2163
361 Ga0207661_10180715 3300025944 Unclassified 1843
362 Ga0207679_10015609 3300025945 Bacteria 5025
363 Ga0207679_10021772 3300025945 Unclassified 4353
364 Ga0207679_10021914 3300025945 Unclassified 4341
365 Ga0207667_10036533 3300025949 Bacteria 5264
366 Ga0207667_10059638 3300025949 Bacteria 3996
367 Ga0207667_10093712 3300025949 Bacteria 3101
368 Ga0207651_10007281 3300025960 Bacteria 5881
369 Ga0207651_10034620 3300025960 Bacteria 3273
370 Ga0207712_10315098 3300025961 Unclassified 1289
371 Ga0207668_10095336 3300025972 Bacteria 2196
372 Ga0207668_10156734 3300025972 Unclassified 1770
373 Ga0207668_10245591 3300025972 Bacteria 1451
374 Ga0207658_10007366 3300025986 Bacteria 7502
375 Ga0207658_10015051 3300025986 Bacteria 5305
376 Ga0207658_10260205 3300025986 Bacteria 1478
377 Ga0207677_10037035 3300026023 Bacteria 3185
378 Ga0207677_10085405 3300026023 Unclassified 2278
379 Ga0207703_10007631 3300026035 Bacteria 8576
380 Ga0207703_10048190 3300026035 Bacteria 3438
381 Ga0207703_10081424 3300026035 Bacteria 2699
382 Ga0207703_10166113 3300026035 Bacteria 1937
383 Ga0207703_10396584 3300026035 Bacteria 1279
384 Ga0207639_10088000 3300026041 Unclassified 2477
385 Ga0207708_10009265 3300026075 Bacteria 7287
386 Ga0207708_10010000 3300026075 Bacteria 7044
387 Ga0207708_10020137 3300026075 Bacteria 5031
388 Ga0207708_10071649 3300026075 Bacteria 2655
389 Ga0207702_10021149 3300026078 Bacteria 5385
390 Ga0207641_10000354 3300026088 Bacteria 54823
391 Ga0207641_10021575 3300026088 Bacteria 5291
392 Ga0207641_10036109 3300026088 Bacteria 4124
393 Ga0207641_10157450 3300026088 Bacteria 2062
394 Ga0207648_10034111 3300026089 Bacteria 4488
395 Ga0207648_10039536 3300026089 Unclassified 4147
396 Ga0207648_10040971 3300026089 Unclassified 4068
397 Ga0207648_10043766 3300026089 Bacteria 3930
398 Ga0207648_10077087 3300026089 Unclassified 2905
399 Ga0207648_10097425 3300026089 Bacteria 2574
400 Ga0207676_10050795 3300026095 Bacteria 3235
401 Ga0207674_10007013 3300026116 Bacteria 13170
402 Ga0207674_10090284 3300026116 Bacteria 3055
403 Ga0207674_10249983 3300026116 Unclassified 1720
404 Ga0207675_100030159 3300026118 Bacteria 5050
405 Ga0207675_100200397 3300026118 Bacteria 1917
406 Ga0207683_10013363 3300026121 Bacteria 7001
407 Ga0207683_10021339 3300026121 Bacteria 5543
408 Ga0207683_10030348 3300026121 Unclassified 4684
409 Ga0207683_10035683 3300026121 Bacteria 4325
410 Ga0207683_10064819 3300026121 Bacteria 3220
411 Ga0207683_10286271 3300026121 Bacteria 1506
412 Ga0207698_10149796 3300026142 Bacteria 2023
413 Ga0207428_10001725 3300027907 Bacteria 22383
414 Ga0207428_10011189 3300027907 Bacteria 7959
415 Ga0268266_10007877 3300028379 Bacteria 9544
416 Ga0268266_10047256 3300028379 Bacteria 3687
417 Ga0268266_10411794 3300028379 Bacteria 1280
418 Ga0268264_10016473 3300028381 Bacteria 6052
419 Ga0268264_10088351 3300028381 Unclassified 2667
420 Ga0265319_1004213 3300028563 Bacteria 7190
421 Ga0265319_1021161 3300028563 Bacteria 2393
422 Ga0265334_10000661 3300028573 Bacteria 17356
423 Ga0265318_10000092 3300028577 Bacteria 82224
424 Ga0265318_10003204 3300028577 Bacteria 8347
425 Ga0265338_10047919 3300028800 Bacteria 3895
426 Ga0265338_10048600 3300028800 Bacteria 3857
427 Ga0265338_10133443 3300028800 Bacteria 1956
428 Ga0265330_10009017 3300031235 Bacteria 4759
429 Ga0265332_10003594 3300031238 Bacteria 7440
430 Ga0265332_10017823 3300031238 Bacteria 3132
431 Ga0265328_10007878 3300031239 Bacteria 4425
432 Ga0265320_10000067 3300031240 Bacteria 93425
433 Ga0265320_10021398 3300031240 Bacteria 3479
434 Ga0265325_10002550 3300031241 Bacteria 12255
435 Ga0265325_10003217 3300031241 Bacteria 10748
436 Ga0265325_10003500 3300031241 Bacteria 10220
437 Ga0265325_10006993 3300031241 Bacteria 6798
438 Ga0265325_10030612 3300031241 Bacteria 2886
439 Ga0265325_10038198 3300031241 Unclassified 2535
440 Ga0265329_10004815 3300031242 Bacteria 5545
441 Ga0265329_10026828 3300031242 Bacteria 1895
442 Ga0265329_10052058 3300031242 Bacteria 1303
443 Ga0265340_10002040 3300031247 Bacteria 11570
444 Ga0265340_10023711 3300031247 Bacteria 3127
445 Ga0265339_10001665 3300031249 Bacteria 16410
446 Ga0265331_10000047 3300031250 Bacteria 183230
447 Ga0265331_10002371 3300031250 Bacteria 12795
448 Ga0265331_10013012 3300031250 Bacteria 4484
449 Ga0265331_10023848 3300031250 Bacteria 3101
450 Ga0265331_10031064 3300031250 Bacteria 2656
451 Ga0265316_10003774 3300031344 Bacteria 15233
452 Ga0265316_10006215 3300031344 Bacteria 11451
453 Ga0265316_10031902 3300031344 Bacteria 4305
454 Ga0265316_10087835 3300031344 Unclassified 2375
455 Ga0265313_10003424 3300031595 Bacteria 12840
456 Ga0265313_10003949 3300031595 Bacteria 11667
457 Ga0265313_10015422 3300031595 Bacteria 4449
458 Ga0265313_10047680 3300031595 Unclassified 2072
459 Ga0265313_10059999 3300031595 Unclassified 1786
460 Ga0265314_10008345 3300031711 Bacteria 8879
461 Ga0265314_10020827 3300031711 Bacteria 5057
462 Ga0265314_10024659 3300031711 Bacteria 4555
463 Ga0265342_10000247 3300031712 Bacteria 60566
464 Ga0307416_100330817 3300032002 Unclassified 1531
465 Ga0373930_0009231 3300034816 Bacteria 1742
466 Ga0373938_0003539 3300034957 Bacteria 2566
467 Ga0373926_0036629 3300035083 Bacteria 1744
468 Ga0373934_0006294 3300035086 Unclassified 4400
469 Ga0373940_0005290 3300035088 Unclassified 2786
470 Ga0373944_0029964 3300035089 Bacteria 1630
471 Ga0373949_0000466 3300035090 Bacteria 13893
472 Ga0373951_0000525 3300035091 Bacteria 10791
473 Ga0373952_0000577 3300035092 Bacteria 6467
474 Ga0373932_0000438 3300035112 Bacteria 12733
475 Ga0373939_0001137 3300035114 Bacteria 6557
476 Ga0373945_0022227 3300035116 Bacteria 2183
477 Ga0373954_0011553 3300035118 Unclassified 3915
478 Ga0373954_0014938 3300035118 Bacteria 3465
479 Ga0373957_0019652 3300035120 Bacteria 2380
480 Ga0373957_0046377 3300035120 Unclassified 1649
481 Ga0373960_0000336 3300035121 Bacteria 8991
482 Ga0373943_0025656 3300035170 Bacteria 2756
483 Ga0373943_0068261 3300035170 Unclassified 1795
484 Ga0373946_0093239 3300035171 Unclassified 1338
485 Ga0373955_0013720 3300035172 Bacteria 3926
486 Ga0373955_0023939 3300035172 Unclassified 3116
487 Ga0373955_0156178 3300035172 Bacteria 1344
488 Ga0373962_0000489 3300035242 Bacteria 8790
489 Ga0373931_0000500 3300035691 Bacteria 15976
490 Ga0373935_0012867 3300035692 Bacteria 5040
491 Ga0373935_0047994 3300035692 Bacteria 2702
492 Ga0373927_0010045 3300035695 Bacteria 6339
493 Ga0373933_0024803 3300035724 Bacteria 3435
494 Ga0373933_0064637 3300035724 Bacteria 2214
495 Ga0373947_0018825 3300035725 Bacteria 3978
496 Ga0373947_0068366 3300035725 Bacteria 2172
497 Ga0373947_0091396 3300035725 Bacteria 1899
498 Ga0373937_0001230 3300036401 Bacteria 21524
499 Ga0373937_0005807 3300036401 Bacteria 10610
500 Ga0373937_0007909 3300036401 Bacteria 9214
501 Ga0373937_0033415 3300036401 Bacteria 4671
502 Ga0373937_0056879 3300036401 Bacteria 3592
503 Ga0373925_0001427 3300037068 Bacteria 20691
504 Ga0373925_0032763 3300037068 Bacteria 3826
505 Ga0373925_0061004 3300037068 Bacteria 2832
506 Ga0373925_0110264 3300037068 Bacteria 2125
507 Ga0436364_1219174 3300037853 Bacteria 1467
508 Ga0436365_0374751 3300039437 Bacteria 1717
509 Ga0439453_0003367 3300041408 Bacteria 2296
510 Ga0439446_0042974 3300042156 Bacteria 1335
511 Ga0439435_0033613 3300042436 Bacteria 1405
512 Ga0451576_0470379 3300045051 Bacteria 1320
513 Ga0495592_0069364 3300046454 Unclassified 2570
514 Ga0495582_0094731 3300046473 Unclassified 1667
515 Ga0495594_0022496 3300046499 Bacteria 3372
516 Ga0495608_0025375 3300046511 Unclassified 4046
517 Ga0495618_0006810 3300046514 Bacteria 6924
518 Ga0495628_0130236 3300046516 Bacteria 1925
519 Ga0495630_0162923 3300046517 Bacteria 1698
520 Ga0495640_0029357 3300046533 Bacteria 3949
521 Ga0495640_0115951 3300046533 Bacteria 1745
522 Ga0495667_0000257 3300046559 Bacteria 34351
523 Ga0495667_0048402 3300046559 Unclassified 2807
524 Ga0495634_0041532 3300046642 Bacteria 3123
525 Ga0495634_0113840 3300046642 Bacteria 1737
526 Ga0495657_0002406 3300046675 Bacteria 15749
527 Ga0495658_0008029 3300046683 Bacteria 5225
528 Ga0495669_0003334 3300046684 Bacteria 6611
529 Ga0495669_0048010 3300046684 Bacteria 1909
530 Ga0495613_0050463 3300046689 Bacteria 3068
531 Ga0495636_0006986 3300047318 Bacteria 4442
532 Ga0495674_0015622 3300047319 Bacteria 7089
533 Ga0495674_0031715 3300047319 Bacteria 4798
534 Ga0495674_0057766 3300047319 Bacteria 3395
535 Ga0495674_0278134 3300047319 Bacteria 1372
536 Ga0495675_0066757 3300047444 Unclassified 2274
537 Ga0495684_0034602 3300047471 Bacteria 3876
538 Ga0495684_0214706 3300047471 Bacteria 1413
539 Ga0496100_0022991 3300048903 Bacteria 3780
540 Ga0496101_0014228 3300048904 Bacteria 5345
541 Ga0496101_0194622 3300048904 Bacteria 1566
542 Ga0496104_0055078 3300048907 Bacteria 3760
543 Ga0496104_0221162 3300048907 Bacteria 1806
544 Ga0496109_0589599 3300048912 Unclassified 1047
545 Ga0496111_0064626 3300048914 Bacteria 2655
546 Ga0496112_0041197 3300048915 Unclassified 4517
547 Ga0496112_0092493 3300048915 Unclassified 2994
548 Ga0496113_0037794 3300048916 Bacteria 3546
549 Ga0501071_0010122 3300049587 Bacteria 6308
550 Ga0501076_0093277 3300049592 Bacteria 2423
551 Ga0501079_0010902 3300049741 Bacteria 6923
552 nmdc:mga05p37_121208_c1 3300050507 Unclassified 3213
553 nmdc:mga05p37_122866_c1 3300050507 Unclassified 3189
554 nmdc:mga05p37_131386_c1 3300050507 Bacteria 3072
555 nmdc:mga05p37_157462_c1 3300050507 Bacteria 2775
556 nmdc:mga05p37_424936_c1 3300050507 Bacteria 1545
557 nmdc:mga05p37_63384_c1 3300050507 Bacteria 4548
558 nmdc:mga05p37_6809_c1 3300050507 Bacteria 13470
559 nmdc:mga05p37_7994_c1 3300050507 Bacteria 12485
560 nmdc:mga09592_109495_c1 3300050508 Bacteria 2369
561 nmdc:mga09592_14204_c1 3300050508 Bacteria 6498
562 nmdc:mga09592_20834_c1 3300050508 Bacteria 5397
563 nmdc:mga09592_28777_c1 3300050508 Bacteria 4618
564 nmdc:mga09592_40128_c1 3300050508 Bacteria 3932
565 nmdc:mga0qj67_19467_c1 3300050509 Bacteria 5186
566 nmdc:mga0qj67_8872_c1 3300050509 Bacteria 7461
567 nmdc:mga06r32_10022_c1 3300050510 Bacteria 8551
568 nmdc:mga06r32_114860_c1 3300050510 Bacteria 2651
569 nmdc:mga06r32_33836_c1 3300050510 Bacteria 4815
570 nmdc:mga06r32_5018_c1 3300050510 Bacteria 11916
571 nmdc:mga06r32_65979_c1 3300050510 Unclassified 3492
572 nmdc:mga06r32_89752_c1 3300050510 Bacteria 3001
573 nmdc:mga08y16_102592_c1 3300050511 Bacteria 2978
574 nmdc:mga08y16_15443_c1 3300050511 Bacteria 8031
575 nmdc:mga08y16_39736_c1 3300050511 Bacteria 4935
576 nmdc:mga08y16_5537_c1 3300050511 Bacteria 13219
577 nmdc:mga0n895_13958_c1 3300050512 Bacteria 7275
578 nmdc:mga0n895_4337_c1 3300050512 Bacteria 11625
579 nmdc:mga0n895_758_c1 3300050512 Bacteria 22873
580 nmdc:mga0n895_92960_c1 3300050512 Bacteria 3020
581 nmdc:mga0n895_9778_c1 3300050512 Bacteria 8419
582 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
583 nmdc:mga08x19_429_c1 3300050514 Bacteria 28767
584 nmdc:mga0a205_1202_c1 3300050515 Bacteria 21664
585 nmdc:mga0a205_1225_c1 3300050515 Bacteria 21505
586 nmdc:mga0a205_15529_c1 3300050515 Bacteria 7116
587 nmdc:mga0a205_18886_c1 3300050515 Bacteria 5003
588 Ga0495619_0089764 3300053085 Bacteria 2080
589 Ga0500641_0000637 3300053096 Bacteria 12673
590 Ga0501082_0317554 3300060353 Bacteria 1357
591 Ga0065712_10089610
592 JGI24746J21847_1002927
593 JGI24751J29686_10003066
594 JGI25406J46586_10000430
595 JGI25406J46586_10009242
596 Ga0065712_10004931
597 Ga0065707_10090576
598 Ga0070676_10013100
599 Ga0070676_10097480
600 Ga0070683_100004982
601 Ga0070683_100093197
602 Ga0070683_100094551
603 Ga0070683_100109059
604 Ga0070690_100014571
605 Ga0070690_100077128
606 Ga0070670_100015239
607 Ga0070670_100074553
608 Ga0070670_100144453
609 Ga0070670_100158354
610 Ga0070670_100346139
611 Ga0070677_10027815
612 Ga0070677_10073110
613 Ga0068869_100004937
614 Ga0068869_100110555
615 Ga0068869_100172614
616 Ga0068869_100392719
617 Ga0070666_10007266
618 Ga0070680_100192840
619 Ga0070680_100237071
620 Ga0068868_100000842
621 Ga0068868_100096488
622 Ga0070660_100051681
623 Ga0070689_100016254
624 Ga0070661_100068921
625 Ga0070661_100146491
626 Ga0070668_100086820
627 Ga0070668_100280173
628 Ga0070669_100001792
629 Ga0070669_100074042
630 Ga0070669_100086584
631 Ga0070675_100001745
632 Ga0070675_100266935
633 Ga0070671_100008794
634 Ga0070671_100363735
635 Ga0070674_100000398
636 Ga0070674_100005830
637 Ga0070673_100053416
638 Ga0070673_100114809
639 Ga0070688_100046472
640 Ga0070659_100150730
641 Ga0070667_100005755
642 Ga0070667_100016468
643 Ga0070713_100015964
644 Ga0070713_100121346
645 Ga0070713_100361037
646 Ga0070701_10002642
647 Ga0070711_100246175
648 Ga0070700_100025296
649 Ga0070708_100070661
650 Ga0070678_100002386
651 Ga0070678_100023636
652 Ga0070678_100026714
653 Ga0070678_100045643
654 Ga0070681_10020639
655 Ga0070681_10049331
656 Ga0070681_10356579
657 Ga0068867_100012685
658 Ga0068867_100027849
659 Ga0068867_100091181
660 Ga0068867_100093925
661 Ga0068867_100096537
662 Ga0070685_10016659
663 Ga0070685_10037951
664 Ga0070707_100024664
665 Ga0070707_100193351
666 Ga0070707_100260360
667 Ga0070698_100007135
668 Ga0070698_100097497
669 Ga0070699_100024273
670 Ga0070684_100046098
671 Ga0070684_100107107
672 Ga0070697_100021082
673 Ga0068853_100095541
674 Ga0068853_100147721
675 Ga0070672_100046757
676 Ga0070672_100088147
677 Ga0070686_100013973
678 Ga0070686_100036646
679 Ga0070686_100073761
680 Ga0070665_100027478
681 Ga0070665_100030203
682 Ga0070704_100103489
683 Ga0070704_100133745
684 Ga0068855_100017546
685 Ga0068855_100033115
686 Ga0068855_100077358
687 Ga0070664_100001279
688 Ga0070664_100047152
689 Ga0068857_100016419
690 Ga0068857_100164812
691 Ga0068857_100221239
692 Ga0070702_100038550
693 Ga0068852_100041483
694 Ga0068859_100041070
695 Ga0068864_100012101
696 Ga0068866_10005372
697 Ga0068866_10134242
698 Ga0068861_100015113
699 Ga0068861_100208280
700 Ga0068851_10037897
701 Ga0068870_10000405
702 Ga0068870_10006753
703 Ga0068863_100002123
704 Ga0068863_100003125
705 Ga0068863_100031979
706 Ga0068863_100038678
707 Ga0068858_100017587
708 Ga0068858_100044047
709 Ga0068858_100104809
710 Ga0068858_100444329
711 Ga0068860_100002477
712 Ga0068860_100015441
713 Ga0068860_100034107
714 Ga0068860_100055834
715 Ga0068860_100321525
716 Ga0068862_100004998
717 Ga0081539_10000122
718 Ga0081539_10000251
719 Ga0070717_10177940
720 Ga0070717_10272990
721 Ga0070712_100108966
722 Ga0097621_100007742
723 Ga0097621_100023118
724 Ga0097621_100067493
725 Ga0097621_100074637
726 Ga0097621_100105454
727 Ga0097621_100116408
728 Ga0097621_100195107
729 Ga0068871_100004876
730 Ga0068871_100009464
731 Ga0068871_100010225
732 Ga0068871_100030430
733 Ga0068871_100046058
734 Ga0068871_100064951
735 Ga0068871_100072426
736 Ga0068871_100078666
737 Ga0068871_100168612
738 Ga0075428_100003005
739 Ga0075428_100039893
740 Ga0075428_100054344
741 Ga0075428_100099052
742 Ga0075428_100152266
743 Ga0075428_100211064
744 Ga0075430_100014426
745 Ga0075431_100002723
746 Ga0075431_100037654
747 Ga0075431_100059848
748 Ga0075431_100098975
749 Ga0075431_100219342
750 Ga0075433_10000344
751 Ga0075433_10003396
752 Ga0075433_10009032
753 Ga0075433_10015358
754 Ga0075434_100001014
755 Ga0075434_100001216
756 Ga0075434_100006259
757 Ga0075434_100023917
758 Ga0075434_100033355
759 Ga0075434_100070617
760 Ga0075429_100017698
761 Ga0075429_100068672
762 Ga0075429_100087759
763 Ga0075429_100103266
764 Ga0075429_100125482
765 Ga0068865_100007873
766 Ga0068865_100041112
767 Ga0068865_100044792
768 Ga0068865_100046934
769 Ga0068865_100053007
770 Ga0075436_100000332
771 Ga0097620_100041071
772 Ga0075435_100001020
773 Ga0075435_100033286
774 Ga0099795_10001739
775 Ga0105240_10012502
776 Ga0105240_10012890
777 Ga0105240_10036427
778 Ga0105240_10059660
779 Ga0105240_10155739
780 Ga0111539_10006253
781 Ga0111539_10037283
782 Ga0111539_10062616
783 Ga0111539_10117956
784 Ga0111539_10184952
785 Ga0111539_10465295
786 Ga0105245_10000949
787 Ga0105245_10003870
788 Ga0105245_10011597
789 Ga0105245_10041457
790 Ga0105247_10001768
791 Ga0105247_10003584
792 Ga0114129_10001421
793 Ga0114129_10033916
794 Ga0114129_10054712
795 Ga0114129_10072566
796 Ga0114129_10086191
797 Ga0114129_10162233
798 Ga0114129_10176413
799 Ga0114129_10237269
800 Ga0105243_10049572
801 Ga0105241_10052595
802 Ga0105242_10002675
803 Ga0105242_10006994
804 Ga0105242_10013202
805 Ga0105242_10015151
806 Ga0105242_10038149
807 Ga0105242_10067825
808 Ga0105242_10112055
809 Ga0105242_10419414
810 Ga0105248_10006158
811 Ga0105248_10011934
812 Ga0105248_10030414
813 Ga0105248_10059443
814 Ga0105248_10064279
815 Ga0105248_10349393
816 Ga0105248_10361518
817 Ga0105237_10012329
818 Ga0105237_10125593
819 Ga0105238_10016996
820 Ga0105238_10017473
821 Ga0105238_10017757
822 Ga0105238_10035851
823 Ga0105238_10040969
824 Ga0105238_10115118
825 Ga0105249_10001171
826 Ga0105239_10015991
827 Ga0105239_10124943
828 Ga0105239_10459369
829 Ga0105246_10004092
830 Ga0105246_10122378
831 Ga0105246_10150372
832 Ga0157370_10006049
833 Ga0157369_10039397
834 Ga0157374_10007751
835 Ga0157374_10025252
836 Ga0157374_10096834
837 Ga0157378_10002085
838 Ga0157378_10004684
839 Ga0157378_10387108
840 Ga0163162_10005026
841 Ga0163162_10183980
842 Ga0157372_10269187
843 Ga0157375_10004978
844 Ga0157375_10014616
845 Ga0157375_10090385
846 Ga0157375_10130508
847 Ga0157375_10133540
848 Ga0157375_10232420
849 Ga0157375_10298145
850 Ga0163163_10005882
851 Ga0163163_10012356
852 Ga0163163_10017914
853 Ga0163163_10036988
854 Ga0163163_10072213
855 Ga0163163_10218158
856 Ga0163163_10522346
857 Ga0157380_10009800
858 Ga0157380_10052158
859 Ga0157380_10061105
860 Ga0157380_10067443
861 Ga0157380_10082440
862 Ga0157380_10128582
863 Ga0157380_10131661
864 Ga0157380_10138289
865 Ga0157380_10220582
866 Ga0157379_10023147
867 Ga0157379_10049144
868 Ga0157379_10084269
869 Ga0157379_10139432
870 Ga0157376_10003275
871 Ga0157376_10017821
872 Ga0157376_10177969
873 Ga0157376_10392637
874 Ga0163161_10019557
875 Ga0163161_10154873
876 Ga0207697_10002120
877 Ga0207697_10047647
878 Ga0207682_10002489
879 Ga0207682_10028556
880 Ga0207682_10032330
881 Ga0207642_10013916
882 Ga0207710_10004263
883 Ga0207688_10004088
884 Ga0207688_10024925
885 Ga0207680_10013271
886 Ga0207680_10135279
887 Ga0207645_10004479
888 Ga0207645_10036178
889 Ga0207645_10060891
890 Ga0207643_10000334
891 Ga0207643_10012867
892 Ga0207654_10006617
893 Ga0207707_10039965
894 Ga0207695_10052545
895 Ga0207671_10040602
896 Ga0207671_10043249
897 Ga0207663_10158340
898 Ga0207660_10087352
899 Ga0207662_10065340
900 Ga0207646_10010308
901 Ga0207646_10012641
902 Ga0207646_10142907
903 Ga0207681_10008307
904 Ga0207681_10012668
905 Ga0207694_10010415
906 Ga0207694_10011149
907 Ga0207694_10025105
908 Ga0207650_10013258
909 Ga0207650_10038298
910 Ga0207650_10069067
911 Ga0207659_10001986
912 Ga0207659_10013259
913 Ga0207659_10104872
914 Ga0207687_10005369
915 Ga0207687_10006186
916 Ga0207687_10006305
917 Ga0207687_10007984
918 Ga0207687_10018057
919 Ga0207700_10132303
920 Ga0207644_10003331
921 Ga0207644_10020218
922 Ga0207644_10057573
923 Ga0207706_10008337
924 Ga0207706_10055242
925 Ga0207706_10095442
926 Ga0207686_10007949
927 Ga0207686_10012521
928 Ga0207686_10043792
929 Ga0207686_10080384
930 Ga0207709_10061329
931 Ga0207669_10007534
932 Ga0207669_10020672
933 Ga0207704_10013941
934 Ga0207704_10026861
935 Ga0207704_10053014
936 Ga0207704_10060521
937 Ga0207691_10003520
938 Ga0207691_10005378
939 Ga0207711_10012772
940 Ga0207711_10030507
941 Ga0207711_10059488
942 Ga0207711_10090866
943 Ga0207711_10140675
944 Ga0207689_10000493
945 Ga0207689_10122703
946 Ga0207689_10128222
947 Ga0207689_10343979
948 Ga0207661_10062217
949 Ga0207661_10085861
950 Ga0207661_10129075
951 Ga0207661_10180715
952 Ga0207679_10015609
953 Ga0207679_10021772
954 Ga0207679_10021914
955 Ga0207667_10036533
956 Ga0207667_10059638
957 Ga0207667_10093712
958 Ga0207651_10007281
959 Ga0207651_10034620
960 Ga0207712_10315098
961 Ga0207668_10095336
962 Ga0207668_10156734
963 Ga0207668_10245591
964 Ga0207658_10007366
965 Ga0207658_10015051
966 Ga0207658_10260205
967 Ga0207677_10037035
968 Ga0207677_10085405
969 Ga0207703_10007631
970 Ga0207703_10048190
971 Ga0207703_10081424
972 Ga0207703_10166113
973 Ga0207703_10396584
974 Ga0207639_10088000
975 Ga0207708_10009265
976 Ga0207708_10010000
977 Ga0207708_10020137
978 Ga0207708_10071649
979 Ga0207702_10021149
980 Ga0207641_10000354
981 Ga0207641_10021575
982 Ga0207641_10036109
983 Ga0207641_10157450
984 Ga0207648_10034111
985 Ga0207648_10039536
986 Ga0207648_10040971
987 Ga0207648_10043766
988 Ga0207648_10077087
989 Ga0207648_10097425
990 Ga0207676_10050795
991 Ga0207674_10007013
992 Ga0207674_10090284
993 Ga0207674_10249983
994 Ga0207675_100030159
995 Ga0207675_100200397
996 Ga0207683_10013363
997 Ga0207683_10021339
998 Ga0207683_10030348
999 Ga0207683_10035683
1000 Ga0207683_10064819
1001 Ga0207683_10286271
1002 Ga0207698_10149796
1003 Ga0207428_10001725
1004 Ga0207428_10011189
1005 Ga0268266_10007877
1006 Ga0268266_10047256
1007 Ga0268266_10411794
1008 Ga0268264_10016473
1009 Ga0268264_10088351
1010 Ga0265319_1004213
1011 Ga0265319_1021161
1012 Ga0265334_10000661
1013 Ga0265318_10000092
1014 Ga0265318_10003204
1015 Ga0265338_10047919
1016 Ga0265338_10048600
1017 Ga0265338_10133443
1018 Ga0265330_10009017
1019 Ga0265332_10003594
1020 Ga0265332_10017823
1021 Ga0265328_10007878
1022 Ga0265320_10000067
1023 Ga0265320_10021398
1024 Ga0265325_10002550
1025 Ga0265325_10003217
1026 Ga0265325_10003500
1027 Ga0265325_10006993
1028 Ga0265325_10030612
1029 Ga0265325_10038198
1030 Ga0265329_10004815
1031 Ga0265329_10026828
1032 Ga0265329_10052058
1033 Ga0265340_10002040
1034 Ga0265340_10023711
1035 Ga0265339_10001665
1036 Ga0265331_10000047
1037 Ga0265331_10002371
1038 Ga0265331_10013012
1039 Ga0265331_10023848
1040 Ga0265331_10031064
1041 Ga0265316_10003774
1042 Ga0265316_10006215
1043 Ga0265316_10031902
1044 Ga0265316_10087835
1045 Ga0265313_10003424
1046 Ga0265313_10003949
1047 Ga0265313_10015422
1048 Ga0265313_10047680
1049 Ga0265313_10059999
1050 Ga0265314_10008345
1051 Ga0265314_10020827
1052 Ga0265314_10024659
1053 Ga0265342_10000247
1054 Ga0307416_100330817
1055 Ga0373930_0009231
1056 Ga0373938_0003539
1057 Ga0373926_0036629
1058 Ga0373934_0006294
1059 Ga0373940_0005290
1060 Ga0373944_0029964
1061 Ga0373949_0000466
1062 Ga0373951_0000525
1063 Ga0373952_0000577
1064 Ga0373932_0000438
1065 Ga0373939_0001137
1066 Ga0373945_0022227
1067 Ga0373954_0011553
1068 Ga0373954_0014938
1069 Ga0373957_0019652
1070 Ga0373957_0046377
1071 Ga0373960_0000336
1072 Ga0373943_0025656
1073 Ga0373943_0068261
1074 Ga0373946_0093239
1075 Ga0373955_0013720
1076 Ga0373955_0023939
1077 Ga0373955_0156178
1078 Ga0373962_0000489
1079 Ga0373931_0000500
1080 Ga0373935_0012867
1081 Ga0373935_0047994
1082 Ga0373927_0010045
1083 Ga0373933_0024803
1084 Ga0373933_0064637
1085 Ga0373947_0018825
1086 Ga0373947_0068366
1087 Ga0373947_0091396
1088 Ga0373937_0001230
1089 Ga0373937_0005807
1090 Ga0373937_0007909
1091 Ga0373937_0033415
1092 Ga0373937_0056879
1093 Ga0373925_0001427
1094 Ga0373925_0032763
1095 Ga0373925_0061004
1096 Ga0373925_0110264
1097 Ga0436364_1219174
1098 Ga0436365_0374751
1099 Ga0439453_0003367
1100 Ga0439446_0042974
1101 Ga0439435_0033613
1102 Ga0451576_0470379
1103 Ga0495592_0069364
1104 Ga0495582_0094731
1105 Ga0495594_0022496
1106 Ga0495608_0025375
1107 Ga0495618_0006810
1108 Ga0495628_0130236
1109 Ga0495630_0162923
1110 Ga0495640_0029357
1111 Ga0495640_0115951
1112 Ga0495667_0000257
1113 Ga0495667_0048402
1114 Ga0495634_0041532
1115 Ga0495634_0113840
1116 Ga0495657_0002406
1117 Ga0495658_0008029
1118 Ga0495669_0003334
1119 Ga0495669_0048010
1120 Ga0495613_0050463
1121 Ga0495636_0006986
1122 Ga0495674_0015622
1123 Ga0495674_0031715
1124 Ga0495674_0057766
1125 Ga0495674_0278134
1126 Ga0495675_0066757
1127 Ga0495684_0034602
1128 Ga0495684_0214706
1129 Ga0496100_0022991
1130 Ga0496101_0014228
1131 Ga0496101_0194622
1132 Ga0496104_0055078
1133 Ga0496104_0221162
1134 Ga0496109_0589599
1135 Ga0496111_0064626
1136 Ga0496112_0041197
1137 Ga0496112_0092493
1138 Ga0496113_0037794
1139 Ga0501071_0010122
1140 Ga0501076_0093277
1141 Ga0501079_0010902
1142 nmdc:mga05p37_121208_c1
1143 nmdc:mga05p37_122866_c1
1144 nmdc:mga05p37_131386_c1
1145 nmdc:mga05p37_157462_c1
1146 nmdc:mga05p37_424936_c1
1147 nmdc:mga05p37_63384_c1
1148 nmdc:mga05p37_6809_c1
1149 nmdc:mga05p37_7994_c1
1150 nmdc:mga09592_109495_c1
1151 nmdc:mga09592_14204_c1
1152 nmdc:mga09592_20834_c1
1153 nmdc:mga09592_28777_c1
1154 nmdc:mga09592_40128_c1
1155 nmdc:mga0qj67_19467_c1
1156 nmdc:mga0qj67_8872_c1
1157 nmdc:mga06r32_10022_c1
1158 nmdc:mga06r32_114860_c1
1159 nmdc:mga06r32_33836_c1
1160 nmdc:mga06r32_5018_c1
1161 nmdc:mga06r32_65979_c1
1162 nmdc:mga06r32_89752_c1
1163 nmdc:mga08y16_102592_c1
1164 nmdc:mga08y16_15443_c1
1165 nmdc:mga08y16_39736_c1
1166 nmdc:mga08y16_5537_c1
1167 nmdc:mga0n895_13958_c1
1168 nmdc:mga0n895_4337_c1
1169 nmdc:mga0n895_758_c1
1170 nmdc:mga0n895_92960_c1
1171 nmdc:mga0n895_9778_c1
1172 nmdc:mga0rr50_8_c1
1173 nmdc:mga08x19_429_c1
1174 nmdc:mga0a205_1202_c1
1175 nmdc:mga0a205_1225_c1
1176 nmdc:mga0a205_15529_c1
1177 nmdc:mga0a205_18886_c1
1178 Ga0495619_0089764
1179 Ga0500641_0000637
1180 Ga0501082_0317554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

54

182

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8era-assembly1.cif.gz_C rmc-5552 in complex with mtorc1 and fkbp12 0.7402 324 351
8brf-assembly1.cif.gz_AAA yopq apo from yersinia enterocolitica 0.7364 321 346
8ewo-assembly2.cif.gz_B crystal structure of putative glyoxylase ii from pseudomonas aeruginosa 0.7256 25 209
6sr6-assembly2.cif.gz_C crystal structure of the rac core with a pseudo substrate bound to ssz1 sbd 0.7251 318 349
8brf-assembly1.cif.gz_BBB yopq apo from yersinia enterocolitica 0.7095 321 346
ID Description Score Start End Superfamily
af_Q9BZH6_665_948_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8572 324 347 2.130.10.10
af_Q8SX44_133_405_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8251 324 350 2.130.10.10
af_Q9Y7K5_82_411_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8204 324 347 2.130.10.10
af_Q9FND4_203_477_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8191 324 348 2.130.10.10
af_Q9LIM7_154_399_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8004 324 349 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V8KB78-F1-model_v4 MBL fold metallo-hydrolase 0.9935 19 275 GO:0016787
AF-A0A2V8VZF5-F1-model_v4 MBL fold metallo-hydrolase 0.9832 139 283 GO:0016787
AF-A0A7X2TT75-F1-model_v4 MBL fold metallo-hydrolase 0.9784 19 276 GO:0008270
GO:0008800
GO:0017001
AF-A0A2V8JW24-F1-model_v4 MBL fold metallo-hydrolase 0.9644 19 351 GO:0016787
AF-A0A2V8GFT8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9641 18 338

Map