F466892

General Info

Members Datasets Scaffolds Average Seq Length
589 288 547 314

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0041444|Ga0466963_0041444_178_1185
Length 335
Sequence MTASDLFAGDLANDRVLAARPGDVWLADDRRSRPSWTIAELEAAKAGRTISVVLPALDEEETIASVIESISPLLDGLVDELIVLDSGSTDDTEIRAVAAGARVVSREQALPEVPIRPGKGEALWRSLAATSGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGVHLVKSFYRRPLRGSELSDVGDVGGDVSATGGGRVTELVARPLLSALRPELGSILQPLGGEYAATRDLLTSVPFAPGYGVEIGLLVDTFDRLGLDAIAQVNLGVRAHRNRPLAELGVMSRQIIATLLSRCGIPDSGVGLTQFVADGPEGHGYTERTSPVSLADRPPMQAIRPR

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221692 Nocardia sp. Root136 Isolate Unclassified
6 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
7 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
8 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
9 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
10 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
11 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
12 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
13 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
14 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
15 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
16 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
17 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
18 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
19 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
20 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
21 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
22 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
23 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
24 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
25 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
26 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
27 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
28 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
29 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
30 2922554459 Rhodococcus sp. 66b Isolate Unclassified
31 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
32 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
33 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
34 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
35 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
36 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
37 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
38 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
39 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
278 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
279 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
284 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.87
Metatranscriptomes 0
Isolates 7.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 9.68
Nodule 0.17
Rhizoplane 14.26
Rhizosphere 61.63
Stem 0
Stem Tuber 0
Unclassified 14.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1003218 3300002074 Bacteria 1863
2 JGI24744J21845_10005795 3300002077 Bacteria 2559
3 JGI24744J21845_10010307 3300002077 Bacteria 1915
4 JGI24742J22300_10012964 3300002244 Bacteria 1394
5 Ga0055540_1000068 3300003792 Bacteria 120413
6 Ga0055540_1004203 3300003792 Bacteria 6624
7 Ga0055540_1009799 3300003792 Bacteria 3262
8 Ga0070676_10009225 3300005328 Bacteria 5332
9 Ga0070676_10222760 3300005328 Bacteria 1247
10 Ga0070683_100174455 3300005329 Bacteria 2041
11 Ga0070683_100687102 3300005329 Bacteria 980
12 Ga0070690_100123284 3300005330 Bacteria 1742
13 Ga0068869_100042289 3300005334 Bacteria 3267
14 Ga0068869_100086429 3300005334 Bacteria 2350
15 Ga0070666_10014663 3300005335 Bacteria 4991
16 Ga0070666_10046623 3300005335 Bacteria 2908
17 Ga0070682_100021115 3300005337 Bacteria 3837
18 Ga0070682_100130961 3300005337 Bacteria 1697
19 Ga0070668_100000366 3300005347 Bacteria 29820
20 Ga0070668_100379395 3300005347 Bacteria 1203
21 Ga0070669_100001667 3300005353 Bacteria 16067
22 Ga0070671_100003983 3300005355 Bacteria 11636
23 Ga0070671_100005370 3300005355 Bacteria 10216
24 Ga0070671_100021745 3300005355 Bacteria 5238
25 Ga0070674_100000805 3300005356 Bacteria 16153
26 Ga0070688_100136561 3300005365 Bacteria 1661
27 Ga0070667_100000109 3300005367 Bacteria 105260
28 Ga0070667_100007680 3300005367 Bacteria 8946
29 Ga0070667_100007796 3300005367 Bacteria 8877
30 Ga0070667_100008481 3300005367 Bacteria 8519
31 Ga0070667_100034730 3300005367 Bacteria 4221
32 Ga0070667_100062528 3300005367 Bacteria 3154
33 Ga0070714_100107689 3300005435 Bacteria 2464
34 Ga0070714_100272896 3300005435 Bacteria 1569
35 Ga0070713_100076008 3300005436 Bacteria 2851
36 Ga0070711_100055837 3300005439 Bacteria 2729
37 Ga0070711_100122928 3300005439 Bacteria 1922
38 Ga0070705_100019559 3300005440 Bacteria 3565
39 Ga0070700_100049172 3300005441 Bacteria 2617
40 Ga0070694_100096207 3300005444 Bacteria 2087
41 Ga0070663_100374177 3300005455 Bacteria 1158
42 Ga0070678_100002537 3300005456 Bacteria 10014
43 Ga0070678_100041683 3300005456 Bacteria 3256
44 Ga0070662_100006133 3300005457 Bacteria 7730
45 Ga0070662_100157166 3300005457 Bacteria 1776
46 Ga0068867_100091221 3300005459 Bacteria 2313
47 Ga0070685_10096735 3300005466 Bacteria 1797
48 Ga0068853_100015629 3300005539 Bacteria 6235
49 Ga0068853_100015864 3300005539 Bacteria 6188
50 Ga0068853_100034882 3300005539 Bacteria 4272
51 Ga0070672_100202381 3300005543 Bacteria 1661
52 Ga0070695_100011805 3300005545 Bacteria 5229
53 Ga0070696_100030020 3300005546 Bacteria 3719
54 Ga0070696_100038167 3300005546 Bacteria 3314
55 Ga0070693_100170217 3300005547 Bacteria 1394
56 Ga0070665_100001778 3300005548 Bacteria 24546
57 Ga0070665_100011482 3300005548 Bacteria 8958
58 Ga0070704_100004972 3300005549 Bacteria 7722
59 Ga0068855_100103152 3300005563 Bacteria 3282
60 Ga0068854_100004474 3300005578 Bacteria 8814
61 Ga0068854_100032598 3300005578 Bacteria 3626
62 Ga0070702_100012084 3300005615 Bacteria 4315
63 Ga0070702_100045308 3300005615 Bacteria 2487
64 Ga0068852_100065428 3300005616 Bacteria 3172
65 Ga0068852_100189414 3300005616 Bacteria 1940
66 Ga0068859_100005634 3300005617 Bacteria 12767
67 Ga0068859_100015931 3300005617 Bacteria 7556
68 Ga0068859_100195749 3300005617 Bacteria 2106
69 Ga0068866_10000999 3300005718 Bacteria 12422
70 Ga0068861_100063513 3300005719 Bacteria 2838
71 Ga0068863_100000123 3300005841 Bacteria 80999
72 Ga0068863_100004187 3300005841 Bacteria 14243
73 Ga0068863_100043788 3300005841 Bacteria 4249
74 Ga0068863_100050174 3300005841 Bacteria 3957
75 Ga0068863_100135682 3300005841 Bacteria 2351
76 Ga0068858_100001382 3300005842 Bacteria 25008
77 Ga0068858_100274755 3300005842 Bacteria 1604
78 Ga0068860_100000175 3300005843 Bacteria 105260
79 Ga0068860_100008172 3300005843 Bacteria 10416
80 Ga0068860_100033740 3300005843 Bacteria 4911
81 Ga0068862_100000091 3300005844 Bacteria 107015
82 Ga0068862_100004256 3300005844 Bacteria 12116
83 Ga0068862_100166999 3300005844 Bacteria 1968
84 Ga0068862_100474187 3300005844 Bacteria 1183
85 Ga0081455_10168844 3300005937 Bacteria 1669
86 Ga0075365_10014494 3300006038 Bacteria 4743
87 Ga0075363_100002133 3300006048 Bacteria 7948
88 Ga0075363_100006493 3300006048 Bacteria 5318
89 Ga0075363_100021909 3300006048 Bacteria 3225
90 Ga0075363_100026444 3300006048 Bacteria 2969
91 Ga0075363_100061206 3300006048 Bacteria 2028
92 Ga0075363_100150674 3300006048 Bacteria 1313
93 Ga0075364_10005916 3300006051 Bacteria 7149
94 Ga0075364_10010657 3300006051 Bacteria 5558
95 Ga0075364_10017802 3300006051 Bacteria 4443
96 Ga0075364_10019287 3300006051 Bacteria 4280
97 Ga0075364_10042904 3300006051 Bacteria 2940
98 Ga0075364_10084707 3300006051 Bacteria 2099
99 Ga0070715_10076602 3300006163 Bacteria 1508
100 Ga0070716_100016155 3300006173 Bacteria 3848
101 Ga0070716_100027412 3300006173 Bacteria 3061
102 Ga0070716_100110301 3300006173 Bacteria 1704
103 Ga0070712_100001760 3300006175 Bacteria 13252
104 Ga0070712_100037254 3300006175 Bacteria 3314
105 Ga0075369_10002433 3300006186 Bacteria 6636
106 Ga0075369_10002841 3300006186 Bacteria 6237
107 Ga0075369_10015052 3300006186 Bacteria 3099
108 Ga0075370_10000494 3300006353 Bacteria 14916
109 Ga0075370_10007840 3300006353 Bacteria 5462
110 Ga0075370_10034907 3300006353 Bacteria 2820
111 Ga0075428_100015103 3300006844 Bacteria 8576
112 Ga0075430_100035923 3300006846 Bacteria 4203
113 Ga0075431_100127978 3300006847 Bacteria 2621
114 Ga0068865_100003183 3300006881 Bacteria 9836
115 Ga0068865_100053708 3300006881 Bacteria 2796
116 Ga0097620_100005634 3300006931 Bacteria 12767
117 Ga0097620_100015929 3300006931 Bacteria 7556
118 Ga0097620_100195751 3300006931 Bacteria 2106
119 Ga0111539_10703562 3300009094 Bacteria 1176
120 Ga0105245_10004590 3300009098 Bacteria 12194
121 Ga0105245_10136248 3300009098 Bacteria 2308
122 Ga0105247_10000070 3300009101 Bacteria 115098
123 Ga0105247_10004456 3300009101 Bacteria 8925
124 Ga0105247_10080855 3300009101 Bacteria 2048
125 Ga0114129_10038244 3300009147 Bacteria 6770
126 Ga0105243_10000243 3300009148 Bacteria 62451
127 Ga0105243_10002033 3300009148 Bacteria 17149
128 Ga0105243_10402379 3300009148 Bacteria 1272
129 Ga0105242_10005082 3300009176 Bacteria 10158
130 Ga0105248_10000331 3300009177 Bacteria 55929
131 Ga0105248_10053727 3300009177 Bacteria 4519
132 Ga0105248_10343228 3300009177 Bacteria 1681
133 Ga0105237_10014312 3300009545 Bacteria 8303
134 Ga0105237_10054044 3300009545 Bacteria 4025
135 Ga0105237_10061680 3300009545 Bacteria 3748
136 Ga0105237_10136015 3300009545 Bacteria 2452
137 Ga0105238_10338527 3300009551 Bacteria 1492
138 Ga0105249_10000020 3300009553 Bacteria 260634
139 Ga0105249_10003076 3300009553 Bacteria 14407
140 Ga0105249_10011266 3300009553 Bacteria 7850
141 Ga0105249_10158180 3300009553 Bacteria 2187
142 Ga0099796_10024061 3300010159 Bacteria 1909
143 Ga0105239_10028306 3300010375 Bacteria 6164
144 Ga0105239_10037981 3300010375 Bacteria 5277
145 Ga0105239_10495034 3300010375 Bacteria 1389
146 Ga0105239_10687768 3300010375 Bacteria 1169
147 Ga0157371_10182247 3300013102 Bacteria 1502
148 Ga0157369_10480499 3300013105 Bacteria 1286
149 Ga0157374_10107569 3300013296 Bacteria 2680
150 Ga0157378_10000959 3300013297 Bacteria 26426
151 Ga0163162_10005660 3300013306 Bacteria 12071
152 Ga0157375_10081782 3300013308 Bacteria 3270
153 Ga0157375_10429952 3300013308 Bacteria 1486
154 Ga0163163_10239146 3300014325 Bacteria 1865
155 Ga0157377_10165741 3300014745 Bacteria 1378
156 Ga0157379_10143634 3300014968 Bacteria 2152
157 Ga0163161_10007218 3300017792 Bacteria 7680
158 Ga0213876_10001195 3300021384 Bacteria 16414
159 Ga0213876_10010296 3300021384 Bacteria 5022
160 Ga0213876_10020099 3300021384 Bacteria 3529
161 Ga0213875_10015626 3300021388 Bacteria 3692
162 Ga0213875_10038669 3300021388 Bacteria 2248
163 Ga0213875_10057079 3300021388 Bacteria 1829
164 Ga0209673_1015235 3300025273 Bacteria 2932
165 Ga0209673_1039943 3300025273 Bacteria 1348
166 Ga0209051_1000057 3300025303 Bacteria 263902
167 Ga0209051_1000840 3300025303 Bacteria 31631
168 Ga0209051_1002003 3300025303 Bacteria 15546
169 Ga0209051_1003913 3300025303 Bacteria 9493
170 Ga0207692_10017059 3300025898 Bacteria 3230
171 Ga0207642_10001701 3300025899 Bacteria 6804
172 Ga0207710_10000010 3300025900 Bacteria 482087
173 Ga0207710_10001871 3300025900 Bacteria 10117
174 Ga0207710_10079938 3300025900 Bacteria 1515
175 Ga0207680_10034522 3300025903 Bacteria 2895
176 Ga0207680_10093470 3300025903 Bacteria 1918
177 Ga0207685_10015987 3300025905 Bacteria 2391
178 Ga0207685_10134136 3300025905 Bacteria 1103
179 Ga0207645_10008512 3300025907 Bacteria 7155
180 Ga0207654_10203199 3300025911 Bacteria 1306
181 Ga0207707_10201820 3300025912 Bacteria 1734
182 Ga0207671_10034677 3300025914 Bacteria 3749
183 Ga0207671_10036796 3300025914 Bacteria 3630
184 Ga0207693_10016517 3300025915 Bacteria 5898
185 Ga0207663_10006686 3300025916 Bacteria 5928
186 Ga0207663_10066359 3300025916 Bacteria 2310
187 Ga0207663_10150278 3300025916 Bacteria 1633
188 Ga0207657_10122033 3300025919 Bacteria 2143
189 Ga0207652_10290566 3300025921 Bacteria 1475
190 Ga0207681_10001388 3300025923 Bacteria 15652
191 Ga0207694_10114079 3300025924 Bacteria 2152
192 Ga0207687_10003067 3300025927 Bacteria 11336
193 Ga0207700_10327878 3300025928 Bacteria 1328
194 Ga0207664_10123684 3300025929 Bacteria 2169
195 Ga0207664_10290083 3300025929 Bacteria 1438
196 Ga0207644_10002584 3300025931 Bacteria 11651
197 Ga0207644_10050115 3300025931 Bacteria 2992
198 Ga0207706_10005802 3300025933 Bacteria 11483
199 Ga0207686_10007952 3300025934 Bacteria 5717
200 Ga0207686_10332664 3300025934 Bacteria 1138
201 Ga0207709_10002717 3300025935 Bacteria 10935
202 Ga0207709_10004811 3300025935 Bacteria 7739
203 Ga0207709_10221976 3300025935 Bacteria 1363
204 Ga0207670_10036704 3300025936 Bacteria 3189
205 Ga0207670_10067446 3300025936 Bacteria 2462
206 Ga0207669_10000728 3300025937 Bacteria 14253
207 Ga0207669_10063173 3300025937 Bacteria 2284
208 Ga0207704_10001117 3300025938 Bacteria 11938
209 Ga0207665_10003168 3300025939 Bacteria 11018
210 Ga0207665_10005883 3300025939 Bacteria 8161
211 Ga0207665_10216183 3300025939 Bacteria 1403
212 Ga0207691_10168999 3300025940 Bacteria 1915
213 Ga0207711_10002791 3300025941 Bacteria 15365
214 Ga0207689_10023196 3300025942 Bacteria 5210
215 Ga0207689_10081951 3300025942 Bacteria 2652
216 Ga0207661_10286914 3300025944 Bacteria 1472
217 Ga0207712_10000010 3300025961 Bacteria 455972
218 Ga0207712_10002366 3300025961 Bacteria 12220
219 Ga0207712_10018563 3300025961 Bacteria 4531
220 Ga0207712_10058630 3300025961 Bacteria 2721
221 Ga0207668_10000510 3300025972 Bacteria 24298
222 Ga0207668_10002330 3300025972 Bacteria 11094
223 Ga0207668_10030976 3300025972 Bacteria 3519
224 Ga0207668_10044124 3300025972 Bacteria 3031
225 Ga0207668_10159648 3300025972 Bacteria 1755
226 Ga0207640_10014372 3300025981 Bacteria 4556
227 Ga0207658_10000525 3300025986 Bacteria 34999
228 Ga0207658_10004155 3300025986 Bacteria 10091
229 Ga0207658_10010262 3300025986 Bacteria 6364
230 Ga0207658_10011382 3300025986 Bacteria 6055
231 Ga0207658_10036660 3300025986 Bacteria 3517
232 Ga0207658_10049852 3300025986 Bacteria 3078
233 Ga0207658_10184745 3300025986 Bacteria 1728
234 Ga0207677_10001429 3300026023 Bacteria 12703
235 Ga0207677_10206583 3300026023 Bacteria 1565
236 Ga0207703_10006257 3300026035 Bacteria 9520
237 Ga0207703_10214579 3300026035 Bacteria 1717
238 Ga0207639_10004094 3300026041 Bacteria 9832
239 Ga0207639_10011257 3300026041 Bacteria 6206
240 Ga0207678_10012182 3300026067 Bacteria 7555
241 Ga0207678_10042077 3300026067 Bacteria 3959
242 Ga0207678_10272795 3300026067 Bacteria 1451
243 Ga0207708_10001516 3300026075 Bacteria 17312
244 Ga0207708_10048533 3300026075 Bacteria 3232
245 Ga0207641_10001365 3300026088 Bacteria 24147
246 Ga0207641_10013676 3300026088 Bacteria 6659
247 Ga0207641_10032803 3300026088 Bacteria 4313
248 Ga0207641_10082288 3300026088 Bacteria 2797
249 Ga0207641_10094859 3300026088 Bacteria 2617
250 Ga0207648_10059896 3300026089 Bacteria 3321
251 Ga0207648_10114095 3300026089 Bacteria 2374
252 Ga0207675_100002729 3300026118 Bacteria 17377
253 Ga0207675_100104241 3300026118 Bacteria 2673
254 Ga0207683_10007107 3300026121 Bacteria 9596
255 Ga0207683_10314131 3300026121 Bacteria 1435
256 Ga0207698_10087808 3300026142 Bacteria 2534
257 Ga0268266_10002138 3300028379 Bacteria 21775
258 Ga0268266_10049109 3300028379 Bacteria 3617
259 Ga0268266_10060708 3300028379 Bacteria 3259
260 Ga0268265_10000105 3300028380 Bacteria 105463
261 Ga0268265_10152250 3300028380 Bacteria 1952
262 Ga0268264_10000237 3300028381 Bacteria 105274
263 Ga0268264_10045886 3300028381 Bacteria 3629
264 Ga0265327_10000329 3300031251 Bacteria 90292
265 Ga0265327_10000336 3300031251 Bacteria 89407
266 Ga0265327_10013354 3300031251 Bacteria 5460
267 Ga0307410_10037064 3300031852 Bacteria 3182
268 Ga0307407_10235112 3300031903 Bacteria 1247
269 Ga0307409_100066679 3300031995 Bacteria 2839
270 Ga0307416_100542478 3300032002 Bacteria 1235
271 Ga0307411_10086212 3300032005 Bacteria 2178
272 Ga0436364_0177961 3300037853 Bacteria 37248
273 Ga0436364_1000162 3300037853 Bacteria 14750
274 Ga0436364_1391144 3300037853 Bacteria 6197
275 Ga0436365_0250021 3300039437 Bacteria 3133
276 Ga0436365_0256841 3300039437 Bacteria 7567
277 Ga0436365_0775855 3300039437 Bacteria 20670
278 Ga0436365_0892314 3300039437 Bacteria 56989
279 Ga0436365_1083994 3300039437 Bacteria 225582
280 Ga0439461_0004334 3300041410 Bacteria 2368
281 Ga0439461_0007265 3300041410 Bacteria 1955
282 Ga0439461_0013367 3300041410 Bacteria 1549
283 Ga0439466_0001397 3300041411 Bacteria 9419
284 Ga0439465_0001791 3300041413 Bacteria 7039
285 Ga0439465_0009228 3300041413 Bacteria 3108
286 Ga0439465_0017471 3300041413 Bacteria 2239
287 Ga0451797_0877360 3300041453 Bacteria 2175
288 Ga0451853_0574377 3300041512 Bacteria 3004
289 Ga0439431_0003646 3300041997 Bacteria 3399
290 Ga0439442_006979 3300042002 Bacteria 2269
291 Ga0439445_0001555 3300042004 Bacteria 4991
292 Ga0439445_0006373 3300042004 Bacteria 2711
293 Ga0439445_0012612 3300042004 Bacteria 2034
294 Ga0439448_0027744 3300042005 Bacteria 1786
295 Ga0439434_0008779 3300042435 Bacteria 2969
296 Ga0466969_0028146 3300044656 Bacteria 2873
297 Ga0466969_0058709 3300044656 Bacteria 1872
298 Ga0466972_0008927 3300044658 Bacteria 5028
299 Ga0466972_0043009 3300044658 Bacteria 2194
300 Ga0466972_0108147 3300044658 Bacteria 1314
301 Ga0466965_0001842 3300044683 Bacteria 8814
302 Ga0466965_0002625 3300044683 Bacteria 7693
303 Ga0466965_0008108 3300044683 Bacteria 4852
304 Ga0466965_0018951 3300044683 Bacteria 3302
305 Ga0466966_0014743 3300044684 Bacteria 5171
306 Ga0466966_0017367 3300044684 Bacteria 4755
307 Ga0466961_0009890 3300044693 Bacteria 6077
308 Ga0466961_0040929 3300044693 Bacteria 2971
309 Ga0466963_0041444 3300044694 Bacteria 3020
310 Ga0466963_0173639 3300044694 Bacteria 1503
311 Ga0466971_0005246 3300044719 Bacteria 5613
312 Ga0466968_0000854 3300044735 Bacteria 10673
313 Ga0466968_0004297 3300044735 Bacteria 5321
314 Ga0466970_0029117 3300044765 Bacteria 2905
315 Ga0466957_0022925 3300044842 Bacteria 3686
316 Ga0466957_0031861 3300044842 Bacteria 3153
317 Ga0466957_0054320 3300044842 Bacteria 2445
318 Ga0466957_0093233 3300044842 Bacteria 1890
319 Ga0466960_0000233 3300044901 Bacteria 19318
320 Ga0466960_0002071 3300044901 Bacteria 7458
321 Ga0466960_0005499 3300044901 Bacteria 5023
322 Ga0466959_0006862 3300045049 Bacteria 7941
323 Ga0466959_0025377 3300045049 Bacteria 4392
324 Ga0466959_0068215 3300045049 Bacteria 2577
325 Ga0466959_0191249 3300045049 Bacteria 1428
326 Ga0466958_0065087 3300045836 Bacteria 2225
327 Ga0466958_0097220 3300045836 Bacteria 1827
328 Ga0466967_0000930 3300045976 Bacteria 15773
329 Ga0466967_0061135 3300045976 Bacteria 3341
330 Ga0466967_0070930 3300045976 Bacteria 3118
331 Ga0466967_0132898 3300045976 Bacteria 2312
332 Ga0466967_0331599 3300045976 Bacteria 1469
333 Ga0495603_0026909 3300046455 Bacteria 3473
334 Ga0495629_0011420 3300046459 Bacteria 6451
335 Ga0495638_0003286 3300046460 Bacteria 12749
336 Ga0495638_0005845 3300046460 Bacteria 9045
337 Ga0495641_0020109 3300046461 Bacteria 3396
338 Ga0495580_0068083 3300046472 Bacteria 2490
339 Ga0495662_0021019 3300046476 Bacteria 3157
340 Ga0495607_0023852 3300046501 Bacteria 3823
341 Ga0495648_0031144 3300046524 Bacteria 3516
342 Ga0495654_0049730 3300046530 Bacteria 2052
343 Ga0495665_0058517 3300046531 Bacteria 2035
344 Ga0495640_0024630 3300046533 Bacteria 4377
345 Ga0495668_0002057 3300046616 Bacteria 17478
346 Ga0495668_0061647 3300046616 Bacteria 2068
347 Ga0495611_0026189 3300046648 Bacteria 2544
348 Ga0495625_0330220 3300046660 Bacteria 969
349 Ga0495671_0068502 3300046692 Bacteria 1745
350 Ga0495581_0053737 3300047315 Bacteria 2326
351 Ga0495672_0004317 3300047320 Bacteria 11709
352 Ga0495683_0000800 3300047323 Bacteria 22388
353 Ga0495673_0000909 3300047469 Bacteria 27065
354 Ga0495686_0002548 3300047472 Bacteria 17016
355 Ga0495593_0085235 3300047673 Bacteria 1630
356 Ga0496100_0000231 3300048903 Bacteria 29595
357 Ga0496100_0001330 3300048903 Bacteria 12093
358 Ga0496100_0002306 3300048903 Bacteria 9656
359 Ga0496100_0002834 3300048903 Bacteria 8885
360 Ga0496100_0003824 3300048903 Bacteria 7889
361 Ga0496100_0031541 3300048903 Bacteria 3296
362 Ga0496100_0127768 3300048903 Bacteria 1786
363 Ga0496101_0000042 3300048904 Bacteria 163148
364 Ga0496101_0000090 3300048904 Bacteria 98184
365 Ga0496101_0010145 3300048904 Bacteria 6212
366 Ga0496101_0033713 3300048904 Bacteria 3613
367 Ga0496101_0033783 3300048904 Bacteria 3610
368 Ga0496101_0038039 3300048904 Bacteria 3416
369 Ga0496101_0038291 3300048904 Bacteria 3405
370 Ga0496101_0336695 3300048904 Bacteria 1185
371 Ga0496102_0000015 3300048905 Bacteria 304524
372 Ga0496102_0000016 3300048905 Bacteria 286787
373 Ga0496102_0002305 3300048905 Bacteria 16314
374 Ga0496102_0008987 3300048905 Bacteria 8573
375 Ga0496102_0035984 3300048905 Bacteria 4458
376 Ga0496102_0045940 3300048905 Bacteria 3965
377 Ga0496102_0115278 3300048905 Bacteria 2507
378 Ga0496102_0147712 3300048905 Bacteria 2207
379 Ga0496102_0328547 3300048905 Bacteria 1440
380 Ga0496103_0000015 3300048906 Bacteria 287966
381 Ga0496103_0000160 3300048906 Bacteria 71063
382 Ga0496103_0000637 3300048906 Bacteria 26749
383 Ga0496103_0000657 3300048906 Bacteria 26145
384 Ga0496103_0046368 3300048906 Bacteria 2683
385 Ga0496103_0081341 3300048906 Bacteria 2038
386 Ga0496103_0289120 3300048906 Bacteria 1054
387 Ga0496104_0017452 3300048907 Bacteria 6536
388 Ga0496104_0064135 3300048907 Bacteria 3486
389 Ga0496104_0355548 3300048907 Bacteria 1377
390 Ga0496105_0006706 3300048908 Bacteria 8862
391 Ga0496105_0046271 3300048908 Bacteria 3591
392 Ga0496105_0077752 3300048908 Bacteria 2740
393 Ga0496105_0189193 3300048908 Bacteria 1684
394 Ga0496106_0000103 3300048909 Bacteria 65242
395 Ga0496106_0004113 3300048909 Bacteria 10840
396 Ga0496106_0004531 3300048909 Bacteria 10293
397 Ga0496106_0035299 3300048909 Bacteria 3738
398 Ga0496106_0053778 3300048909 Bacteria 3042
399 Ga0496107_0000847 3300048910 Bacteria 17909
400 Ga0496107_0010318 3300048910 Bacteria 6487
401 Ga0496107_0024873 3300048910 Bacteria 4238
402 Ga0496107_0028295 3300048910 Bacteria 3982
403 Ga0496107_0098928 3300048910 Bacteria 2137
404 Ga0496108_0000230 3300048911 Bacteria 50141
405 Ga0496108_0029159 3300048911 Bacteria 4569
406 Ga0496108_0069590 3300048911 Bacteria 2970
407 Ga0496109_0000312 3300048912 Bacteria 45661
408 Ga0496109_0001308 3300048912 Bacteria 20550
409 Ga0496109_0012818 3300048912 Bacteria 7246
410 Ga0496109_0077645 3300048912 Bacteria 3056
411 Ga0496109_0139103 3300048912 Bacteria 2270
412 Ga0496109_0296618 3300048912 Bacteria 1524
413 Ga0496110_0001276 3300048913 Bacteria 18022
414 Ga0496110_0038494 3300048913 Bacteria 4162
415 Ga0496110_0319086 3300048913 Bacteria 1415
416 Ga0496111_0044502 3300048914 Bacteria 3191
417 Ga0496111_0047998 3300048914 Bacteria 3075
418 Ga0496112_0003401 3300048915 Bacteria 13142
419 Ga0496112_0022814 3300048915 Bacteria 5972
420 Ga0496112_0078088 3300048915 Bacteria 3274
421 Ga0496112_0295998 3300048915 Bacteria 1564
422 Ga0496112_0331402 3300048915 Bacteria 1466
423 Ga0496112_0368376 3300048915 Bacteria 1378
424 Ga0496112_0493431 3300048915 Bacteria 1160
425 Ga0496113_0029324 3300048916 Bacteria 3972
426 Ga0496113_0035993 3300048916 Bacteria 3625
427 Ga0496113_0070426 3300048916 Bacteria 2658
428 Ga0496113_0108495 3300048916 Bacteria 2158
429 Ga0496114_0000265 3300048917 Bacteria 38105
430 Ga0496114_0000344 3300048917 Bacteria 33940
431 Ga0496114_0000741 3300048917 Bacteria 24353
432 Ga0496114_0060100 3300048917 Bacteria 3176
433 Ga0496114_0313064 3300048917 Bacteria 1387
434 Ga0496114_0337089 3300048917 Bacteria 1333
435 Ga0496114_0341395 3300048917 Bacteria 1324
436 Ga0496115_0003291 3300048918 Bacteria 11598
437 Ga0496115_0004402 3300048918 Bacteria 10199
438 Ga0496115_0008702 3300048918 Bacteria 7520
439 Ga0496116_0000055 3300048919 Bacteria 286923
440 Ga0496116_0000178 3300048919 Bacteria 128023
441 Ga0496116_0007231 3300048919 Bacteria 9897
442 Ga0496116_0165334 3300048919 Bacteria 1207
443 Ga0496117_0000006 3300048920 Bacteria 758420
444 Ga0496117_0000047 3300048920 Bacteria 299632
445 Ga0496117_0006938 3300048920 Bacteria 11226
446 Ga0496117_0047002 3300048920 Bacteria 3099
447 Ga0496117_0122284 3300048920 Bacteria 1596
448 Ga0496118_0000004 3300048921 Bacteria 758420
449 Ga0496118_0000050 3300048921 Bacteria 244124
450 Ga0496118_0002176 3300048921 Bacteria 27275
451 Ga0496118_0006562 3300048921 Bacteria 12723
452 Ga0496118_0132038 3300048921 Bacteria 1601
453 Ga0496118_0132050 3300048921 Bacteria 1601
454 Ga0496119_0002385 3300048922 Bacteria 20639
455 Ga0496119_0009657 3300048922 Bacteria 8223
456 Ga0496119_0024653 3300048922 Bacteria 4224
457 Ga0496119_0057722 3300048922 Bacteria 2343
458 Ga0496119_0110867 3300048922 Bacteria 1523
459 Ga0496121_0000139 3300048924 Bacteria 163176
460 Ga0496121_0000258 3300048924 Bacteria 112069
461 Ga0496121_0008765 3300048924 Bacteria 11803
462 Ga0496121_0012441 3300048924 Bacteria 9276
463 Ga0496122_0000149 3300048925 Bacteria 163504
464 Ga0496122_0059268 3300048925 Bacteria 2826
465 Ga0496122_0102067 3300048925 Bacteria 1914
466 Ga0496123_0002050 3300048926 Bacteria 26006
467 Ga0496123_0042180 3300048926 Bacteria 3153
468 Ga0496124_0000114 3300048927 Bacteria 165215
469 Ga0496124_0002610 3300048927 Bacteria 23269
470 Ga0496124_0133524 3300048927 Bacteria 1968
471 Ga0496125_0000130 3300048928 Bacteria 163176
472 Ga0496125_0014400 3300048928 Bacteria 7704
473 Ga0496125_0019355 3300048928 Bacteria 6423
474 Ga0496125_0044840 3300048928 Bacteria 3731
475 Ga0496126_0000049 3300048929 Bacteria 317568
476 Ga0496126_0000149 3300048929 Bacteria 163176
477 Ga0496126_0000350 3300048929 Bacteria 96612
478 Ga0496126_0006663 3300048929 Bacteria 12845
479 Ga0496126_0018794 3300048929 Bacteria 6834
480 Ga0496126_0076706 3300048929 Bacteria 2965
481 Ga0496126_0160608 3300048929 Bacteria 1920
482 Ga0501032_0001468 3300049569 Bacteria 18774
483 Ga0501032_0026668 3300049569 Bacteria 3972
484 Ga0501032_0040412 3300049569 Bacteria 3170
485 Ga0501034_0001443 3300049571 Bacteria 31525
486 Ga0501034_0058916 3300049571 Bacteria 3858
487 Ga0501034_0064315 3300049571 Bacteria 3682
488 Ga0501034_0133583 3300049571 Bacteria 2464
489 Ga0501034_0379504 3300049571 Bacteria 1339
490 Ga0501036_0032238 3300049572 Bacteria 4427
491 Ga0501037_0000338 3300049573 Bacteria 39545
492 Ga0501037_0002236 3300049573 Bacteria 13981
493 Ga0501038_0020484 3300049574 Bacteria 5942
494 Ga0501043_0000159 3300049579 Bacteria 61151
495 Ga0501043_0015522 3300049579 Bacteria 5969
496 Ga0501046_0001102 3300049580 Bacteria 26442
497 Ga0501047_0027835 3300049581 Bacteria 5447
498 Ga0501047_0306713 3300049581 Bacteria 1429
499 Ga0501048_0013803 3300049582 Bacteria 5991
500 Ga0501067_0051246 3300049583 Bacteria 2288
501 Ga0501068_0031779 3300049584 Bacteria 3137
502 Ga0501069_0009619 3300049585 Bacteria 5105
503 Ga0501070_0002146 3300049586 Bacteria 17328
504 Ga0501070_0005100 3300049586 Bacteria 11196
505 Ga0501070_0297436 3300049586 Bacteria 1315
506 Ga0501073_0078371 3300049589 Bacteria 2299
507 Ga0501080_0130539 3300049742 Bacteria 2326
508 Ga0501083_0084331 3300049744 Bacteria 2104
509 Ga0501035_0005273 3300049822 Bacteria 12234
510 Ga0501044_0003424 3300049823 Bacteria 17877
511 Ga0501044_0054262 3300049823 Bacteria 4121
512 Ga0501044_0167348 3300049823 Bacteria 2172
513 nmdc:mga03683_10381_c1 3300050489 Bacteria 1786
514 nmdc:mga03683_71716_c1 3300050489 Bacteria 1482
515 nmdc:mga03n38_115485_c1 3300050490 Bacteria 1313
516 nmdc:mga03n38_13130_c1 3300050490 Bacteria 3137
517 nmdc:mga03n38_132150_c1 3300050490 Bacteria 1238
518 nmdc:mga03n38_24033_c1 3300050490 Bacteria 2487
519 nmdc:mga03n38_26289_c1 3300050490 Bacteria 2402
520 nmdc:mga00v17_10074_c1 3300050491 Bacteria 5147
521 nmdc:mga00v17_10161_c1 3300050491 Bacteria 5129
522 nmdc:mga00v17_106975_c1 3300050491 Bacteria 1771
523 nmdc:mga00v17_122481_c1 3300050491 Bacteria 1657
524 nmdc:mga00v17_143849_c1 3300050491 Bacteria 1530
525 nmdc:mga00v17_67539_c1 3300050491 Bacteria 2209
526 nmdc:mga00v17_84702_c1 3300050491 Bacteria 1984
527 nmdc:mga07m45_22172_c1 3300050496 Bacteria 3466
528 nmdc:mga07m45_65109_c1 3300050496 Bacteria 2069
529 nmdc:mga07m45_73986_c1 3300050496 Bacteria 1940
530 nmdc:mga05p37_482669_c1 3300050507 Bacteria 1427
531 nmdc:mga0qj67_36195_c1 3300050509 Bacteria 3861
532 nmdc:mga06r32_184452_c1 3300050510 Bacteria 2073
533 nmdc:mga0sz30_24909_c1 3300050516 Bacteria 2445
534 nmdc:mga0sz30_5980_c1 3300050516 Bacteria 4491
535 Ga0495601_0024913 3300053077 Bacteria 3686
536 Ga0500610_0011751 3300053079 Bacteria 4003
537 Ga0500635_0019416 3300053080 Bacteria 2066
538 Ga0495655_0028472 3300053083 Bacteria 1335
539 Ga0500643_001688 3300053087 Bacteria 12280
540 Ga0500643_015367 3300053087 Bacteria 2629
541 Ga0500641_0131004 3300053096 Bacteria 1082
542 Ga0500642_0030768 3300053130 Bacteria 2237
543 Ga0500652_002358 3300053131 Bacteria 5683
544 Ga0500588_0019676 3300053146 Bacteria 1800
545 Ga0500627_0011243 3300053158 Bacteria 3296
546 Ga0500645_014213 3300053730 Bacteria 2539
547 Ga0466962_0036265 3300061719 Bacteria 2360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10136015 Ga0105237_101360153 261
2 3300050507 nmdc:mga05p37_482669_c1 nmdc:mga05p37_482669_c1_588_1409 273
3 3300048907 Ga0496104_0355548 Ga0496104_0355548_495_1319 274
4 3300025934 Ga0207686_10332664 Ga0207686_103326641 276
5 3300049581 Ga0501047_0306713 Ga0501047_0306713_374_1261 282
6 3300021384 Ga0213876_10001195 Ga0213876_1000119516 283
7 3300021388 Ga0213875_10057079 Ga0213875_100570793 283
8 3300037853 Ga0436364_1000162 Ga0436364_1000162_7141_8046 283
9 3300039437 Ga0436365_1083994 Ga0436365_1083994_47016_47921 283
10 iso_pu_bacteria 2547132424 2548695192 284
11 3300046472 Ga0495580_0068083 Ga0495580_0068083_1597_2466 289
12 3300047673 Ga0495593_0085235 Ga0495593_0085235_744_1613 289
13 3300050490 nmdc:mga03n38_26289_c1 nmdc:mga03n38_26289_c1_1516_2388 290
14 iso_pu_bacteria 2919713450 2919719918 290
15 3300013105 Ga0157369_10480499 Ga0157369_104804991 292
16 3300049581 Ga0501047_0027835 Ga0501047_0027835_151_1104 292
17 3300049585 Ga0501069_0009619 Ga0501069_0009619_86_1039 292
18 3300053130 Ga0500642_0030768 Ga0500642_0030768_353_1306 292
19 3300061719 Ga0466962_0036265 Ga0466962_0036265_1051_2049 293
20 iso_pu_bacteria 2795385470 2795785759 295
21 3300005329 Ga0070683_100174455 Ga0070683_1001744552 296
22 3300005435 Ga0070714_100272896 Ga0070714_1002728961 296
23 3300006051 Ga0075364_10010657 Ga0075364_100106572 296
24 3300006186 Ga0075369_10002841 Ga0075369_100028414 296
25 3300025929 Ga0207664_10290083 Ga0207664_102900832 296
26 3300025944 Ga0207661_10286914 Ga0207661_102869142 296
27 3300048921 Ga0496118_0006562 Ga0496118_0006562_10697_11671 296
28 3300049569 Ga0501032_0001468 Ga0501032_0001468_9307_10314 296
29 3300049571 Ga0501034_0064315 Ga0501034_0064315_1035_2042 296
30 3300049573 Ga0501037_0002236 Ga0501037_0002236_166_1173 296
31 3300049579 Ga0501043_0015522 Ga0501043_0015522_4490_5497 296
32 3300049580 Ga0501046_0001102 Ga0501046_0001102_1055_2062 296
33 3300049582 Ga0501048_0013803 Ga0501048_0013803_644_1651 296
34 3300049586 Ga0501070_0002146 Ga0501070_0002146_1055_2062 296
35 3300049744 Ga0501083_0084331 Ga0501083_0084331_133_1140 296
36 3300050491 nmdc:mga00v17_10161_c1 nmdc:mga00v17_10161_c1_194_1165 296
37 3300053096 Ga0500641_0131004 Ga0500641_0131004_23_913 296
38 3300044656 Ga0466969_0058709 Ga0466969_0058709_685_1641 297
39 3300044842 Ga0466957_0022925 Ga0466957_0022925_764_1720 297
40 3300048903 Ga0496100_0127768 Ga0496100_0127768_156_1049 297
41 3300048905 Ga0496102_0045940 Ga0496102_0045940_2086_2979 297
42 3300048906 Ga0496103_0081341 Ga0496103_0081341_373_1266 297
43 3300048909 Ga0496106_0035299 Ga0496106_0035299_1216_2109 297
44 3300048917 Ga0496114_0337089 Ga0496114_0337089_162_1055 297
45 3300046660 Ga0495625_0330220 Ga0495625_0330220_49_945 298
46 3300048913 Ga0496110_0038494 Ga0496110_0038494_469_1365 298
47 3300048916 Ga0496113_0029324 Ga0496113_0029324_1439_2335 298
48 3300050491 nmdc:mga00v17_10074_c1 nmdc:mga00v17_10074_c1_2563_3459 298
49 3300048918 Ga0496115_0008702 Ga0496115_0008702_4290_5189 299
50 iso_pu_bacteria 2547132424 2548698698 300
51 iso_pu_bacteria 2738543034 2739364603 300
52 iso_pu_bacteria 2919713450 2919719374 300
53 3300044684 Ga0466966_0017367 Ga0466966_0017367_646_1602 301
54 3300044693 Ga0466961_0009890 Ga0466961_0009890_1377_2333 301
55 3300044719 Ga0466971_0005246 Ga0466971_0005246_1262_2218 301
56 3300045049 Ga0466959_0068215 Ga0466959_0068215_231_1187 301
57 iso_pu_bacteria 2915358134 2915362349 301
58 iso_pu_bacteria 8054472261 8054475722 301
59 3300006048 Ga0075363_100021909 Ga0075363_1000219094 302
60 3300006051 Ga0075364_10019287 Ga0075364_100192872 302
61 3300006051 Ga0075364_10084707 Ga0075364_100847072 302
62 3300050491 nmdc:mga00v17_122481_c1 nmdc:mga00v17_122481_c1_475_1404 302
63 3300050491 nmdc:mga00v17_143849_c1 nmdc:mga00v17_143849_c1_139_1068 302
64 3300050496 nmdc:mga07m45_73986_c1 nmdc:mga07m45_73986_c1_139_1068 302
65 iso_pu_bacteria 2738543005 2739203920 302
66 iso_pu_bacteria 2928142448 2928145650 302
67 iso_pu_bacteria 2738543011 2739238573 303
68 iso_pu_bacteria 2889300758 2889303007 303
69 iso_pu_bacteria 2939743619 2939746115 303
70 3300031251 Ga0265327_10000329 Ga0265327_1000032957 304
71 3300041512 Ga0451853_0574377 Ga0451853_0574377_1040_1957 304
72 iso_pu_bacteria 2643221692 2644513692 304
73 iso_pu_bacteria 2904765812 2904767307 304
74 iso_pu_bacteria 2904770941 2904774592 304
75 iso_pu_bacteria 2908811453 2908812959 304
76 iso_pu_bacteria 2919420072 2919424071 304
77 iso_pu_bacteria 2919432681 2919436477 304
78 iso_pu_bacteria 2956939328 2956941306 304
79 iso_pu_bacteria 3001119090 3001120266 304
80 3300005355 Ga0070671_100003983 Ga0070671_10000398312 305
81 3300005548 Ga0070665_100001778 Ga0070665_1000017785 305
82 3300005841 Ga0068863_100043788 Ga0068863_1000437883 305
83 3300005843 Ga0068860_100033740 Ga0068860_1000337405 305
84 3300014968 Ga0157379_10143634 Ga0157379_101436343 305
85 3300025931 Ga0207644_10002584 Ga0207644_100025845 305
86 3300025972 Ga0207668_10044124 Ga0207668_100441243 305
87 3300026088 Ga0207641_10013676 Ga0207641_100136766 305
88 3300026088 Ga0207641_10032803 Ga0207641_100328035 305
89 3300028379 Ga0268266_10002138 Ga0268266_1000213820 305
90 3300044658 Ga0466972_0008927 Ga0466972_0008927_3691_4644 305
91 3300044683 Ga0466965_0001842 Ga0466965_0001842_322_1275 305
92 3300044901 Ga0466960_0002071 Ga0466960_0002071_4645_5598 305
93 3300048903 Ga0496100_0002834 Ga0496100_0002834_5408_6361 305
94 3300048904 Ga0496101_0038291 Ga0496101_0038291_2353_3306 305
95 3300048905 Ga0496102_0000015 Ga0496102_0000015_234787_235740 305
96 3300048906 Ga0496103_0000160 Ga0496103_0000160_1367_2320 305
97 3300048908 Ga0496105_0077752 Ga0496105_0077752_508_1461 305
98 3300048910 Ga0496107_0028295 Ga0496107_0028295_287_1240 305
99 3300048919 Ga0496116_0000178 Ga0496116_0000178_68773_69726 305
100 3300048920 Ga0496117_0000047 Ga0496117_0000047_68783_69736 305
101 3300048921 Ga0496118_0000050 Ga0496118_0000050_173813_174766 305
102 3300048922 Ga0496119_0002385 Ga0496119_0002385_4807_5760 305
103 3300048924 Ga0496121_0012441 Ga0496121_0012441_2637_3590 305
104 3300048925 Ga0496122_0102067 Ga0496122_0102067_597_1550 305
105 3300048927 Ga0496124_0002610 Ga0496124_0002610_8808_9761 305
106 3300048928 Ga0496125_0014400 Ga0496125_0014400_6482_7435 305
107 3300048929 Ga0496126_0000049 Ga0496126_0000049_247467_248420 305
108 iso_pu_bacteria 2738541274 2738706526 305
109 iso_pu_bacteria 2738543028 2739333145 305
110 iso_pu_bacteria 2738543034 2739366149 305
111 iso_pu_bacteria 2902799365 2902799936 305
112 iso_pu_bacteria 2974315732 2974318217 305
113 iso_pu_bacteria 2984523437 2984526429 305
114 3300009148 Ga0105243_10000243 Ga0105243_100002435 306
115 3300025935 Ga0207709_10002717 Ga0207709_100027175 306
116 3300045976 Ga0466967_0132898 Ga0466967_0132898_1064_1987 306
117 3300046531 Ga0495665_0058517 Ga0495665_0058517_1078_2004 306
118 3300047315 Ga0495581_0053737 Ga0495581_0053737_924_1850 306
119 3300048903 Ga0496100_0000231 Ga0496100_0000231_3006_3929 306
120 3300048904 Ga0496101_0000042 Ga0496101_0000042_82650_83573 306
121 3300048905 Ga0496102_0035984 Ga0496102_0035984_2340_3263 306
122 3300048905 Ga0496102_0328547 Ga0496102_0328547_118_1041 306
123 3300048906 Ga0496103_0000637 Ga0496103_0000637_8863_9786 306
124 3300048906 Ga0496103_0289120 Ga0496103_0289120_41_964 306
125 3300048909 Ga0496106_0000103 Ga0496106_0000103_5554_6477 306
126 3300048912 Ga0496109_0000312 Ga0496109_0000312_9325_10248 306
127 3300048913 Ga0496110_0001276 Ga0496110_0001276_6904_7827 306
128 3300048914 Ga0496111_0047998 Ga0496111_0047998_717_1640 306
129 3300048917 Ga0496114_0000344 Ga0496114_0000344_31002_31925 306
130 3300048918 Ga0496115_0004402 Ga0496115_0004402_8287_9210 306
131 3300048919 Ga0496116_0007231 Ga0496116_0007231_7331_8254 306
132 3300048919 Ga0496116_0165334 Ga0496116_0165334_69_992 306
133 3300048920 Ga0496117_0047002 Ga0496117_0047002_257_1180 306
134 3300048920 Ga0496117_0122284 Ga0496117_0122284_257_1180 306
135 3300048921 Ga0496118_0132038 Ga0496118_0132038_257_1180 306
136 3300048921 Ga0496118_0132050 Ga0496118_0132050_422_1345 306
137 3300048922 Ga0496119_0009657 Ga0496119_0009657_6879_7802 306
138 3300048922 Ga0496119_0110867 Ga0496119_0110867_422_1345 306
139 3300048924 Ga0496121_0000139 Ga0496121_0000139_82650_83573 306
140 3300048925 Ga0496122_0000149 Ga0496122_0000149_82878_83801 306
141 3300048926 Ga0496123_0002050 Ga0496123_0002050_14681_15604 306
142 3300048927 Ga0496124_0000114 Ga0496124_0000114_84689_85612 306
143 3300048928 Ga0496125_0000130 Ga0496125_0000130_82650_83573 306
144 3300048929 Ga0496126_0000149 Ga0496126_0000149_79604_80527 306
145 3300050490 nmdc:mga03n38_24033_c1 nmdc:mga03n38_24033_c1_306_1238 306
146 3300050491 nmdc:mga00v17_106975_c1 nmdc:mga00v17_106975_c1_272_1204 306
147 iso_pu_bacteria 2565956761 2566997351 306
148 iso_pu_bacteria 2738541308 2738888090 306
149 iso_pu_bacteria 2904535858 2904538280 306
150 iso_pu_bacteria 2922554459 2922557472 306
151 3300005367 Ga0070667_100007680 Ga0070667_1000076802 307
152 3300025986 Ga0207658_10010262 Ga0207658_100102622 307
153 3300041453 Ga0451797_0877360 Ga0451797_0877360_1014_1952 307
154 3300006048 Ga0075363_100150674 Ga0075363_1001506741 308
155 3300031251 Ga0265327_10013354 Ga0265327_100133545 308
156 3300046501 Ga0495607_0023852 Ga0495607_0023852_2371_3318 308
157 3300047323 Ga0495683_0000800 Ga0495683_0000800_5200_6147 308
158 3300050490 nmdc:mga03n38_115485_c1 nmdc:mga03n38_115485_c1_181_1119 308
159 3300050496 nmdc:mga07m45_65109_c1 nmdc:mga07m45_65109_c1_617_1555 308
160 iso_pu_bacteria 2551306166 2552110356 308
161 iso_pu_bacteria 2738541264 2738669146 308
162 iso_pu_bacteria 2738541356 2739147683 308
163 iso_pu_bacteria 2939582691 2939584315 308
164 3300044683 Ga0466965_0018951 Ga0466965_0018951_2310_3242 309
165 3300046460 Ga0495638_0005845 Ga0495638_0005845_4693_5631 310
166 3300046616 Ga0495668_0002057 Ga0495668_0002057_8831_9772 310
167 3300048928 Ga0496125_0019355 Ga0496125_0019355_3292_4233 310
168 3300048929 Ga0496126_0160608 Ga0496126_0160608_748_1686 310
169 3300050490 nmdc:mga03n38_132150_c1 nmdc:mga03n38_132150_c1_103_1044 310
170 3300053080 Ga0500635_0019416 Ga0500635_0019416_328_1266 310
171 3300053087 Ga0500643_015367 Ga0500643_015367_673_1611 310
172 3300053131 Ga0500652_002358 Ga0500652_002358_2142_3080 310
173 3300053146 Ga0500588_0019676 Ga0500588_0019676_658_1596 310
174 3300053158 Ga0500627_0011243 Ga0500627_0011243_1821_2759 310
175 3300053730 Ga0500645_014213 Ga0500645_014213_1349_2287 310
176 3300021384 Ga0213876_10010296 Ga0213876_100102963 311
177 3300021388 Ga0213875_10038669 Ga0213875_100386693 311
178 3300037853 Ga0436364_1391144 Ga0436364_1391144_541_1518 311
179 3300039437 Ga0436365_0250021 Ga0436365_0250021_1626_2570 311
180 3300039437 Ga0436365_0892314 Ga0436365_0892314_13773_14759 311
181 3300048910 Ga0496107_0024873 Ga0496107_0024873_57_1004 311
182 3300049569 Ga0501032_0040412 Ga0501032_0040412_1916_2857 311
183 3300049571 Ga0501034_0001443 Ga0501034_0001443_18603_19544 311
184 3300049572 Ga0501036_0032238 Ga0501036_0032238_1239_2180 311
185 3300049573 Ga0501037_0000338 Ga0501037_0000338_7227_8168 311
186 3300049574 Ga0501038_0020484 Ga0501038_0020484_3418_4359 311
187 3300049579 Ga0501043_0000159 Ga0501043_0000159_59230_60171 311
188 3300049583 Ga0501067_0051246 Ga0501067_0051246_56_997 311
189 3300049584 Ga0501068_0031779 Ga0501068_0031779_220_1161 311
190 3300049586 Ga0501070_0005100 Ga0501070_0005100_541_1482 311
191 3300049589 Ga0501073_0078371 Ga0501073_0078371_1337_2278 311
192 3300049823 Ga0501044_0054262 Ga0501044_0054262_229_1170 311
193 iso_pu_bacteria 2643221687 2644491006 311
194 iso_pu_bacteria 2902792274 2902799015 311
195 iso_pu_bacteria 2902837492 2902843847 311
196 3300003792 Ga0055540_1000068 Ga0055540_1000068101 312
197 3300005335 Ga0070666_10046623 Ga0070666_100466233 312
198 3300005367 Ga0070667_100008481 Ga0070667_1000084819 312
199 3300009148 Ga0105243_10402379 Ga0105243_104023792 312
200 3300009545 Ga0105237_10061680 Ga0105237_100616802 312
201 3300025303 Ga0209051_1000057 Ga0209051_1000057101 312
202 3300025903 Ga0207680_10034522 Ga0207680_100345222 312
203 3300025914 Ga0207671_10034677 Ga0207671_100346772 312
204 3300025986 Ga0207658_10000525 Ga0207658_100005255 312
205 3300031251 Ga0265327_10000336 Ga0265327_1000033685 312
206 3300042005 Ga0439448_0027744 Ga0439448_0027744_733_1674 312
207 3300044658 Ga0466972_0043009 Ga0466972_0043009_661_1602 312
208 3300044683 Ga0466965_0002625 Ga0466965_0002625_6283_7224 312
209 3300044735 Ga0466968_0000854 Ga0466968_0000854_4020_4961 312
210 3300044765 Ga0466970_0029117 Ga0466970_0029117_1073_2014 312
211 3300044842 Ga0466957_0031861 Ga0466957_0031861_945_1886 312
212 3300045049 Ga0466959_0006862 Ga0466959_0006862_746_1687 312
213 3300045976 Ga0466967_0070930 Ga0466967_0070930_1440_2381 312
214 3300048904 Ga0496101_0033713 Ga0496101_0033713_594_1535 312
215 3300048915 Ga0496112_0022814 Ga0496112_0022814_361_1302 312
216 3300048916 Ga0496113_0070426 Ga0496113_0070426_205_1146 312
217 3300048925 Ga0496122_0059268 Ga0496122_0059268_33_974 312
218 3300048926 Ga0496123_0042180 Ga0496123_0042180_1853_2794 312
219 3300048929 Ga0496126_0018794 Ga0496126_0018794_4184_5125 312
220 3300005435 Ga0070714_100107689 Ga0070714_1001076892 313
221 3300009101 Ga0105247_10080855 Ga0105247_100808553 313
222 3300021384 Ga0213876_10020099 Ga0213876_100200993 313
223 3300021388 Ga0213875_10015626 Ga0213875_100156263 313
224 3300025900 Ga0207710_10079938 Ga0207710_100799382 313
225 3300025929 Ga0207664_10123684 Ga0207664_101236843 313
226 3300031903 Ga0307407_10235112 Ga0307407_102351122 313
227 3300032002 Ga0307416_100542478 Ga0307416_1005424782 313
228 3300037853 Ga0436364_0177961 Ga0436364_0177961_11387_12343 313
229 3300039437 Ga0436365_0256841 Ga0436365_0256841_2234_3190 313
230 3300044656 Ga0466969_0028146 Ga0466969_0028146_1617_2582 313
231 3300044694 Ga0466963_0173639 Ga0466963_0173639_19_984 313
232 3300045049 Ga0466959_0025377 Ga0466959_0025377_1825_2790 313
233 3300048904 Ga0496101_0033783 Ga0496101_0033783_28_972 313
234 3300048905 Ga0496102_0115278 Ga0496102_0115278_442_1386 313
235 3300048907 Ga0496104_0064135 Ga0496104_0064135_291_1235 313
236 3300048908 Ga0496105_0189193 Ga0496105_0189193_138_1082 313
237 3300048910 Ga0496107_0098928 Ga0496107_0098928_301_1245 313
238 3300048917 Ga0496114_0060100 Ga0496114_0060100_259_1203 313
239 3300049569 Ga0501032_0026668 Ga0501032_0026668_308_1291 313
240 3300049571 Ga0501034_0058916 Ga0501034_0058916_110_1093 313
241 3300049822 Ga0501035_0005273 Ga0501035_0005273_10054_11037 313
242 3300049823 Ga0501044_0003424 Ga0501044_0003424_4077_5060 313
243 3300005328 Ga0070676_10222760 Ga0070676_102227601 314
244 3300005334 Ga0068869_100086429 Ga0068869_1000864293 314
245 3300005337 Ga0070682_100130961 Ga0070682_1001309611 314
246 3300005436 Ga0070713_100076008 Ga0070713_1000760083 314
247 3300005439 Ga0070711_100122928 Ga0070711_1001229282 314
248 3300005444 Ga0070694_100096207 Ga0070694_1000962072 314
249 3300005455 Ga0070663_100374177 Ga0070663_1003741771 314
250 3300005456 Ga0070678_100041683 Ga0070678_1000416833 314
251 3300005457 Ga0070662_100157166 Ga0070662_1001571663 314
252 3300005539 Ga0068853_100015629 Ga0068853_1000156298 314
253 3300005546 Ga0070696_100030020 Ga0070696_1000300203 314
254 3300005547 Ga0070693_100170217 Ga0070693_1001702172 314
255 3300005578 Ga0068854_100032598 Ga0068854_1000325983 314
256 3300005615 Ga0070702_100045308 Ga0070702_1000453081 314
257 3300005617 Ga0068859_100195749 Ga0068859_1001957492 314
258 3300005844 Ga0068862_100474187 Ga0068862_1004741871 314
259 3300006048 Ga0075363_100006493 Ga0075363_1000064932 314
260 3300006163 Ga0070715_10076602 Ga0070715_100766022 314
261 3300006173 Ga0070716_100027412 Ga0070716_1000274123 314
262 3300006175 Ga0070712_100037254 Ga0070712_1000372543 314
263 3300006353 Ga0075370_10007840 Ga0075370_100078407 314
264 3300006353 Ga0075370_10034907 Ga0075370_100349072 314
265 3300006881 Ga0068865_100053708 Ga0068865_1000537082 314
266 3300006931 Ga0097620_100195751 Ga0097620_1001957512 314
267 3300009094 Ga0111539_10703562 Ga0111539_107035622 314
268 3300009098 Ga0105245_10136248 Ga0105245_101362483 314
269 3300009177 Ga0105248_10343228 Ga0105248_103432282 314
270 3300009553 Ga0105249_10158180 Ga0105249_101581803 314
271 3300010159 Ga0099796_10024061 Ga0099796_100240613 314
272 3300010375 Ga0105239_10687768 Ga0105239_106877681 314
273 3300013296 Ga0157374_10107569 Ga0157374_101075692 314
274 3300014745 Ga0157377_10165741 Ga0157377_101657411 314
275 3300025898 Ga0207692_10017059 Ga0207692_100170593 314
276 3300025905 Ga0207685_10134136 Ga0207685_101341361 314
277 3300025915 Ga0207693_10016517 Ga0207693_100165173 314
278 3300025916 Ga0207663_10066359 Ga0207663_100663592 314
279 3300025919 Ga0207657_10122033 Ga0207657_101220332 314
280 3300025928 Ga0207700_10327878 Ga0207700_103278782 314
281 3300025935 Ga0207709_10221976 Ga0207709_102219762 314
282 3300025936 Ga0207670_10067446 Ga0207670_100674463 314
283 3300025937 Ga0207669_10063173 Ga0207669_100631733 314
284 3300025939 Ga0207665_10005883 Ga0207665_100058833 314
285 3300025942 Ga0207689_10081951 Ga0207689_100819512 314
286 3300025961 Ga0207712_10058630 Ga0207712_100586302 314
287 3300025972 Ga0207668_10159648 Ga0207668_101596483 314
288 3300025986 Ga0207658_10184745 Ga0207658_101847453 314
289 3300026067 Ga0207678_10272795 Ga0207678_102727952 314
290 3300026075 Ga0207708_10048533 Ga0207708_100485334 314
291 3300026089 Ga0207648_10114095 Ga0207648_101140954 314
292 3300026121 Ga0207683_10314131 Ga0207683_103141312 314
293 3300028380 Ga0268265_10152250 Ga0268265_101522503 314
294 3300039437 Ga0436365_0775855 Ga0436365_0775855_15041_16042 314
295 3300044683 Ga0466965_0008108 Ga0466965_0008108_3640_4596 314
296 3300044901 Ga0466960_0000233 Ga0466960_0000233_5470_6426 314
297 3300048903 Ga0496100_0001330 Ga0496100_0001330_2162_3109 314
298 3300048904 Ga0496101_0000090 Ga0496101_0000090_89328_90275 314
299 3300048904 Ga0496101_0336695 Ga0496101_0336695_147_1091 314
300 3300048905 Ga0496102_0000016 Ga0496102_0000016_44915_45862 314
301 3300048906 Ga0496103_0000015 Ga0496103_0000015_240913_241860 314
302 3300048907 Ga0496104_0017452 Ga0496104_0017452_5542_6486 314
303 3300048909 Ga0496106_0053778 Ga0496106_0053778_270_1217 314
304 3300048911 Ga0496108_0000230 Ga0496108_0000230_16760_17704 314
305 3300048912 Ga0496109_0001308 Ga0496109_0001308_7693_8637 314
306 3300048914 Ga0496111_0044502 Ga0496111_0044502_1712_2656 314
307 3300048915 Ga0496112_0493431 Ga0496112_0493431_65_1009 314
308 3300048916 Ga0496113_0035993 Ga0496113_0035993_1689_2633 314
309 3300048919 Ga0496116_0000055 Ga0496116_0000055_241100_242047 314
310 3300048920 Ga0496117_0000006 Ga0496117_0000006_516548_517495 314
311 3300048921 Ga0496118_0000004 Ga0496118_0000004_516548_517495 314
312 3300048922 Ga0496119_0057722 Ga0496119_0057722_881_1828 314
313 3300048924 Ga0496121_0000258 Ga0496121_0000258_89377_90324 314
314 3300048929 Ga0496126_0000350 Ga0496126_0000350_84681_85628 314
315 3300049571 Ga0501034_0379504 Ga0501034_0379504_36_992 314
316 3300049823 Ga0501044_0167348 Ga0501044_0167348_640_1629 314
317 3300050496 nmdc:mga07m45_22172_c1 nmdc:mga07m45_22172_c1_590_1540 314
318 3300003792 Ga0055540_1004203 Ga0055540_10042035 315
319 3300003792 Ga0055540_1009799 Ga0055540_10097993 315
320 3300005328 Ga0070676_10009225 Ga0070676_100092251 315
321 3300005329 Ga0070683_100687102 Ga0070683_1006871021 315
322 3300005337 Ga0070682_100021115 Ga0070682_1000211152 315
323 3300005347 Ga0070668_100379395 Ga0070668_1003793952 315
324 3300005563 Ga0068855_100103152 Ga0068855_1001031522 315
325 3300005616 Ga0068852_100189414 Ga0068852_1001894143 315
326 3300005841 Ga0068863_100135682 Ga0068863_1001356822 315
327 3300006048 Ga0075363_100002133 Ga0075363_1000021338 315
328 3300006051 Ga0075364_10017802 Ga0075364_100178023 315
329 3300006051 Ga0075364_10042904 Ga0075364_100429044 315
330 3300006173 Ga0070716_100110301 Ga0070716_1001103012 315
331 3300009177 Ga0105248_10053727 Ga0105248_100537272 315
332 3300009545 Ga0105237_10014312 Ga0105237_100143123 315
333 3300009551 Ga0105238_10338527 Ga0105238_103385271 315
334 3300010375 Ga0105239_10028306 Ga0105239_100283062 315
335 3300013308 Ga0157375_10429952 Ga0157375_104299522 315
336 3300025273 Ga0209673_1015235 Ga0209673_10152352 315
337 3300025273 Ga0209673_1039943 Ga0209673_10399432 315
338 3300025303 Ga0209051_1000840 Ga0209051_10008403 315
339 3300025303 Ga0209051_1002003 Ga0209051_10020033 315
340 3300025303 Ga0209051_1003913 Ga0209051_10039136 315
341 3300025914 Ga0207671_10036796 Ga0207671_100367963 315
342 3300025916 Ga0207663_10150278 Ga0207663_101502782 315
343 3300025924 Ga0207694_10114079 Ga0207694_101140793 315
344 3300025939 Ga0207665_10216183 Ga0207665_102161832 315
345 3300025972 Ga0207668_10000510 Ga0207668_1000051026 315
346 3300026023 Ga0207677_10206583 Ga0207677_102065832 315
347 3300026067 Ga0207678_10012182 Ga0207678_100121826 315
348 3300026088 Ga0207641_10082288 Ga0207641_100822882 315
349 3300026118 Ga0207675_100104241 Ga0207675_1001042412 315
350 3300041410 Ga0439461_0007265 Ga0439461_0007265_570_1541 315
351 3300041410 Ga0439461_0013367 Ga0439461_0013367_62_1009 315
352 3300041411 Ga0439466_0001397 Ga0439466_0001397_2889_3860 315
353 3300041413 Ga0439465_0009228 Ga0439465_0009228_1956_2927 315
354 3300041997 Ga0439431_0003646 Ga0439431_0003646_1615_2586 315
355 3300042004 Ga0439445_0001555 Ga0439445_0001555_864_1835 315
356 3300042435 Ga0439434_0008779 Ga0439434_0008779_1178_2149 315
357 3300044684 Ga0466966_0014743 Ga0466966_0014743_4083_5066 315
358 3300044693 Ga0466961_0040929 Ga0466961_0040929_374_1357 315
359 3300044694 Ga0466963_0041444 Ga0466963_0041444_178_1185 315
360 3300044735 Ga0466968_0004297 Ga0466968_0004297_3795_4778 315
361 3300044842 Ga0466957_0054320 Ga0466957_0054320_241_1224 315
362 3300044842 Ga0466957_0093233 Ga0466957_0093233_301_1248 315
363 3300044901 Ga0466960_0005499 Ga0466960_0005499_3996_5003 315
364 3300045836 Ga0466958_0097220 Ga0466958_0097220_513_1520 315
365 3300045976 Ga0466967_0000930 Ga0466967_0000930_6984_7991 315
366 3300045976 Ga0466967_0331599 Ga0466967_0331599_187_1134 315
367 3300046455 Ga0495603_0026909 Ga0495603_0026909_410_1357 315
368 3300046459 Ga0495629_0011420 Ga0495629_0011420_448_1395 315
369 3300046460 Ga0495638_0003286 Ga0495638_0003286_11005_11955 315
370 3300046461 Ga0495641_0020109 Ga0495641_0020109_661_1608 315
371 3300046476 Ga0495662_0021019 Ga0495662_0021019_1950_2897 315
372 3300046524 Ga0495648_0031144 Ga0495648_0031144_1620_2570 315
373 3300046530 Ga0495654_0049730 Ga0495654_0049730_425_1375 315
374 3300046533 Ga0495640_0024630 Ga0495640_0024630_69_1016 315
375 3300046616 Ga0495668_0061647 Ga0495668_0061647_298_1248 315
376 3300046648 Ga0495611_0026189 Ga0495611_0026189_931_1881 315
377 3300046692 Ga0495671_0068502 Ga0495671_0068502_715_1665 315
378 3300047320 Ga0495672_0004317 Ga0495672_0004317_8227_9177 315
379 3300047469 Ga0495673_0000909 Ga0495673_0000909_23952_24902 315
380 3300048903 Ga0496100_0003824 Ga0496100_0003824_294_1244 315
381 3300048904 Ga0496101_0010145 Ga0496101_0010145_320_1270 315
382 3300048908 Ga0496105_0006706 Ga0496105_0006706_4543_5493 315
383 3300048909 Ga0496106_0004113 Ga0496106_0004113_7020_7970 315
384 3300048910 Ga0496107_0010318 Ga0496107_0010318_4246_5196 315
385 3300048911 Ga0496108_0029159 Ga0496108_0029159_1856_2818 315
386 3300048912 Ga0496109_0077645 Ga0496109_0077645_97_1044 315
387 3300048912 Ga0496109_0296618 Ga0496109_0296618_266_1228 315
388 3300048913 Ga0496110_0319086 Ga0496110_0319086_239_1201 315
389 3300048915 Ga0496112_0078088 Ga0496112_0078088_1468_2415 315
390 3300048915 Ga0496112_0295998 Ga0496112_0295998_376_1323 315
391 3300048916 Ga0496113_0108495 Ga0496113_0108495_665_1612 315
392 3300048917 Ga0496114_0000741 Ga0496114_0000741_6693_7643 315
393 3300048917 Ga0496114_0313064 Ga0496114_0313064_258_1205 315
394 3300048917 Ga0496114_0341395 Ga0496114_0341395_319_1281 315
395 3300048918 Ga0496115_0003291 Ga0496115_0003291_4193_5143 315
396 3300048929 Ga0496126_0006663 Ga0496126_0006663_5590_6585 315
397 3300049571 Ga0501034_0133583 Ga0501034_0133583_655_1602 315
398 3300049586 Ga0501070_0297436 Ga0501070_0297436_53_1012 315
399 3300049742 Ga0501080_0130539 Ga0501080_0130539_178_1137 315
400 3300050491 nmdc:mga00v17_67539_c1 nmdc:mga00v17_67539_c1_684_1670 315
401 3300050491 nmdc:mga00v17_84702_c1 nmdc:mga00v17_84702_c1_505_1455 315
402 3300053077 Ga0495601_0024913 Ga0495601_0024913_69_1016 315
403 3300053079 Ga0500610_0011751 Ga0500610_0011751_243_1193 315
404 3300053083 Ga0495655_0028472 Ga0495655_0028472_91_1038 315
405 3300053087 Ga0500643_001688 Ga0500643_001688_747_1697 315
406 iso_pu_bacteria 2643221715 2644634427 315
407 iso_pu_bacteria 2842134933 2842138867 315
408 iso_pu_bacteria 2902810491 2902816851 315
409 iso_pu_bacteria 2929212328 2929217087 315
410 3300002074 JGI24748J21848_1003218 JGI24748J21848_10032182 316
411 3300002077 JGI24744J21845_10005795 JGI24744J21845_100057955 316
412 3300002077 JGI24744J21845_10010307 JGI24744J21845_100103073 316
413 3300002244 JGI24742J22300_10012964 JGI24742J22300_100129642 316
414 3300005330 Ga0070690_100123284 Ga0070690_1001232842 316
415 3300005334 Ga0068869_100042289 Ga0068869_1000422893 316
416 3300005335 Ga0070666_10014663 Ga0070666_100146636 316
417 3300005347 Ga0070668_100000366 Ga0070668_1000003668 316
418 3300005353 Ga0070669_100001667 Ga0070669_1000016679 316
419 3300005355 Ga0070671_100005370 Ga0070671_10000537012 316
420 3300005355 Ga0070671_100021745 Ga0070671_1000217454 316
421 3300005356 Ga0070674_100000805 Ga0070674_10000080513 316
422 3300005365 Ga0070688_100136561 Ga0070688_1001365612 316
423 3300005367 Ga0070667_100000109 Ga0070667_100000109108 316
424 3300005367 Ga0070667_100007796 Ga0070667_1000077967 316
425 3300005367 Ga0070667_100034730 Ga0070667_1000347303 316
426 3300005367 Ga0070667_100062528 Ga0070667_1000625282 316
427 3300005439 Ga0070711_100055837 Ga0070711_1000558372 316
428 3300005440 Ga0070705_100019559 Ga0070705_1000195593 316
429 3300005441 Ga0070700_100049172 Ga0070700_1000491722 316
430 3300005456 Ga0070678_100002537 Ga0070678_1000025373 316
431 3300005457 Ga0070662_100006133 Ga0070662_1000061335 316
432 3300005459 Ga0068867_100091221 Ga0068867_1000912213 316
433 3300005466 Ga0070685_10096735 Ga0070685_100967352 316
434 3300005539 Ga0068853_100015864 Ga0068853_1000158649 316
435 3300005539 Ga0068853_100034882 Ga0068853_1000348823 316
436 3300005543 Ga0070672_100202381 Ga0070672_1002023811 316
437 3300005545 Ga0070695_100011805 Ga0070695_1000118053 316
438 3300005546 Ga0070696_100038167 Ga0070696_1000381673 316
439 3300005548 Ga0070665_100011482 Ga0070665_10001148210 316
440 3300005549 Ga0070704_100004972 Ga0070704_1000049725 316
441 3300005578 Ga0068854_100004474 Ga0068854_1000044744 316
442 3300005615 Ga0070702_100012084 Ga0070702_1000120843 316
443 3300005616 Ga0068852_100065428 Ga0068852_1000654283 316
444 3300005617 Ga0068859_100005634 Ga0068859_10000563410 316
445 3300005617 Ga0068859_100015931 Ga0068859_1000159314 316
446 3300005718 Ga0068866_10000999 Ga0068866_1000099913 316
447 3300005719 Ga0068861_100063513 Ga0068861_1000635132 316
448 3300005841 Ga0068863_100000123 Ga0068863_1000001232 316
449 3300005841 Ga0068863_100004187 Ga0068863_10000418710 316
450 3300005841 Ga0068863_100050174 Ga0068863_1000501744 316
451 3300005842 Ga0068858_100001382 Ga0068858_1000013824 316
452 3300005842 Ga0068858_100274755 Ga0068858_1002747552 316
453 3300005843 Ga0068860_100000175 Ga0068860_10000017511 316
454 3300005843 Ga0068860_100008172 Ga0068860_1000081724 316
455 3300005844 Ga0068862_100000091 Ga0068862_100000091111 316
456 3300005844 Ga0068862_100004256 Ga0068862_1000042564 316
457 3300005844 Ga0068862_100166999 Ga0068862_1001669992 316
458 3300005937 Ga0081455_10168844 Ga0081455_101688442 316
459 3300006038 Ga0075365_10014494 Ga0075365_100144946 316
460 3300006048 Ga0075363_100026444 Ga0075363_1000264443 316
461 3300006048 Ga0075363_100061206 Ga0075363_1000612061 316
462 3300006051 Ga0075364_10005916 Ga0075364_100059169 316
463 3300006173 Ga0070716_100016155 Ga0070716_1000161554 316
464 3300006175 Ga0070712_100001760 Ga0070712_10000176012 316
465 3300006186 Ga0075369_10002433 Ga0075369_100024332 316
466 3300006186 Ga0075369_10015052 Ga0075369_100150521 316
467 3300006353 Ga0075370_10000494 Ga0075370_1000049410 316
468 3300006844 Ga0075428_100015103 Ga0075428_1000151035 316
469 3300006846 Ga0075430_100035923 Ga0075430_1000359232 316
470 3300006847 Ga0075431_100127978 Ga0075431_1001279783 316
471 3300006881 Ga0068865_100003183 Ga0068865_1000031838 316
472 3300006931 Ga0097620_100005634 Ga0097620_10000563410 316
473 3300006931 Ga0097620_100015929 Ga0097620_1000159294 316
474 3300009098 Ga0105245_10004590 Ga0105245_100045909 316
475 3300009101 Ga0105247_10000070 Ga0105247_1000007010 316
476 3300009101 Ga0105247_10004456 Ga0105247_100044567 316
477 3300009147 Ga0114129_10038244 Ga0114129_100382443 316
478 3300009148 Ga0105243_10002033 Ga0105243_1000203316 316
479 3300009176 Ga0105242_10005082 Ga0105242_100050828 316
480 3300009177 Ga0105248_10000331 Ga0105248_1000033150 316
481 3300009545 Ga0105237_10054044 Ga0105237_100540444 316
482 3300009553 Ga0105249_10000020 Ga0105249_10000020255 316
483 3300009553 Ga0105249_10003076 Ga0105249_1000307612 316
484 3300009553 Ga0105249_10011266 Ga0105249_100112668 316
485 3300010375 Ga0105239_10037981 Ga0105239_100379814 316
486 3300010375 Ga0105239_10495034 Ga0105239_104950341 316
487 3300013102 Ga0157371_10182247 Ga0157371_101822472 316
488 3300013297 Ga0157378_10000959 Ga0157378_1000095925 316
489 3300013306 Ga0163162_10005660 Ga0163162_100056609 316
490 3300013308 Ga0157375_10081782 Ga0157375_100817823 316
491 3300014325 Ga0163163_10239146 Ga0163163_102391462 316
492 3300017792 Ga0163161_10007218 Ga0163161_100072185 316
493 3300025899 Ga0207642_10001701 Ga0207642_100017013 316
494 3300025900 Ga0207710_10000010 Ga0207710_10000010384 316
495 3300025900 Ga0207710_10001871 Ga0207710_100018717 316
496 3300025903 Ga0207680_10093470 Ga0207680_100934702 316
497 3300025905 Ga0207685_10015987 Ga0207685_100159873 316
498 3300025907 Ga0207645_10008512 Ga0207645_100085125 316
499 3300025911 Ga0207654_10203199 Ga0207654_102031992 316
500 3300025912 Ga0207707_10201820 Ga0207707_102018202 316
501 3300025916 Ga0207663_10006686 Ga0207663_100066865 316
502 3300025921 Ga0207652_10290566 Ga0207652_102905662 316
503 3300025923 Ga0207681_10001388 Ga0207681_1000138812 316
504 3300025927 Ga0207687_10003067 Ga0207687_100030674 316
505 3300025931 Ga0207644_10050115 Ga0207644_100501153 316
506 3300025933 Ga0207706_10005802 Ga0207706_100058025 316
507 3300025934 Ga0207686_10007952 Ga0207686_100079524 316
508 3300025935 Ga0207709_10004811 Ga0207709_100048113 316
509 3300025936 Ga0207670_10036704 Ga0207670_100367042 316
510 3300025937 Ga0207669_10000728 Ga0207669_100007289 316
511 3300025938 Ga0207704_10001117 Ga0207704_100011178 316
512 3300025939 Ga0207665_10003168 Ga0207665_100031689 316
513 3300025940 Ga0207691_10168999 Ga0207691_101689992 316
514 3300025941 Ga0207711_10002791 Ga0207711_100027919 316
515 3300025942 Ga0207689_10023196 Ga0207689_100231964 316
516 3300025961 Ga0207712_10000010 Ga0207712_1000001010 316
517 3300025961 Ga0207712_10002366 Ga0207712_100023668 316
518 3300025961 Ga0207712_10018563 Ga0207712_100185634 316
519 3300025972 Ga0207668_10002330 Ga0207668_100023302 316
520 3300025972 Ga0207668_10030976 Ga0207668_100309762 316
521 3300025981 Ga0207640_10014372 Ga0207640_100143723 316
522 3300025986 Ga0207658_10004155 Ga0207658_100041554 316
523 3300025986 Ga0207658_10011382 Ga0207658_100113827 316
524 3300025986 Ga0207658_10036660 Ga0207658_100366603 316
525 3300025986 Ga0207658_10049852 Ga0207658_100498523 316
526 3300026023 Ga0207677_10001429 Ga0207677_1000142912 316
527 3300026035 Ga0207703_10006257 Ga0207703_100062574 316
528 3300026035 Ga0207703_10214579 Ga0207703_102145792 316
529 3300026041 Ga0207639_10004094 Ga0207639_100040949 316
530 3300026041 Ga0207639_10011257 Ga0207639_100112575 316
531 3300026067 Ga0207678_10042077 Ga0207678_100420774 316
532 3300026075 Ga0207708_10001516 Ga0207708_100015164 316
533 3300026088 Ga0207641_10001365 Ga0207641_100013652 316
534 3300026088 Ga0207641_10094859 Ga0207641_100948592 316
535 3300026089 Ga0207648_10059896 Ga0207648_100598963 316
536 3300026118 Ga0207675_100002729 Ga0207675_1000027294 316
537 3300026121 Ga0207683_10007107 Ga0207683_100071078 316
538 3300026142 Ga0207698_10087808 Ga0207698_100878083 316
539 3300028379 Ga0268266_10049109 Ga0268266_100491093 316
540 3300028379 Ga0268266_10060708 Ga0268266_100607085 316
541 3300028380 Ga0268265_10000105 Ga0268265_1000010510 316
542 3300028381 Ga0268264_10000237 Ga0268264_10000237108 316
543 3300028381 Ga0268264_10045886 Ga0268264_100458862 316
544 3300031852 Ga0307410_10037064 Ga0307410_100370645 316
545 3300031995 Ga0307409_100066679 Ga0307409_1000666795 316
546 3300032005 Ga0307411_10086212 Ga0307411_100862122 316
547 3300041410 Ga0439461_0004334 Ga0439461_0004334_1062_2012 316
548 3300041413 Ga0439465_0001791 Ga0439465_0001791_5097_6047 316
549 3300041413 Ga0439465_0017471 Ga0439465_0017471_920_1870 316
550 3300042002 Ga0439442_006979 Ga0439442_006979_583_1533 316
551 3300042004 Ga0439445_0006373 Ga0439445_0006373_843_1793 316
552 3300042004 Ga0439445_0012612 Ga0439445_0012612_931_1881 316
553 3300044658 Ga0466972_0108147 Ga0466972_0108147_23_973 316
554 3300045049 Ga0466959_0191249 Ga0466959_0191249_93_1043 316
555 3300045836 Ga0466958_0065087 Ga0466958_0065087_1262_2212 316
556 3300045976 Ga0466967_0061135 Ga0466967_0061135_782_1732 316
557 3300047472 Ga0495686_0002548 Ga0495686_0002548_11011_11964 316
558 3300048903 Ga0496100_0002306 Ga0496100_0002306_4725_5675 316
559 3300048903 Ga0496100_0031541 Ga0496100_0031541_1800_2756 316
560 3300048904 Ga0496101_0038039 Ga0496101_0038039_1970_2926 316
561 3300048905 Ga0496102_0002305 Ga0496102_0002305_9511_10467 316
562 3300048905 Ga0496102_0008987 Ga0496102_0008987_5069_6019 316
563 3300048905 Ga0496102_0147712 Ga0496102_0147712_206_1156 316
564 3300048906 Ga0496103_0000657 Ga0496103_0000657_5829_6785 316
565 3300048906 Ga0496103_0046368 Ga0496103_0046368_1243_2193 316
566 3300048908 Ga0496105_0046271 Ga0496105_0046271_1605_2555 316
567 3300048909 Ga0496106_0004531 Ga0496106_0004531_8101_9051 316
568 3300048910 Ga0496107_0000847 Ga0496107_0000847_7170_8120 316
569 3300048911 Ga0496108_0069590 Ga0496108_0069590_1187_2137 316
570 3300048912 Ga0496109_0012818 Ga0496109_0012818_4351_5301 316
571 3300048912 Ga0496109_0139103 Ga0496109_0139103_378_1328 316
572 3300048915 Ga0496112_0003401 Ga0496112_0003401_2580_3530 316
573 3300048915 Ga0496112_0331402 Ga0496112_0331402_169_1119 316
574 3300048915 Ga0496112_0368376 Ga0496112_0368376_83_1033 316
575 3300048917 Ga0496114_0000265 Ga0496114_0000265_35730_36680 316
576 3300048920 Ga0496117_0006938 Ga0496117_0006938_5840_6796 316
577 3300048921 Ga0496118_0002176 Ga0496118_0002176_22603_23559 316
578 3300048922 Ga0496119_0024653 Ga0496119_0024653_388_1344 316
579 3300048924 Ga0496121_0008765 Ga0496121_0008765_5848_6804 316
580 3300048927 Ga0496124_0133524 Ga0496124_0133524_905_1861 316
581 3300048928 Ga0496125_0044840 Ga0496125_0044840_1163_2119 316
582 3300048929 Ga0496126_0076706 Ga0496126_0076706_1429_2385 316
583 3300050489 nmdc:mga03683_10381_c1 nmdc:mga03683_10381_c1_31_981 316
584 3300050489 nmdc:mga03683_71716_c1 nmdc:mga03683_71716_c1_351_1301 316
585 3300050490 nmdc:mga03n38_13130_c1 nmdc:mga03n38_13130_c1_1493_2443 316
586 3300050509 nmdc:mga0qj67_36195_c1 nmdc:mga0qj67_36195_c1_658_1608 316
587 3300050510 nmdc:mga06r32_184452_c1 nmdc:mga06r32_184452_c1_1112_2062 316
588 3300050516 nmdc:mga0sz30_24909_c1 nmdc:mga0sz30_24909_c1_316_1266 316
589 3300050516 nmdc:mga0sz30_5980_c1 nmdc:mga0sz30_5980_c1_259_1209 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

51

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qib-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 in complex with udp 0.9887 11 313
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.9877 22 313
4y6n-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 0.9877 22 313
7qoq-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 in complex with ump and magnesium 0.9873 11 313
4y9x-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-3 0.9871 22 313
ID Description Score Start End Superfamily
4y6nA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9877 22 313 3.90.550.10
4y6nA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9634 22 313 3.90.550.10
3kiaC00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8935 14 312 3.90.550.10
3kiaC00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8659 14 312 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7973 41 271 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A060BVE5-F1-model_v4 Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266) 1 45 140 GO:0016757
AF-V7L7F7-F1-model_v4 deleted 0.9888 181 315
AF-W9DHP3-F1-model_v4 Glucosyl-3-phosphoglycerate synthase 0.9745 125 302
AF-A0A7W9HSN0-F1-model_v4 Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266) 0.971 15 316 GO:0016757
AF-A0A2X4TRS3-F1-model_v4 Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266) 0.9708 13 311 GO:0016757

Feature Viewer

pLDDT pTM Quality
90.11 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map