F466835

General Info

Members Datasets Scaffolds Average Seq Length
589 298 1178 171

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100056508|Ga0070690_1000565082
Length 193
Sequence MGSGKPPDLVINSGLGDTSMTVKSAGTDESDIRPGEVQVPLPAQTDASLYFIGRIRTPWTARKDCPKNARVARESGVVCTIEVDPRWEKALPGVETCSHLIVLYWMDRARRDLAVQMPTKAEAGRPTFSVRSPVRPNPIAMSVVELRKVEGTRLEVVGLDCLDGTPLLDIKPYFASTDSIPDARAVSHAGRKG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
292 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
298 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.3
Nodule 0
Rhizoplane 11.21
Rhizosphere 81.32
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100056508 3300005330 Bacteria 2517
2 JGI24752J21851_1025002 3300001976 Bacteria 783
3 JGI24744J21845_10000772 3300002077 Bacteria 5969
4 JGI24751J29686_10021216 3300002459 Bacteria 1346
5 JGI25405J52794_10087849 3300003911 Bacteria 687
6 Ga0070676_10043395 3300005328 Bacteria 2613
7 Ga0070683_100126907 3300005329 Bacteria 2412
8 Ga0070683_100924925 3300005329 Bacteria 837
9 Ga0070670_100006134 3300005331 Bacteria 10163
10 Ga0070670_100505793 3300005331 Bacteria 1075
11 Ga0068869_100043166 3300005334 Bacteria 3237
12 Ga0068869_100548359 3300005334 Bacteria 971
13 Ga0070680_100082085 3300005336 Bacteria 2660
14 Ga0070682_100129481 3300005337 Bacteria 1706
15 Ga0068868_100066044 3300005338 Bacteria 2875
16 Ga0068868_100212581 3300005338 Bacteria 1617
17 Ga0070660_100106987 3300005339 Bacteria 2222
18 Ga0070660_101062801 3300005339 Bacteria 685
19 Ga0070689_100002613 3300005340 Bacteria 11797
20 Ga0070689_100053316 3300005340 Bacteria 3129
21 Ga0070661_100544049 3300005344 Bacteria 933
22 Ga0070668_100295803 3300005347 Bacteria 1356
23 Ga0070668_100348991 3300005347 Bacteria 1252
24 Ga0070669_100255089 3300005353 Bacteria 1397
25 Ga0070675_100052027 3300005354 Bacteria 3366
26 Ga0070671_100121377 3300005355 Bacteria 2199
27 Ga0070674_100579726 3300005356 Bacteria 945
28 Ga0070673_100120663 3300005364 Bacteria 2187
29 Ga0070673_100342617 3300005364 Bacteria 1325
30 Ga0070673_100440498 3300005364 Bacteria 1171
31 Ga0070688_100018427 3300005365 Bacteria 4029
32 Ga0070688_100028763 3300005365 Bacteria 3321
33 Ga0070659_100445376 3300005366 Bacteria 1098
34 Ga0070703_10314815 3300005406 Bacteria 657
35 Ga0070709_10002761 3300005434 Bacteria 9496
36 Ga0070714_100008916 3300005435 Bacteria 7848
37 Ga0070714_100451114 3300005435 Bacteria 1222
38 Ga0070713_100000399 3300005436 Bacteria 27898
39 Ga0070713_100437894 3300005436 Bacteria 1226
40 Ga0070710_10045271 3300005437 Bacteria 2445
41 Ga0070710_10055269 3300005437 Bacteria 2243
42 Ga0070710_10095816 3300005437 Bacteria 1758
43 Ga0070710_10415734 3300005437 Bacteria 905
44 Ga0070711_100006108 3300005439 Bacteria 7241
45 Ga0070711_100102214 3300005439 Bacteria 2087
46 Ga0070705_100050607 3300005440 Bacteria 2417
47 Ga0070700_100452907 3300005441 Bacteria 977
48 Ga0070708_100265919 3300005445 Bacteria 1613
49 Ga0070708_100672515 3300005445 Bacteria 975
50 Ga0070663_100075195 3300005455 Bacteria 2468
51 Ga0070663_100290096 3300005455 Bacteria 1306
52 Ga0070678_100014938 3300005456 Bacteria 4917
53 Ga0070678_100171339 3300005456 Bacteria 1768
54 Ga0070678_100874946 3300005456 Bacteria 820
55 Ga0070662_100178523 3300005457 Bacteria 1672
56 Ga0070662_100190473 3300005457 Bacteria 1622
57 Ga0070681_10009006 3300005458 Bacteria 9813
58 Ga0070681_10226595 3300005458 Bacteria 1784
59 Ga0068867_100073054 3300005459 Bacteria 2568
60 Ga0070685_10002608 3300005466 Bacteria 9232
61 Ga0070706_100193408 3300005467 Bacteria 1901
62 Ga0070699_100002544 3300005518 Bacteria 16387
63 Ga0070699_100040010 3300005518 Bacteria 4060
64 Ga0070679_100006683 3300005530 Bacteria 10755
65 Ga0070679_100192648 3300005530 Bacteria 2007
66 Ga0070672_100046754 3300005543 Bacteria 3354
67 Ga0070686_100223550 3300005544 Bacteria 1362
68 Ga0070686_100902926 3300005544 Bacteria 719
69 Ga0070695_100200823 3300005545 Bacteria 1425
70 Ga0070696_100062797 3300005546 Bacteria 2601
71 Ga0070693_100174266 3300005547 Bacteria 1380
72 Ga0070665_100062450 3300005548 Bacteria 3735
73 Ga0070665_100194028 3300005548 Bacteria 2032
74 Ga0070664_100118558 3300005564 Bacteria 2315
75 Ga0068854_100157464 3300005578 Bacteria 1756
76 Ga0068856_100076560 3300005614 Bacteria 3314
77 Ga0068856_101436602 3300005614 Bacteria 704
78 Ga0070702_100021099 3300005615 Bacteria 3422
79 Ga0070702_100111818 3300005615 Bacteria 1695
80 Ga0070702_100832374 3300005615 Bacteria 716
81 Ga0068859_100181266 3300005617 Bacteria 2189
82 Ga0068864_100059018 3300005618 Bacteria 3318
83 Ga0068864_100535177 3300005618 Bacteria 1131
84 Ga0068866_10308482 3300005718 Bacteria 991
85 Ga0068870_10028607 3300005840 Bacteria 2800
86 Ga0068863_100057282 3300005841 Bacteria 3688
87 Ga0068863_100085025 3300005841 Bacteria 2998
88 Ga0068858_100085162 3300005842 Bacteria 2940
89 Ga0068860_100165200 3300005843 Bacteria 2137
90 Ga0081455_10002035 3300005937 Bacteria 24184
91 Ga0081455_10009923 3300005937 Bacteria 9741
92 Ga0081455_10286552 3300005937 Bacteria 1187
93 Ga0081540_1042232 3300005983 Bacteria 2354
94 Ga0081539_10033555 3300005985 Bacteria 3122
95 Ga0070717_10009273 3300006028 Bacteria 7396
96 Ga0070717_10199739 3300006028 Bacteria 1751
97 Ga0070717_10244158 3300006028 Bacteria 1584
98 Ga0070717_10260906 3300006028 Bacteria 1533
99 Ga0075365_10031211 3300006038 Bacteria 3417
100 Ga0075365_10033631 3300006038 Bacteria 3306
101 Ga0075365_10109917 3300006038 Bacteria 1894
102 Ga0075365_10355818 3300006038 Bacteria 1032
103 Ga0075365_10393982 3300006038 Unclassified 977
104 Ga0075365_10662909 3300006038 Bacteria 737
105 Ga0075365_10846204 3300006038 Bacteria 645
106 Ga0075363_100080667 3300006048 Bacteria 1779
107 Ga0075363_100093544 3300006048 Bacteria 1657
108 Ga0075364_10047221 3300006051 Bacteria 2804
109 Ga0075364_10093862 3300006051 Bacteria 1993
110 Ga0075432_10000490 3300006058 Bacteria 11811
111 Ga0075432_10191483 3300006058 Bacteria 805
112 Ga0070715_10001341 3300006163 Bacteria 7098
113 Ga0070715_10592128 3300006163 Bacteria 649
114 Ga0070716_100218107 3300006173 Bacteria 1280
115 Ga0070716_100337713 3300006173 Bacteria 1062
116 Ga0070712_100005556 3300006175 Bacteria 7803
117 Ga0070712_100011175 3300006175 Bacteria 5683
118 Ga0070712_100014542 3300006175 Bacteria 5051
119 Ga0070712_100273296 3300006175 Bacteria 1359
120 Ga0070712_100370564 3300006175 Bacteria 1177
121 Ga0070712_100592416 3300006175 Bacteria 938
122 Ga0075362_10041990 3300006177 Bacteria 2019
123 Ga0075362_10210982 3300006177 Bacteria 947
124 Ga0075367_10018677 3300006178 Bacteria 3830
125 Ga0075367_10339729 3300006178 Bacteria 947
126 Ga0075367_10448499 3300006178 Bacteria 818
127 Ga0075369_10005227 3300006186 Bacteria 4837
128 Ga0075369_10030295 3300006186 Bacteria 2278
129 Ga0075427_10000547 3300006194 Bacteria 4345
130 Ga0075370_10027028 3300006353 Bacteria 3182
131 Ga0075370_10653980 3300006353 Bacteria 638
132 Ga0068871_100069952 3300006358 Bacteria 2883
133 Ga0068871_100440836 3300006358 Bacteria 1166
134 Ga0075428_100003603 3300006844 Bacteria 16973
135 Ga0075428_100162235 3300006844 Bacteria 2426
136 Ga0075428_100413213 3300006844 Bacteria 1446
137 Ga0075428_100474944 3300006844 Bacteria 1338
138 Ga0075430_100001211 3300006846 Bacteria 20749
139 Ga0075430_100003714 3300006846 Bacteria 12823
140 Ga0075430_100192416 3300006846 Bacteria 1695
141 Ga0075430_100560358 3300006846 Bacteria 942
142 Ga0075430_100774510 3300006846 Bacteria 791
143 Ga0075431_100003725 3300006847 Bacteria 14811
144 Ga0075431_100110014 3300006847 Bacteria 2844
145 Ga0075431_100233206 3300006847 Bacteria 1874
146 Ga0075431_100882572 3300006847 Bacteria 864
147 Ga0075433_10000029 3300006852 Bacteria 55893
148 Ga0075433_10286600 3300006852 Bacteria 1459
149 Ga0075433_10733495 3300006852 Bacteria 865
150 Ga0075434_100002244 3300006871 Bacteria 16889
151 Ga0075434_100038251 3300006871 Bacteria 4752
152 Ga0075434_100057841 3300006871 Bacteria 3853
153 Ga0075434_100172212 3300006871 Bacteria 2185
154 Ga0075434_100673902 3300006871 Bacteria 1052
155 Ga0075434_100688999 3300006871 Bacteria 1040
156 Ga0075434_101032750 3300006871 Unclassified 836
157 Ga0075429_100002021 3300006880 Bacteria 16869
158 Ga0075429_100224240 3300006880 Bacteria 1646
159 Ga0075429_100420325 3300006880 Bacteria 1171
160 Ga0075429_101058910 3300006880 Bacteria 709
161 Ga0068865_100073969 3300006881 Bacteria 2425
162 Ga0068865_100583280 3300006881 Bacteria 943
163 Ga0075436_100939343 3300006914 Bacteria 648
164 Ga0097620_100181256 3300006931 Bacteria 2189
165 Ga0075435_100001612 3300007076 Bacteria 14589
166 Ga0075435_100112378 3300007076 Bacteria 2266
167 Ga0075435_100189384 3300007076 Bacteria 1741
168 Ga0075435_101394021 3300007076 Bacteria 614
169 Ga0099794_10005115 3300007265 Bacteria 5229
170 Ga0099794_10043755 3300007265 Bacteria 2138
171 Ga0099795_10076554 3300007788 Bacteria 1272
172 Ga0099795_10277495 3300007788 Bacteria 731
173 Ga0111539_10000345 3300009094 Bacteria 57093
174 Ga0111539_10431253 3300009094 Bacteria 1535
175 Ga0111539_11348998 3300009094 Bacteria 827
176 Ga0111539_11488865 3300009094 Bacteria 785
177 Ga0111539_12053069 3300009094 Bacteria 663
178 Ga0111539_12275760 3300009094 Bacteria 629
179 Ga0105245_10061832 3300009098 Bacteria 3377
180 Ga0105247_10057751 3300009101 Bacteria 2399
181 Ga0105247_10169651 3300009101 Bacteria 1450
182 Ga0114129_10024967 3300009147 Bacteria 8473
183 Ga0114129_10037724 3300009147 Bacteria 6822
184 Ga0114129_10054577 3300009147 Bacteria 5602
185 Ga0114129_10143506 3300009147 Bacteria 3271
186 Ga0114129_10410384 3300009147 Bacteria 1783
187 Ga0114129_10426801 3300009147 Bacteria 1742
188 Ga0114129_10597028 3300009147 Bacteria 1431
189 Ga0114129_10960914 3300009147 Bacteria 1078
190 Ga0114129_11118693 3300009147 Bacteria 985
191 Ga0105243_10728822 3300009148 Bacteria 970
192 Ga0105241_10267816 3300009174 Bacteria 1454
193 Ga0105241_10856688 3300009174 Unclassified 841
194 Ga0105242_10017333 3300009176 Bacteria 5610
195 Ga0105242_10098655 3300009176 Bacteria 2471
196 Ga0105248_10075676 3300009177 Bacteria 3784
197 Ga0105248_10098149 3300009177 Bacteria 3300
198 Ga0105248_10166116 3300009177 Bacteria 2488
199 Ga0105248_10345526 3300009177 Bacteria 1675
200 Ga0105237_10279027 3300009545 Bacteria 1673
201 Ga0105238_10260526 3300009551 Bacteria 1713
202 Ga0105249_10112429 3300009553 Bacteria 2576
203 Ga0105249_10439276 3300009553 Bacteria 1342
204 Ga0099796_10100838 3300010159 Bacteria 1086
205 Ga0105239_10416553 3300010375 Bacteria 1521
206 Ga0105239_10491811 3300010375 Bacteria 1394
207 Ga0105246_10045627 3300011119 Bacteria 2985
208 Ga0105246_10050504 3300011119 Bacteria 2852
209 Ga0105246_10119113 3300011119 Bacteria 1953
210 Ga0105246_11379921 3300011119 Bacteria 657
211 Ga0157371_10624613 3300013102 Bacteria 803
212 Ga0157374_10098711 3300013296 Bacteria 2797
213 Ga0157374_10180587 3300013296 Bacteria 2061
214 Ga0157378_10398825 3300013297 Bacteria 1355
215 Ga0157378_10760214 3300013297 Bacteria 993
216 Ga0163162_10153001 3300013306 Bacteria 2425
217 Ga0163162_10155808 3300013306 Bacteria 2404
218 Ga0163162_10277279 3300013306 Bacteria 1809
219 Ga0163162_10581233 3300013306 Bacteria 1247
220 Ga0163162_10678063 3300013306 Bacteria 1153
221 Ga0157372_11028742 3300013307 Bacteria 954
222 Ga0157375_10089816 3300013308 Bacteria 3129
223 Ga0157375_10199902 3300013308 Bacteria 2154
224 Ga0157375_10743774 3300013308 Bacteria 1132
225 Ga0157375_10838936 3300013308 Bacteria 1066
226 Ga0157375_11947078 3300013308 Bacteria 698
227 Ga0163163_10109949 3300014325 Bacteria 2784
228 Ga0163163_10167830 3300014325 Bacteria 2241
229 Ga0163163_10235906 3300014325 Bacteria 1878
230 Ga0163163_11770450 3300014325 Bacteria 678
231 Ga0163163_12046641 3300014325 Bacteria 632
232 Ga0157380_12021878 3300014326 Bacteria 638
233 Ga0157377_10074281 3300014745 Bacteria 1972
234 Ga0157379_10585223 3300014968 Bacteria 1041
235 Ga0157376_10155619 3300014969 Bacteria 2066
236 Ga0157376_10368830 3300014969 Bacteria 1379
237 Ga0157376_10403045 3300014969 Bacteria 1323
238 Ga0157376_10904189 3300014969 Bacteria 901
239 Ga0163161_10988226 3300017792 Bacteria 718
240 Ga0207692_10003963 3300025898 Bacteria 5813
241 Ga0207692_10061381 3300025898 Bacteria 1948
242 Ga0207692_10076947 3300025898 Bacteria 1774
243 Ga0207710_10023622 3300025900 Bacteria 2643
244 Ga0207710_10036699 3300025900 Bacteria 2162
245 Ga0207688_10017863 3300025901 Bacteria 3860
246 Ga0207647_10217608 3300025904 Bacteria 1101
247 Ga0207685_10012249 3300025905 Bacteria 2611
248 Ga0207699_10008397 3300025906 Bacteria 5096
249 Ga0207645_10021743 3300025907 Bacteria 4179
250 Ga0207645_10132803 3300025907 Bacteria 1621
251 Ga0207643_10001007 3300025908 Bacteria 16791
252 Ga0207684_10010039 3300025910 Bacteria 8341
253 Ga0207707_10021935 3300025912 Bacteria 5581
254 Ga0207707_10264233 3300025912 Bacteria 1492
255 Ga0207671_10196286 3300025914 Bacteria 1575
256 Ga0207693_10003360 3300025915 Bacteria 13667
257 Ga0207693_10004439 3300025915 Bacteria 11856
258 Ga0207693_10207474 3300025915 Bacteria 1540
259 Ga0207693_10208737 3300025915 Bacteria 1535
260 Ga0207693_10372599 3300025915 Bacteria 1117
261 Ga0207663_10000486 3300025916 Bacteria 17287
262 Ga0207663_10202552 3300025916 Bacteria 1433
263 Ga0207660_10057277 3300025917 Bacteria 2791
264 Ga0207657_10093249 3300025919 Bacteria 2508
265 Ga0207694_10154997 3300025924 Bacteria 1847
266 Ga0207650_10005080 3300025925 Bacteria 8983
267 Ga0207650_10136159 3300025925 Bacteria 1927
268 Ga0207659_10223731 3300025926 Bacteria 1514
269 Ga0207700_10002081 3300025928 Bacteria 11427
270 Ga0207700_10727766 3300025928 Bacteria 886
271 Ga0207664_10016398 3300025929 Bacteria 5405
272 Ga0207664_10258017 3300025929 Bacteria 1523
273 Ga0207664_10503620 3300025929 Bacteria 1084
274 Ga0207644_10051022 3300025931 Bacteria 2967
275 Ga0207644_10077283 3300025931 Bacteria 2451
276 Ga0207690_10354203 3300025932 Bacteria 1161
277 Ga0207706_10020138 3300025933 Bacteria 5995
278 Ga0207706_10022814 3300025933 Bacteria 5615
279 Ga0207686_10045029 3300025934 Bacteria 2713
280 Ga0207686_10173869 3300025934 Bacteria 1521
281 Ga0207709_10053028 3300025935 Bacteria 2494
282 Ga0207670_10008170 3300025936 Bacteria 5892
283 Ga0207669_10393917 3300025937 Bacteria 1083
284 Ga0207665_10110842 3300025939 Bacteria 1928
285 Ga0207665_10235272 3300025939 Bacteria 1348
286 Ga0207691_10001764 3300025940 Bacteria 21304
287 Ga0207711_10014688 3300025941 Bacteria 6507
288 Ga0207711_10218222 3300025941 Bacteria 1743
289 Ga0207711_10521236 3300025941 Bacteria 1108
290 Ga0207689_10026493 3300025942 Bacteria 4855
291 Ga0207689_10217194 3300025942 Bacteria 1580
292 Ga0207679_10047412 3300025945 Bacteria 3121
293 Ga0207667_10725528 3300025949 Unclassified 995
294 Ga0207651_10031699 3300025960 Bacteria 3383
295 Ga0207651_10100373 3300025960 Bacteria 2146
296 Ga0207651_10376881 3300025960 Bacteria 1201
297 Ga0207651_10556776 3300025960 Bacteria 998
298 Ga0207712_10441614 3300025961 Bacteria 1102
299 Ga0207668_10094068 3300025972 Bacteria 2209
300 Ga0207668_10188537 3300025972 Bacteria 1632
301 Ga0207640_10027600 3300025981 Bacteria 3461
302 Ga0207658_10024856 3300025986 Bacteria 4191
303 Ga0207677_10078661 3300026023 Bacteria 2355
304 Ga0207678_10089779 3300026067 Bacteria 2626
305 Ga0207708_10001725 3300026075 Bacteria 16161
306 Ga0207708_10471234 3300026075 Bacteria 1049
307 Ga0207702_10855083 3300026078 Bacteria 900
308 Ga0207641_10146641 3300026088 Bacteria 2134
309 Ga0207641_11476125 3300026088 Bacteria 681
310 Ga0207648_10063493 3300026089 Bacteria 3219
311 Ga0207676_10024423 3300026095 Bacteria 4472
312 Ga0207674_11349111 3300026116 Bacteria 683
313 Ga0207675_100004083 3300026118 Bacteria 14129
314 Ga0207683_10016218 3300026121 Bacteria 6341
315 Ga0207683_10016362 3300026121 Bacteria 6311
316 Ga0209588_1035516 3300027671 Bacteria 1602
317 Ga0209588_1051386 3300027671 Bacteria 1333
318 Ga0209813_10148025 3300027866 Bacteria 839
319 Ga0207428_10000360 3300027907 Bacteria 58478
320 Ga0268266_10116869 3300028379 Bacteria 2370
321 Ga0268266_11527628 3300028379 Bacteria 643
322 Ga0268264_10150016 3300028381 Bacteria 2089
323 Ga0268264_12038079 3300028381 Bacteria 583
324 Ga0265338_10221469 3300028800 Bacteria 1413
325 Ga0265325_10148594 3300031241 Bacteria 1110
326 Ga0265340_10182488 3300031247 Bacteria 948
327 Ga0316578_10046438 3300031728 Bacteria 2531
328 Ga0373958_0024929 3300034819 Bacteria 1136
329 Ga0373926_0037758 3300035083 Bacteria 1719
330 Ga0373928_0037010 3300035084 Bacteria 1105
331 Ga0373928_0087099 3300035084 Bacteria 796
332 Ga0373940_0013885 3300035088 Bacteria 1957
333 Ga0373944_0004025 3300035089 Bacteria 3809
334 Ga0373923_0121703 3300035111 Bacteria 1167
335 Ga0373936_0044095 3300035113 Bacteria 1794
336 Ga0373939_0013009 3300035114 Bacteria 2133
337 Ga0373941_0142642 3300035115 Bacteria 872
338 Ga0373945_0027884 3300035116 Bacteria 1975
339 Ga0373945_0042791 3300035116 Bacteria 1642
340 Ga0373953_0428976 3300035117 Bacteria 583
341 Ga0373960_0007681 3300035121 Bacteria 2563
342 Ga0373960_0075148 3300035121 Bacteria 1053
343 Ga0373960_0183955 3300035121 Bacteria 731
344 Ga0373943_0161978 3300035170 Bacteria 1218
345 Ga0373946_0047438 3300035171 Bacteria 1784
346 Ga0373946_0310194 3300035171 Bacteria 782
347 Ga0373942_0239244 3300035207 Bacteria 614
348 Ga0373961_0043639 3300035241 Bacteria 1305
349 Ga0316574_0000991 3300035398 Bacteria 12767
350 Ga0373931_0014574 3300035691 Bacteria 3845
351 Ga0373931_0019642 3300035691 Bacteria 3375
352 Ga0373931_0055890 3300035691 Bacteria 2113
353 Ga0373931_0491804 3300035691 Bacteria 790
354 Ga0373935_0047132 3300035692 Bacteria 2724
355 Ga0373935_0070775 3300035692 Bacteria 2249
356 Ga0373935_0305831 3300035692 Bacteria 1125
357 Ga0373927_0057497 3300035695 Bacteria 2515
358 Ga0373927_0080180 3300035695 Bacteria 2115
359 Ga0373927_0164171 3300035695 Bacteria 1455
360 Ga0373927_0174994 3300035695 Bacteria 1407
361 Ga0373927_0187727 3300035695 Bacteria 1356
362 Ga0373947_0012564 3300035725 Bacteria 4855
363 Ga0373947_0038833 3300035725 Bacteria 2831
364 Ga0373947_0144587 3300035725 Bacteria 1528
365 Ga0373937_0039319 3300036401 Bacteria 4311
366 Ga0373937_0488314 3300036401 Bacteria 1170
367 Ga0316584_0002919 3300036712 Bacteria 10981
368 Ga0373925_0038149 3300037068 Bacteria 3550
369 Ga0373925_0049184 3300037068 Bacteria 3143
370 Ga0373925_0237378 3300037068 Bacteria 1459
371 Ga0373925_0304978 3300037068 Bacteria 1286
372 Ga0373925_0636803 3300037068 Bacteria 878
373 Ga0395898_0035487 3300037466 Bacteria 4957
374 Ga0436360_0700084 3300039438 Bacteria 912
375 Ga0436361_0423100 3300039447 Bacteria 5370
376 Ga0436361_0784595 3300039447 Bacteria 666
377 Ga0495592_0213686 3300046454 Bacteria 1294
378 Ga0495603_0199764 3300046455 Bacteria 1155
379 Ga0495629_0034266 3300046459 Bacteria 3589
380 Ga0495629_0085995 3300046459 Bacteria 2194
381 Ga0495629_0738995 3300046459 Bacteria 652
382 Ga0495641_0116184 3300046461 Bacteria 1194
383 Ga0495641_0238127 3300046461 Bacteria 817
384 Ga0495580_0438538 3300046472 Bacteria 877
385 Ga0495582_0055105 3300046473 Bacteria 2192
386 Ga0495605_0314541 3300046474 Bacteria 661
387 Ga0495639_0120279 3300046475 Bacteria 1252
388 Ga0495662_0028782 3300046476 Bacteria 2683
389 Ga0495584_0058609 3300046491 Bacteria 1937
390 Ga0495584_0151850 3300046491 Bacteria 1177
391 Ga0495585_0377340 3300046492 Bacteria 685
392 Ga0495607_0145397 3300046501 Bacteria 1219
393 Ga0495618_0066761 3300046514 Bacteria 2287
394 Ga0495630_0107721 3300046517 Bacteria 2111
395 Ga0495631_0111246 3300046518 Bacteria 1178
396 Ga0495632_0089302 3300046519 Bacteria 1463
397 Ga0495637_0197768 3300046520 Bacteria 740
398 Ga0495644_0056568 3300046523 Bacteria 1474
399 Ga0495644_0091420 3300046523 Bacteria 1149
400 Ga0495666_0271516 3300046526 Bacteria 770
401 Ga0495640_0073171 3300046533 Bacteria 2295
402 Ga0495586_0307931 3300046535 Bacteria 908
403 Ga0495598_0000697 3300046537 Bacteria 6395
404 Ga0495621_0014373 3300046539 Bacteria 2504
405 Ga0495633_0051404 3300046558 Bacteria 1942
406 Ga0495633_0381595 3300046558 Bacteria 638
407 Ga0495656_0027056 3300046615 Bacteria 2288
408 Ga0495656_0223820 3300046615 Bacteria 942
409 Ga0495634_0457855 3300046642 Bacteria 752
410 Ga0495611_0398759 3300046648 Bacteria 629
411 Ga0495659_0082625 3300046664 Bacteria 1222
412 Ga0495659_0089043 3300046664 Bacteria 1183
413 Ga0495588_0075200 3300046674 Bacteria 1759
414 Ga0495646_0060832 3300046680 Bacteria 2251
415 Ga0495647_0052274 3300046681 Bacteria 1590
416 Ga0495658_0136733 3300046683 Bacteria 1495
417 Ga0495669_0399290 3300046684 Bacteria 666
418 Ga0495613_0220407 3300046689 Bacteria 1332
419 Ga0495624_0037117 3300046690 Bacteria 3137
420 Ga0495624_0274570 3300046690 Bacteria 1018
421 Ga0495670_0114717 3300046691 Bacteria 1396
422 Ga0495671_0082831 3300046692 Bacteria 1572
423 Ga0495589_0122776 3300046794 Bacteria 1250
424 Ga0495581_0085448 3300047315 Bacteria 1829
425 Ga0495581_0142804 3300047315 Bacteria 1397
426 Ga0495674_0938364 3300047319 Bacteria 666
427 Ga0495676_0011515 3300047321 Bacteria 7978
428 Ga0495676_0283403 3300047321 Bacteria 1121
429 Ga0495680_0264560 3300047322 Bacteria 1216
430 Ga0495675_0258095 3300047444 Bacteria 1045
431 Ga0495684_0208705 3300047471 Bacteria 1437
432 Ga0496100_0015167 3300048903 Bacteria 4495
433 Ga0496100_0068412 3300048903 Bacteria 2361
434 Ga0496100_0116503 3300048903 Bacteria 1864
435 Ga0496100_0516548 3300048903 Bacteria 921
436 Ga0496101_0069002 3300048904 Bacteria 2585
437 Ga0496101_0179160 3300048904 Bacteria 1631
438 Ga0496102_0093039 3300048905 Bacteria 2793
439 Ga0496102_0147332 3300048905 Bacteria 2210
440 Ga0496102_0232341 3300048905 Bacteria 1738
441 Ga0496102_0252608 3300048905 Bacteria 1662
442 Ga0496102_0347213 3300048905 Bacteria 1397
443 Ga0496102_0610624 3300048905 Bacteria 1014
444 Ga0496102_1126085 3300048905 Bacteria 704
445 Ga0496103_0004074 3300048906 Bacteria 8875
446 Ga0496103_0063589 3300048906 Bacteria 2299
447 Ga0496103_0215903 3300048906 Bacteria 1233
448 Ga0496103_0287133 3300048906 Bacteria 1058
449 Ga0496103_0434010 3300048906 Bacteria 843
450 Ga0496104_0000423 3300048907 Bacteria 36966
451 Ga0496104_0007334 3300048907 Bacteria 9736
452 Ga0496104_0011395 3300048907 Bacteria 7960
453 Ga0496104_0020816 3300048907 Bacteria 6014
454 Ga0496104_0788508 3300048907 Bacteria 856
455 Ga0496105_0001835 3300048908 Bacteria 15210
456 Ga0496105_0007095 3300048908 Bacteria 8640
457 Ga0496105_0009750 3300048908 Bacteria 7522
458 Ga0496105_0039286 3300048908 Bacteria 3900
459 Ga0496105_0195712 3300048908 Bacteria 1651
460 Ga0496106_0006607 3300048909 Bacteria 8585
461 Ga0496106_0064225 3300048909 Bacteria 2792
462 Ga0496106_0704417 3300048909 Bacteria 805
463 Ga0496106_1255734 3300048909 Bacteria 576
464 Ga0496107_0015823 3300048910 Bacteria 5290
465 Ga0496107_0080479 3300048910 Bacteria 2375
466 Ga0496107_0197444 3300048910 Bacteria 1495
467 Ga0496108_0002705 3300048911 Bacteria 14172
468 Ga0496108_0121535 3300048911 Bacteria 2240
469 Ga0496108_0122806 3300048911 Bacteria 2228
470 Ga0496108_0155095 3300048911 Bacteria 1977
471 Ga0496109_0060020 3300048912 Bacteria 3475
472 Ga0496109_0127049 3300048912 Bacteria 2377
473 Ga0496109_0166212 3300048912 Bacteria 2068
474 Ga0496110_0100439 3300048913 Bacteria 2593
475 Ga0496110_0180532 3300048913 Bacteria 1916
476 Ga0496110_0214226 3300048913 Bacteria 1751
477 Ga0496110_0230444 3300048913 Bacteria 1685
478 Ga0496110_1059925 3300048913 Bacteria 718
479 Ga0496111_0018009 3300048914 Bacteria 4886
480 Ga0496111_0038288 3300048914 Bacteria 3436
481 Ga0496112_0002936 3300048915 Bacteria 13891
482 Ga0496112_0005264 3300048915 Bacteria 11148
483 Ga0496112_0143306 3300048915 Bacteria 2358
484 Ga0496112_0522686 3300048915 Bacteria 1121
485 Ga0496113_0000490 3300048916 Bacteria 19510
486 Ga0496113_0001007 3300048916 Bacteria 15109
487 Ga0496113_0033685 3300048916 Bacteria 3733
488 Ga0496113_0499438 3300048916 Bacteria 977
489 Ga0496114_0116176 3300048917 Bacteria 2297
490 Ga0496114_0188678 3300048917 Bacteria 1803
491 Ga0496114_0225539 3300048917 Bacteria 1645
492 Ga0496115_0029636 3300048918 Bacteria 4299
493 Ga0496115_0134522 3300048918 Bacteria 2038
494 Ga0496115_0189148 3300048918 Bacteria 1701
495 Ga0496115_0196538 3300048918 Bacteria 1666
496 Ga0496115_0707346 3300048918 Bacteria 791
497 Ga0496115_0891058 3300048918 Bacteria 687
498 Ga0501039_0070850 3300049575 Bacteria 2708
499 Ga0501039_0381819 3300049575 Bacteria 1107
500 Ga0501040_0128818 3300049576 Bacteria 1779
501 Ga0501041_0087520 3300049577 Bacteria 1923
502 Ga0501041_0167883 3300049577 Bacteria 1373
503 Ga0501041_0777484 3300049577 Bacteria 614
504 Ga0501046_0193715 3300049580 Bacteria 1515
505 Ga0501071_0020350 3300049587 Bacteria 4610
506 Ga0501072_0002952 3300049588 Bacteria 12805
507 Ga0501075_0113745 3300049591 Bacteria 2058
508 Ga0501076_0005769 3300049592 Bacteria 8929
509 Ga0501076_0173883 3300049592 Bacteria 1756
510 Ga0501077_0054650 3300049593 Bacteria 2536
511 Ga0501077_0235167 3300049593 Bacteria 1165
512 Ga0501079_0070985 3300049741 Bacteria 2690
513 Ga0501079_0206782 3300049741 Bacteria 1533
514 Ga0501081_0164849 3300049743 Bacteria 1598
515 Ga0501081_0423612 3300049743 Bacteria 987
516 Ga0501045_0022424 3300049824 Bacteria 4522
517 nmdc:mga03683_133972_c1 3300050489 Bacteria 1110
518 nmdc:mga03683_206904_c1 3300050489 Bacteria 902
519 nmdc:mga03683_280655_c1 3300050489 Bacteria 778
520 nmdc:mga03683_85890_c1 3300050489 Bacteria 1365
521 nmdc:mga00v17_135166_c1 3300050491 Bacteria 1578
522 nmdc:mga00v17_207434_c1 3300050491 Bacteria 1267
523 nmdc:mga00v17_24039_c1 3300050491 Bacteria 3531
524 nmdc:mga00v17_331092_c1 3300050491 Bacteria 989
525 nmdc:mga0yw44_52089_c1 3300050492 Bacteria 2480
526 nmdc:mga0yw44_681053_c1 3300050492 Bacteria 699
527 nmdc:mga0yw44_702181_c1 3300050492 Unclassified 687
528 nmdc:mga0k408_770776_c1 3300050493 Bacteria 561
529 nmdc:mga06z11_10542_c1 3300050494 Bacteria 3945
530 nmdc:mga06z11_286623_c1 3300050494 Bacteria 976
531 nmdc:mga04h51_216134_c1 3300050495 Bacteria 758
532 nmdc:mga04h51_272643_c1 3300050495 Bacteria 683
533 nmdc:mga07m45_63519_c1 3300050496 Bacteria 2094
534 nmdc:mga05p37_25974_c1 3300050507 Bacteria 7121
535 nmdc:mga05p37_2764_c1 3300050507 Bacteria 20392
536 nmdc:mga05p37_380774_c1 3300050507 Bacteria 1653
537 nmdc:mga05p37_501887_c1 3300050507 Bacteria 1392
538 nmdc:mga05p37_558391_c1 3300050507 Bacteria 1301
539 nmdc:mga05p37_821929_c1 3300050507 Bacteria 1013
540 nmdc:mga05p37_82451_c1 3300050507 Bacteria 3962
541 nmdc:mga09592_358275_c1 3300050508 Bacteria 1262
542 nmdc:mga09592_524_c1 3300050508 Bacteria 28956
543 nmdc:mga09592_669632_c1 3300050508 Bacteria 885
544 nmdc:mga0qj67_4921_c1 3300050509 Bacteria 9716
545 nmdc:mga0qj67_85987_c1 3300050509 Bacteria 2523
546 nmdc:mga0qj67_94022_c1 3300050509 Bacteria 2411
547 nmdc:mga06r32_121_c1 3300050510 Bacteria 55968
548 nmdc:mga06r32_52964_c1 3300050510 Bacteria 3887
549 nmdc:mga06r32_757985_c1 3300050510 Bacteria 933
550 nmdc:mga08y16_190636_c1 3300050511 Bacteria 2126
551 nmdc:mga08y16_5266_c1 3300050511 Bacteria 13515
552 nmdc:mga0n895_12320_c1 3300050512 Bacteria 7667
553 nmdc:mga0n895_1473767_c1 3300050512 Bacteria 647
554 nmdc:mga0n895_209430_c1 3300050512 Bacteria 1980
555 nmdc:mga0n895_2636_c1 3300050512 Bacteria 14138
556 nmdc:mga0n895_382904_c1 3300050512 Bacteria 1423
557 nmdc:mga0n895_511532_c1 3300050512 Bacteria 1209
558 nmdc:mga0n895_795745_c1 3300050512 Unclassified 936
559 nmdc:mga0rr50_143412_c1 3300050513 Bacteria 1923
560 nmdc:mga0rr50_232813_c1 3300050513 Bacteria 1525
561 nmdc:mga0rr50_3849_c1 3300050513 Bacteria 8721
562 nmdc:mga08x19_348641_c1 3300050514 Bacteria 1033
563 nmdc:mga0a205_40529_c2 3300050515 Bacteria 4013
564 nmdc:mga0a205_487707_c1 3300050515 Bacteria 1090
565 nmdc:mga0a205_549_c1 3300050515 Bacteria 29737
566 nmdc:mga0a205_61189_c1 3300050515 Bacteria 3636
567 nmdc:mga0sz30_13701_c1 3300050516 Bacteria 3180
568 Ga0495601_0273309 3300053077 Bacteria 1102
569 Ga0495601_0549119 3300053077 Bacteria 743
570 Ga0495655_0006920 3300053083 Bacteria 2085
571 Ga0495655_0029147 3300053083 Bacteria 1324
572 Ga0495595_0031138 3300053084 Bacteria 2396
573 Ga0495595_0187686 3300053084 Bacteria 1027
574 Ga0495595_0597313 3300053084 Bacteria 564
575 Ga0495619_0035750 3300053085 Bacteria 3232
576 Ga0495619_0196883 3300053085 Bacteria 1395
577 Ga0495619_0352315 3300053085 Bacteria 1018
578 Ga0500652_000011 3300053131 Bacteria 160704
579 Ga0500577_0168867 3300053142 Bacteria 935
580 Ga0500627_0035814 3300053158 Bacteria 2110
581 Ga0500636_0005613 3300053177 Bacteria 7167
582 Ga0501084_0611874 3300054114 Bacteria 920
583 Ga0501084_0646539 3300054114 Bacteria 893
584 Ga0501082_0118853 3300060353 Bacteria 2290
585 Ga0501082_0935103 3300060353 Unclassified 758
586 Ga0530510_0089869 3300061734 Bacteria 2240
587 Ga0530510_0092592 3300061734 Bacteria 2206
588 Ga0530510_0160063 3300061734 Bacteria 1665
589 8001849340 8001845381 Bacteria 5804942
590 Ga0070690_100056508
591 JGI24752J21851_1025002
592 JGI24744J21845_10000772
593 JGI24751J29686_10021216
594 JGI25405J52794_10087849
595 Ga0070676_10043395
596 Ga0070683_100126907
597 Ga0070683_100924925
598 Ga0070670_100006134
599 Ga0070670_100505793
600 Ga0068869_100043166
601 Ga0068869_100548359
602 Ga0070680_100082085
603 Ga0070682_100129481
604 Ga0068868_100066044
605 Ga0068868_100212581
606 Ga0070660_100106987
607 Ga0070660_101062801
608 Ga0070689_100002613
609 Ga0070689_100053316
610 Ga0070661_100544049
611 Ga0070668_100295803
612 Ga0070668_100348991
613 Ga0070669_100255089
614 Ga0070675_100052027
615 Ga0070671_100121377
616 Ga0070674_100579726
617 Ga0070673_100120663
618 Ga0070673_100342617
619 Ga0070673_100440498
620 Ga0070688_100018427
621 Ga0070688_100028763
622 Ga0070659_100445376
623 Ga0070703_10314815
624 Ga0070709_10002761
625 Ga0070714_100008916
626 Ga0070714_100451114
627 Ga0070713_100000399
628 Ga0070713_100437894
629 Ga0070710_10045271
630 Ga0070710_10055269
631 Ga0070710_10095816
632 Ga0070710_10415734
633 Ga0070711_100006108
634 Ga0070711_100102214
635 Ga0070705_100050607
636 Ga0070700_100452907
637 Ga0070708_100265919
638 Ga0070708_100672515
639 Ga0070663_100075195
640 Ga0070663_100290096
641 Ga0070678_100014938
642 Ga0070678_100171339
643 Ga0070678_100874946
644 Ga0070662_100178523
645 Ga0070662_100190473
646 Ga0070681_10009006
647 Ga0070681_10226595
648 Ga0068867_100073054
649 Ga0070685_10002608
650 Ga0070706_100193408
651 Ga0070699_100002544
652 Ga0070699_100040010
653 Ga0070679_100006683
654 Ga0070679_100192648
655 Ga0070672_100046754
656 Ga0070686_100223550
657 Ga0070686_100902926
658 Ga0070695_100200823
659 Ga0070696_100062797
660 Ga0070693_100174266
661 Ga0070665_100062450
662 Ga0070665_100194028
663 Ga0070664_100118558
664 Ga0068854_100157464
665 Ga0068856_100076560
666 Ga0068856_101436602
667 Ga0070702_100021099
668 Ga0070702_100111818
669 Ga0070702_100832374
670 Ga0068859_100181266
671 Ga0068864_100059018
672 Ga0068864_100535177
673 Ga0068866_10308482
674 Ga0068870_10028607
675 Ga0068863_100057282
676 Ga0068863_100085025
677 Ga0068858_100085162
678 Ga0068860_100165200
679 Ga0081455_10002035
680 Ga0081455_10009923
681 Ga0081455_10286552
682 Ga0081540_1042232
683 Ga0081539_10033555
684 Ga0070717_10009273
685 Ga0070717_10199739
686 Ga0070717_10244158
687 Ga0070717_10260906
688 Ga0075365_10031211
689 Ga0075365_10033631
690 Ga0075365_10109917
691 Ga0075365_10355818
692 Ga0075365_10393982
693 Ga0075365_10662909
694 Ga0075365_10846204
695 Ga0075363_100080667
696 Ga0075363_100093544
697 Ga0075364_10047221
698 Ga0075364_10093862
699 Ga0075432_10000490
700 Ga0075432_10191483
701 Ga0070715_10001341
702 Ga0070715_10592128
703 Ga0070716_100218107
704 Ga0070716_100337713
705 Ga0070712_100005556
706 Ga0070712_100011175
707 Ga0070712_100014542
708 Ga0070712_100273296
709 Ga0070712_100370564
710 Ga0070712_100592416
711 Ga0075362_10041990
712 Ga0075362_10210982
713 Ga0075367_10018677
714 Ga0075367_10339729
715 Ga0075367_10448499
716 Ga0075369_10005227
717 Ga0075369_10030295
718 Ga0075427_10000547
719 Ga0075370_10027028
720 Ga0075370_10653980
721 Ga0068871_100069952
722 Ga0068871_100440836
723 Ga0075428_100003603
724 Ga0075428_100162235
725 Ga0075428_100413213
726 Ga0075428_100474944
727 Ga0075430_100001211
728 Ga0075430_100003714
729 Ga0075430_100192416
730 Ga0075430_100560358
731 Ga0075430_100774510
732 Ga0075431_100003725
733 Ga0075431_100110014
734 Ga0075431_100233206
735 Ga0075431_100882572
736 Ga0075433_10000029
737 Ga0075433_10286600
738 Ga0075433_10733495
739 Ga0075434_100002244
740 Ga0075434_100038251
741 Ga0075434_100057841
742 Ga0075434_100172212
743 Ga0075434_100673902
744 Ga0075434_100688999
745 Ga0075434_101032750
746 Ga0075429_100002021
747 Ga0075429_100224240
748 Ga0075429_100420325
749 Ga0075429_101058910
750 Ga0068865_100073969
751 Ga0068865_100583280
752 Ga0075436_100939343
753 Ga0097620_100181256
754 Ga0075435_100001612
755 Ga0075435_100112378
756 Ga0075435_100189384
757 Ga0075435_101394021
758 Ga0099794_10005115
759 Ga0099794_10043755
760 Ga0099795_10076554
761 Ga0099795_10277495
762 Ga0111539_10000345
763 Ga0111539_10431253
764 Ga0111539_11348998
765 Ga0111539_11488865
766 Ga0111539_12053069
767 Ga0111539_12275760
768 Ga0105245_10061832
769 Ga0105247_10057751
770 Ga0105247_10169651
771 Ga0114129_10024967
772 Ga0114129_10037724
773 Ga0114129_10054577
774 Ga0114129_10143506
775 Ga0114129_10410384
776 Ga0114129_10426801
777 Ga0114129_10597028
778 Ga0114129_10960914
779 Ga0114129_11118693
780 Ga0105243_10728822
781 Ga0105241_10267816
782 Ga0105241_10856688
783 Ga0105242_10017333
784 Ga0105242_10098655
785 Ga0105248_10075676
786 Ga0105248_10098149
787 Ga0105248_10166116
788 Ga0105248_10345526
789 Ga0105237_10279027
790 Ga0105238_10260526
791 Ga0105249_10112429
792 Ga0105249_10439276
793 Ga0099796_10100838
794 Ga0105239_10416553
795 Ga0105239_10491811
796 Ga0105246_10045627
797 Ga0105246_10050504
798 Ga0105246_10119113
799 Ga0105246_11379921
800 Ga0157371_10624613
801 Ga0157374_10098711
802 Ga0157374_10180587
803 Ga0157378_10398825
804 Ga0157378_10760214
805 Ga0163162_10153001
806 Ga0163162_10155808
807 Ga0163162_10277279
808 Ga0163162_10581233
809 Ga0163162_10678063
810 Ga0157372_11028742
811 Ga0157375_10089816
812 Ga0157375_10199902
813 Ga0157375_10743774
814 Ga0157375_10838936
815 Ga0157375_11947078
816 Ga0163163_10109949
817 Ga0163163_10167830
818 Ga0163163_10235906
819 Ga0163163_11770450
820 Ga0163163_12046641
821 Ga0157380_12021878
822 Ga0157377_10074281
823 Ga0157379_10585223
824 Ga0157376_10155619
825 Ga0157376_10368830
826 Ga0157376_10403045
827 Ga0157376_10904189
828 Ga0163161_10988226
829 Ga0207692_10003963
830 Ga0207692_10061381
831 Ga0207692_10076947
832 Ga0207710_10023622
833 Ga0207710_10036699
834 Ga0207688_10017863
835 Ga0207647_10217608
836 Ga0207685_10012249
837 Ga0207699_10008397
838 Ga0207645_10021743
839 Ga0207645_10132803
840 Ga0207643_10001007
841 Ga0207684_10010039
842 Ga0207707_10021935
843 Ga0207707_10264233
844 Ga0207671_10196286
845 Ga0207693_10003360
846 Ga0207693_10004439
847 Ga0207693_10207474
848 Ga0207693_10208737
849 Ga0207693_10372599
850 Ga0207663_10000486
851 Ga0207663_10202552
852 Ga0207660_10057277
853 Ga0207657_10093249
854 Ga0207694_10154997
855 Ga0207650_10005080
856 Ga0207650_10136159
857 Ga0207659_10223731
858 Ga0207700_10002081
859 Ga0207700_10727766
860 Ga0207664_10016398
861 Ga0207664_10258017
862 Ga0207664_10503620
863 Ga0207644_10051022
864 Ga0207644_10077283
865 Ga0207690_10354203
866 Ga0207706_10020138
867 Ga0207706_10022814
868 Ga0207686_10045029
869 Ga0207686_10173869
870 Ga0207709_10053028
871 Ga0207670_10008170
872 Ga0207669_10393917
873 Ga0207665_10110842
874 Ga0207665_10235272
875 Ga0207691_10001764
876 Ga0207711_10014688
877 Ga0207711_10218222
878 Ga0207711_10521236
879 Ga0207689_10026493
880 Ga0207689_10217194
881 Ga0207679_10047412
882 Ga0207667_10725528
883 Ga0207651_10031699
884 Ga0207651_10100373
885 Ga0207651_10376881
886 Ga0207651_10556776
887 Ga0207712_10441614
888 Ga0207668_10094068
889 Ga0207668_10188537
890 Ga0207640_10027600
891 Ga0207658_10024856
892 Ga0207677_10078661
893 Ga0207678_10089779
894 Ga0207708_10001725
895 Ga0207708_10471234
896 Ga0207702_10855083
897 Ga0207641_10146641
898 Ga0207641_11476125
899 Ga0207648_10063493
900 Ga0207676_10024423
901 Ga0207674_11349111
902 Ga0207675_100004083
903 Ga0207683_10016218
904 Ga0207683_10016362
905 Ga0209588_1035516
906 Ga0209588_1051386
907 Ga0209813_10148025
908 Ga0207428_10000360
909 Ga0268266_10116869
910 Ga0268266_11527628
911 Ga0268264_10150016
912 Ga0268264_12038079
913 Ga0265338_10221469
914 Ga0265325_10148594
915 Ga0265340_10182488
916 Ga0316578_10046438
917 Ga0373958_0024929
918 Ga0373926_0037758
919 Ga0373928_0037010
920 Ga0373928_0087099
921 Ga0373940_0013885
922 Ga0373944_0004025
923 Ga0373923_0121703
924 Ga0373936_0044095
925 Ga0373939_0013009
926 Ga0373941_0142642
927 Ga0373945_0027884
928 Ga0373945_0042791
929 Ga0373953_0428976
930 Ga0373960_0007681
931 Ga0373960_0075148
932 Ga0373960_0183955
933 Ga0373943_0161978
934 Ga0373946_0047438
935 Ga0373946_0310194
936 Ga0373942_0239244
937 Ga0373961_0043639
938 Ga0316574_0000991
939 Ga0373931_0014574
940 Ga0373931_0019642
941 Ga0373931_0055890
942 Ga0373931_0491804
943 Ga0373935_0047132
944 Ga0373935_0070775
945 Ga0373935_0305831
946 Ga0373927_0057497
947 Ga0373927_0080180
948 Ga0373927_0164171
949 Ga0373927_0174994
950 Ga0373927_0187727
951 Ga0373947_0012564
952 Ga0373947_0038833
953 Ga0373947_0144587
954 Ga0373937_0039319
955 Ga0373937_0488314
956 Ga0316584_0002919
957 Ga0373925_0038149
958 Ga0373925_0049184
959 Ga0373925_0237378
960 Ga0373925_0304978
961 Ga0373925_0636803
962 Ga0395898_0035487
963 Ga0436360_0700084
964 Ga0436361_0423100
965 Ga0436361_0784595
966 Ga0495592_0213686
967 Ga0495603_0199764
968 Ga0495629_0034266
969 Ga0495629_0085995
970 Ga0495629_0738995
971 Ga0495641_0116184
972 Ga0495641_0238127
973 Ga0495580_0438538
974 Ga0495582_0055105
975 Ga0495605_0314541
976 Ga0495639_0120279
977 Ga0495662_0028782
978 Ga0495584_0058609
979 Ga0495584_0151850
980 Ga0495585_0377340
981 Ga0495607_0145397
982 Ga0495618_0066761
983 Ga0495630_0107721
984 Ga0495631_0111246
985 Ga0495632_0089302
986 Ga0495637_0197768
987 Ga0495644_0056568
988 Ga0495644_0091420
989 Ga0495666_0271516
990 Ga0495640_0073171
991 Ga0495586_0307931
992 Ga0495598_0000697
993 Ga0495621_0014373
994 Ga0495633_0051404
995 Ga0495633_0381595
996 Ga0495656_0027056
997 Ga0495656_0223820
998 Ga0495634_0457855
999 Ga0495611_0398759
1000 Ga0495659_0082625
1001 Ga0495659_0089043
1002 Ga0495588_0075200
1003 Ga0495646_0060832
1004 Ga0495647_0052274
1005 Ga0495658_0136733
1006 Ga0495669_0399290
1007 Ga0495613_0220407
1008 Ga0495624_0037117
1009 Ga0495624_0274570
1010 Ga0495670_0114717
1011 Ga0495671_0082831
1012 Ga0495589_0122776
1013 Ga0495581_0085448
1014 Ga0495581_0142804
1015 Ga0495674_0938364
1016 Ga0495676_0011515
1017 Ga0495676_0283403
1018 Ga0495680_0264560
1019 Ga0495675_0258095
1020 Ga0495684_0208705
1021 Ga0496100_0015167
1022 Ga0496100_0068412
1023 Ga0496100_0116503
1024 Ga0496100_0516548
1025 Ga0496101_0069002
1026 Ga0496101_0179160
1027 Ga0496102_0093039
1028 Ga0496102_0147332
1029 Ga0496102_0232341
1030 Ga0496102_0252608
1031 Ga0496102_0347213
1032 Ga0496102_0610624
1033 Ga0496102_1126085
1034 Ga0496103_0004074
1035 Ga0496103_0063589
1036 Ga0496103_0215903
1037 Ga0496103_0287133
1038 Ga0496103_0434010
1039 Ga0496104_0000423
1040 Ga0496104_0007334
1041 Ga0496104_0011395
1042 Ga0496104_0020816
1043 Ga0496104_0788508
1044 Ga0496105_0001835
1045 Ga0496105_0007095
1046 Ga0496105_0009750
1047 Ga0496105_0039286
1048 Ga0496105_0195712
1049 Ga0496106_0006607
1050 Ga0496106_0064225
1051 Ga0496106_0704417
1052 Ga0496106_1255734
1053 Ga0496107_0015823
1054 Ga0496107_0080479
1055 Ga0496107_0197444
1056 Ga0496108_0002705
1057 Ga0496108_0121535
1058 Ga0496108_0122806
1059 Ga0496108_0155095
1060 Ga0496109_0060020
1061 Ga0496109_0127049
1062 Ga0496109_0166212
1063 Ga0496110_0100439
1064 Ga0496110_0180532
1065 Ga0496110_0214226
1066 Ga0496110_0230444
1067 Ga0496110_1059925
1068 Ga0496111_0018009
1069 Ga0496111_0038288
1070 Ga0496112_0002936
1071 Ga0496112_0005264
1072 Ga0496112_0143306
1073 Ga0496112_0522686
1074 Ga0496113_0000490
1075 Ga0496113_0001007
1076 Ga0496113_0033685
1077 Ga0496113_0499438
1078 Ga0496114_0116176
1079 Ga0496114_0188678
1080 Ga0496114_0225539
1081 Ga0496115_0029636
1082 Ga0496115_0134522
1083 Ga0496115_0189148
1084 Ga0496115_0196538
1085 Ga0496115_0707346
1086 Ga0496115_0891058
1087 Ga0501039_0070850
1088 Ga0501039_0381819
1089 Ga0501040_0128818
1090 Ga0501041_0087520
1091 Ga0501041_0167883
1092 Ga0501041_0777484
1093 Ga0501046_0193715
1094 Ga0501071_0020350
1095 Ga0501072_0002952
1096 Ga0501075_0113745
1097 Ga0501076_0005769
1098 Ga0501076_0173883
1099 Ga0501077_0054650
1100 Ga0501077_0235167
1101 Ga0501079_0070985
1102 Ga0501079_0206782
1103 Ga0501081_0164849
1104 Ga0501081_0423612
1105 Ga0501045_0022424
1106 nmdc:mga03683_133972_c1
1107 nmdc:mga03683_206904_c1
1108 nmdc:mga03683_280655_c1
1109 nmdc:mga03683_85890_c1
1110 nmdc:mga00v17_135166_c1
1111 nmdc:mga00v17_207434_c1
1112 nmdc:mga00v17_24039_c1
1113 nmdc:mga00v17_331092_c1
1114 nmdc:mga0yw44_52089_c1
1115 nmdc:mga0yw44_681053_c1
1116 nmdc:mga0yw44_702181_c1
1117 nmdc:mga0k408_770776_c1
1118 nmdc:mga06z11_10542_c1
1119 nmdc:mga06z11_286623_c1
1120 nmdc:mga04h51_216134_c1
1121 nmdc:mga04h51_272643_c1
1122 nmdc:mga07m45_63519_c1
1123 nmdc:mga05p37_25974_c1
1124 nmdc:mga05p37_2764_c1
1125 nmdc:mga05p37_380774_c1
1126 nmdc:mga05p37_501887_c1
1127 nmdc:mga05p37_558391_c1
1128 nmdc:mga05p37_821929_c1
1129 nmdc:mga05p37_82451_c1
1130 nmdc:mga09592_358275_c1
1131 nmdc:mga09592_524_c1
1132 nmdc:mga09592_669632_c1
1133 nmdc:mga0qj67_4921_c1
1134 nmdc:mga0qj67_85987_c1
1135 nmdc:mga0qj67_94022_c1
1136 nmdc:mga06r32_121_c1
1137 nmdc:mga06r32_52964_c1
1138 nmdc:mga06r32_757985_c1
1139 nmdc:mga08y16_190636_c1
1140 nmdc:mga08y16_5266_c1
1141 nmdc:mga0n895_12320_c1
1142 nmdc:mga0n895_1473767_c1
1143 nmdc:mga0n895_209430_c1
1144 nmdc:mga0n895_2636_c1
1145 nmdc:mga0n895_382904_c1
1146 nmdc:mga0n895_511532_c1
1147 nmdc:mga0n895_795745_c1
1148 nmdc:mga0rr50_143412_c1
1149 nmdc:mga0rr50_232813_c1
1150 nmdc:mga0rr50_3849_c1
1151 nmdc:mga08x19_348641_c1
1152 nmdc:mga0a205_40529_c2
1153 nmdc:mga0a205_487707_c1
1154 nmdc:mga0a205_549_c1
1155 nmdc:mga0a205_61189_c1
1156 nmdc:mga0sz30_13701_c1
1157 Ga0495601_0273309
1158 Ga0495601_0549119
1159 Ga0495655_0006920
1160 Ga0495655_0029147
1161 Ga0495595_0031138
1162 Ga0495595_0187686
1163 Ga0495595_0597313
1164 Ga0495619_0035750
1165 Ga0495619_0196883
1166 Ga0495619_0352315
1167 Ga0500652_000011
1168 Ga0500577_0168867
1169 Ga0500627_0035814
1170 Ga0500636_0005613
1171 Ga0501084_0611874
1172 Ga0501084_0646539
1173 Ga0501082_0118853
1174 Ga0501082_0935103
1175 Ga0530510_0089869
1176 Ga0530510_0092592
1177 Ga0530510_0160063
1178 8001849340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

64

178

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8869 25 156
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8744 25 156
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8578 7 154
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8471 7 154
7bu1-assembly1.cif.gz_A crystal structure of trmo from pseudomonas aeruginosa 0.8312 23 159
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8841 26 156 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8715 26 156 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8679 7 151 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8462 7 151 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8418 26 159 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A537MRQ3-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9143 8 152 GO:0008168
GO:0032259
AF-A0A6A8AIH1-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9092 25 164 GO:0008168
GO:0032259
AF-F2J1E9-F1-model_v4 YaeB-like protein 0.9065 11 164
AF-A0A6N6SW02-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9062 9 160 GO:0008168
GO:0032259
AF-A0A0D6JDL2-F1-model_v4 TsaA-like domain-containing protein 0.9055 9 160

Map