F466821
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 588 | 241 | 587 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300059503|Ga0587080_074552|Ga0587080_074552_205_609 |
| Length | 134 |
| Sequence | LPAAAAGVPLRLPQPKNIQEPNMTKIEAIIQPNRFDVVKKALIDIGVEGMTVSEVRGHGRQKGHKESYRGGEYSVDLLPKVKLETVLQDNVVEAAVNAIITNASTGKIGDGKIFLYKVEEAIRIRSQERGAAAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 158 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 171 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 225 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 3.57 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 1.53 |
| Rhizosphere | 93.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10212188 | 3300001989 | Bacteria | 567 |
| 2 | JGI24737J22298_10083107 | 3300001990 | Bacteria | 952 |
| 3 | Ga0070658_10243472 | 3300005327 | Bacteria | 1525 |
| 4 | Ga0070658_10801807 | 3300005327 | Unclassified | 818 |
| 5 | Ga0070658_11254413 | 3300005327 | Unclassified | 644 |
| 6 | Ga0070683_100007613 | 3300005329 | Bacteria | 9160 |
| 7 | Ga0070683_100009342 | 3300005329 | Bacteria | 8380 |
| 8 | Ga0070683_100074415 | 3300005329 | Bacteria | 3173 |
| 9 | Ga0070683_100490649 | 3300005329 | Bacteria | 1173 |
| 10 | Ga0070683_100595490 | 3300005329 | Bacteria | 1058 |
| 11 | Ga0070683_101252808 | 3300005329 | Bacteria | 713 |
| 12 | Ga0070670_100308523 | 3300005331 | Bacteria | 1385 |
| 13 | Ga0068869_100166301 | 3300005334 | Unclassified | 1720 |
| 14 | Ga0070680_100115864 | 3300005336 | Bacteria | 2233 |
| 15 | Ga0070680_100159325 | 3300005336 | Unclassified | 1896 |
| 16 | Ga0070680_100207879 | 3300005336 | Bacteria | 1651 |
| 17 | Ga0068868_100002892 | 3300005338 | Bacteria | 11916 |
| 18 | Ga0068868_100011357 | 3300005338 | Bacteria | 6486 |
| 19 | Ga0068868_100023407 | 3300005338 | Bacteria | 4675 |
| 20 | Ga0070660_100813462 | 3300005339 | Bacteria | 786 |
| 21 | Ga0070689_100030045 | 3300005340 | Unclassified | 4121 |
| 22 | Ga0070661_100077422 | 3300005344 | Bacteria | 2452 |
| 23 | Ga0070661_100797848 | 3300005344 | Unclassified | 775 |
| 24 | Ga0070661_101391096 | 3300005344 | Unclassified | 590 |
| 25 | Ga0070692_10309238 | 3300005345 | Unclassified | 968 |
| 26 | Ga0070675_100322713 | 3300005354 | Bacteria | 1364 |
| 27 | Ga0070671_100042202 | 3300005355 | Bacteria | 3792 |
| 28 | Ga0070673_102354765 | 3300005364 | Bacteria | 506 |
| 29 | Ga0070659_100181636 | 3300005366 | Bacteria | 1727 |
| 30 | Ga0070659_100522805 | 3300005366 | Bacteria | 1013 |
| 31 | Ga0070667_100516120 | 3300005367 | Bacteria | 1096 |
| 32 | Ga0070709_10099769 | 3300005434 | Bacteria | 1932 |
| 33 | Ga0070714_100001278 | 3300005435 | Bacteria | 18196 |
| 34 | Ga0070714_100146155 | 3300005435 | Bacteria | 2127 |
| 35 | Ga0070714_100317158 | 3300005435 | Bacteria | 1457 |
| 36 | Ga0070714_100712498 | 3300005435 | Bacteria | 969 |
| 37 | Ga0070714_100722815 | 3300005435 | Bacteria | 962 |
| 38 | Ga0070714_100987096 | 3300005435 | Bacteria | 819 |
| 39 | Ga0070714_102029110 | 3300005435 | Unclassified | 561 |
| 40 | Ga0070713_100010422 | 3300005436 | Bacteria | 6712 |
| 41 | Ga0070713_100445816 | 3300005436 | Bacteria | 1215 |
| 42 | Ga0070713_100516815 | 3300005436 | Bacteria | 1128 |
| 43 | Ga0070713_100543498 | 3300005436 | Bacteria | 1099 |
| 44 | Ga0070713_101787737 | 3300005436 | Bacteria | 596 |
| 45 | Ga0070713_101989266 | 3300005436 | Unclassified | 564 |
| 46 | Ga0070713_102345368 | 3300005436 | Unclassified | 516 |
| 47 | Ga0070710_10028217 | 3300005437 | Bacteria | 3000 |
| 48 | Ga0070710_10775431 | 3300005437 | Bacteria | 683 |
| 49 | Ga0070710_11140390 | 3300005437 | Unclassified | 574 |
| 50 | Ga0070711_100077814 | 3300005439 | Bacteria | 2355 |
| 51 | Ga0070711_100116217 | 3300005439 | Bacteria | 1971 |
| 52 | Ga0070711_100125789 | 3300005439 | Bacteria | 1903 |
| 53 | Ga0070711_100233855 | 3300005439 | Bacteria | 1434 |
| 54 | Ga0070711_100980660 | 3300005439 | Unclassified | 724 |
| 55 | Ga0070711_101063622 | 3300005439 | Bacteria | 696 |
| 56 | Ga0070711_101626493 | 3300005439 | Unclassified | 565 |
| 57 | Ga0070694_100875063 | 3300005444 | Unclassified | 740 |
| 58 | Ga0070708_100501425 | 3300005445 | Bacteria | 1145 |
| 59 | Ga0070663_100800547 | 3300005455 | Unclassified | 808 |
| 60 | Ga0070662_100050637 | 3300005457 | Bacteria | 2996 |
| 61 | Ga0070681_10001282 | 3300005458 | Bacteria | 21908 |
| 62 | Ga0070681_10031615 | 3300005458 | Bacteria | 5314 |
| 63 | Ga0070681_10032389 | 3300005458 | Bacteria | 5246 |
| 64 | Ga0070681_10369484 | 3300005458 | Bacteria | 1345 |
| 65 | Ga0070681_10444310 | 3300005458 | Bacteria | 1209 |
| 66 | Ga0068867_100009183 | 3300005459 | Bacteria | 6980 |
| 67 | Ga0068867_100693823 | 3300005459 | Unclassified | 898 |
| 68 | Ga0070685_10923000 | 3300005466 | Bacteria | 651 |
| 69 | Ga0070706_100582375 | 3300005467 | Bacteria | 1040 |
| 70 | Ga0070707_100076196 | 3300005468 | Unclassified | 3236 |
| 71 | Ga0070707_100681989 | 3300005468 | Unclassified | 990 |
| 72 | Ga0070679_100004510 | 3300005530 | Bacteria | 12863 |
| 73 | Ga0070679_100308309 | 3300005530 | Unclassified | 1533 |
| 74 | Ga0070679_100493780 | 3300005530 | Bacteria | 1168 |
| 75 | Ga0070679_100976104 | 3300005530 | Bacteria | 791 |
| 76 | Ga0070684_100117711 | 3300005535 | Bacteria | 2388 |
| 77 | Ga0070684_100151473 | 3300005535 | Bacteria | 2101 |
| 78 | Ga0070684_100165012 | 3300005535 | Bacteria | 2010 |
| 79 | Ga0070684_100280780 | 3300005535 | Bacteria | 1526 |
| 80 | Ga0070684_100814618 | 3300005535 | Bacteria | 873 |
| 81 | Ga0070684_101427488 | 3300005535 | Unclassified | 652 |
| 82 | Ga0068853_100336992 | 3300005539 | Bacteria | 1401 |
| 83 | Ga0068853_100377786 | 3300005539 | Bacteria | 1323 |
| 84 | Ga0068853_100929481 | 3300005539 | Bacteria | 836 |
| 85 | Ga0068853_101286758 | 3300005539 | Bacteria | 707 |
| 86 | Ga0068853_101955511 | 3300005539 | Unclassified | 569 |
| 87 | Ga0068853_101986356 | 3300005539 | Bacteria | 564 |
| 88 | Ga0070672_100308831 | 3300005543 | Bacteria | 1342 |
| 89 | Ga0070672_100628533 | 3300005543 | Bacteria | 937 |
| 90 | Ga0070695_100141018 | 3300005545 | Bacteria | 1671 |
| 91 | Ga0070695_101763695 | 3300005545 | Unclassified | 519 |
| 92 | Ga0070693_100026548 | 3300005547 | Bacteria | 3128 |
| 93 | Ga0070693_100079286 | 3300005547 | Bacteria | 1954 |
| 94 | Ga0070693_100320493 | 3300005547 | Unclassified | 1051 |
| 95 | Ga0070665_100160391 | 3300005548 | Bacteria | 2251 |
| 96 | Ga0068855_100000234 | 3300005563 | Bacteria | 70713 |
| 97 | Ga0068855_100000432 | 3300005563 | Bacteria | 51912 |
| 98 | Ga0068855_100002034 | 3300005563 | Bacteria | 25069 |
| 99 | Ga0068855_100030374 | 3300005563 | Bacteria | 6464 |
| 100 | Ga0068855_100190196 | 3300005563 | Bacteria | 2316 |
| 101 | Ga0068855_100239106 | 3300005563 | Bacteria | 2030 |
| 102 | Ga0068855_101595520 | 3300005563 | Unclassified | 668 |
| 103 | Ga0068855_101675000 | 3300005563 | Unclassified | 649 |
| 104 | Ga0070664_100047322 | 3300005564 | Bacteria | 3633 |
| 105 | Ga0070664_100111666 | 3300005564 | Bacteria | 2386 |
| 106 | Ga0070664_100233340 | 3300005564 | Bacteria | 1650 |
| 107 | Ga0070664_100634760 | 3300005564 | Bacteria | 992 |
| 108 | Ga0068857_100000096 | 3300005577 | Bacteria | 51376 |
| 109 | Ga0068857_100066916 | 3300005577 | Bacteria | 3197 |
| 110 | Ga0068857_100072363 | 3300005577 | Unclassified | 3072 |
| 111 | Ga0068857_100482048 | 3300005577 | Unclassified | 1162 |
| 112 | Ga0068854_100021654 | 3300005578 | Unclassified | 4364 |
| 113 | Ga0068854_100069393 | 3300005578 | Unclassified | 2573 |
| 114 | Ga0068854_101258624 | 3300005578 | Unclassified | 665 |
| 115 | Ga0068856_100000062 | 3300005614 | Bacteria | 100769 |
| 116 | Ga0068856_100000179 | 3300005614 | Bacteria | 66149 |
| 117 | Ga0068856_100002175 | 3300005614 | Bacteria | 20318 |
| 118 | Ga0068856_100006231 | 3300005614 | Bacteria | 11706 |
| 119 | Ga0068856_100056448 | 3300005614 | Bacteria | 3874 |
| 120 | Ga0068856_102060169 | 3300005614 | Unclassified | 581 |
| 121 | Ga0068852_100065418 | 3300005616 | Bacteria | 3172 |
| 122 | Ga0068852_100492136 | 3300005616 | Bacteria | 1220 |
| 123 | Ga0068852_101634655 | 3300005616 | Bacteria | 667 |
| 124 | Ga0068859_100010599 | 3300005617 | Bacteria | 9278 |
| 125 | Ga0068859_100598981 | 3300005617 | Bacteria | 1195 |
| 126 | Ga0068859_100761365 | 3300005617 | Bacteria | 1057 |
| 127 | Ga0068859_102522365 | 3300005617 | Bacteria | 566 |
| 128 | Ga0068864_100000129 | 3300005618 | Bacteria | 73206 |
| 129 | Ga0068864_101078384 | 3300005618 | Bacteria | 799 |
| 130 | Ga0068866_10621363 | 3300005718 | Bacteria | 732 |
| 131 | Ga0068861_100038831 | 3300005719 | Unclassified | 3550 |
| 132 | Ga0068851_10100124 | 3300005834 | Bacteria | 1537 |
| 133 | Ga0068851_10169279 | 3300005834 | Bacteria | 1205 |
| 134 | Ga0068851_10264820 | 3300005834 | Bacteria | 979 |
| 135 | Ga0068870_10316028 | 3300005840 | Unclassified | 991 |
| 136 | Ga0068863_100026366 | 3300005841 | Bacteria | 5545 |
| 137 | Ga0068863_100207531 | 3300005841 | Unclassified | 1886 |
| 138 | Ga0068863_101149075 | 3300005841 | Bacteria | 782 |
| 139 | Ga0068863_102613797 | 3300005841 | Bacteria | 514 |
| 140 | Ga0068858_100022846 | 3300005842 | Bacteria | 5833 |
| 141 | Ga0068858_100025071 | 3300005842 | Bacteria | 5550 |
| 142 | Ga0068858_100030716 | 3300005842 | Unclassified | 4989 |
| 143 | Ga0068858_100631877 | 3300005842 | Bacteria | 1040 |
| 144 | Ga0068860_100062412 | 3300005843 | Bacteria | 3541 |
| 145 | Ga0068860_100819175 | 3300005843 | Bacteria | 945 |
| 146 | Ga0068860_102284396 | 3300005843 | Bacteria | 561 |
| 147 | Ga0068860_102625124 | 3300005843 | Bacteria | 523 |
| 148 | Ga0081455_10004203 | 3300005937 | Bacteria | 16225 |
| 149 | Ga0070717_10008993 | 3300006028 | Bacteria | 7492 |
| 150 | Ga0070717_10009110 | 3300006028 | Bacteria | 7454 |
| 151 | Ga0070717_10022907 | 3300006028 | Bacteria | 4942 |
| 152 | Ga0070717_10391938 | 3300006028 | Bacteria | 1247 |
| 153 | Ga0070717_11177178 | 3300006028 | Unclassified | 698 |
| 154 | Ga0070716_100020959 | 3300006173 | Bacteria | 3439 |
| 155 | Ga0070716_101377353 | 3300006173 | Bacteria | 573 |
| 156 | Ga0070712_100026229 | 3300006175 | Bacteria | 3880 |
| 157 | Ga0070712_100108632 | 3300006175 | Bacteria | 2066 |
| 158 | Ga0070712_100757866 | 3300006175 | Bacteria | 831 |
| 159 | Ga0070712_101030200 | 3300006175 | Bacteria | 713 |
| 160 | Ga0097621_100000196 | 3300006237 | Bacteria | 39296 |
| 161 | Ga0097621_100000326 | 3300006237 | Bacteria | 32263 |
| 162 | Ga0097621_100002114 | 3300006237 | Bacteria | 13601 |
| 163 | Ga0097621_100066365 | 3300006237 | Bacteria | 2972 |
| 164 | Ga0097621_101963939 | 3300006237 | Bacteria | 559 |
| 165 | Ga0068871_100000049 | 3300006358 | Bacteria | 65954 |
| 166 | Ga0068871_100000729 | 3300006358 | Bacteria | 22322 |
| 167 | Ga0068871_100038114 | 3300006358 | Bacteria | 3836 |
| 168 | Ga0068871_101419834 | 3300006358 | Bacteria | 655 |
| 169 | Ga0068871_102055265 | 3300006358 | Unclassified | 544 |
| 170 | Ga0075431_101447682 | 3300006847 | Bacteria | 646 |
| 171 | Ga0068865_100433159 | 3300006881 | Bacteria | 1084 |
| 172 | Ga0075436_100493957 | 3300006914 | Unclassified | 895 |
| 173 | Ga0075436_100693741 | 3300006914 | Unclassified | 754 |
| 174 | Ga0097620_100010599 | 3300006931 | Bacteria | 9278 |
| 175 | Ga0097620_100599037 | 3300006931 | Bacteria | 1195 |
| 176 | Ga0097620_100761191 | 3300006931 | Bacteria | 1057 |
| 177 | Ga0097620_102523503 | 3300006931 | Bacteria | 566 |
| 178 | Ga0105240_10001598 | 3300009093 | Bacteria | 38481 |
| 179 | Ga0105240_10013638 | 3300009093 | Bacteria | 11145 |
| 180 | Ga0105240_10027316 | 3300009093 | Bacteria | 7473 |
| 181 | Ga0105240_10095388 | 3300009093 | Bacteria | 3627 |
| 182 | Ga0105240_10097173 | 3300009093 | Unclassified | 3589 |
| 183 | Ga0105240_10106552 | 3300009093 | Bacteria | 3399 |
| 184 | Ga0105240_10176064 | 3300009093 | Bacteria | 2529 |
| 185 | Ga0105240_10228873 | 3300009093 | Bacteria | 2162 |
| 186 | Ga0105240_10718411 | 3300009093 | Bacteria | 1089 |
| 187 | Ga0105240_11745621 | 3300009093 | Bacteria | 649 |
| 188 | Ga0111539_12382874 | 3300009094 | Bacteria | 614 |
| 189 | Ga0105245_10257481 | 3300009098 | Unclassified | 1697 |
| 190 | Ga0114129_10105829 | 3300009147 | Bacteria | 3887 |
| 191 | Ga0114129_10165238 | 3300009147 | Bacteria | 3021 |
| 192 | Ga0105243_10168691 | 3300009148 | Bacteria | 1894 |
| 193 | Ga0105241_10008156 | 3300009174 | Bacteria | 7712 |
| 194 | Ga0105241_10033741 | 3300009174 | Unclassified | 3843 |
| 195 | Ga0105241_10191313 | 3300009174 | Bacteria | 1704 |
| 196 | Ga0105241_10196967 | 3300009174 | Bacteria | 1680 |
| 197 | Ga0105241_10429589 | 3300009174 | Bacteria | 1164 |
| 198 | Ga0105241_10507246 | 3300009174 | Unclassified | 1077 |
| 199 | Ga0105241_11449856 | 3300009174 | Unclassified | 659 |
| 200 | Ga0105242_10720222 | 3300009176 | Bacteria | 978 |
| 201 | Ga0105242_11653731 | 3300009176 | Unclassified | 675 |
| 202 | Ga0105242_12854410 | 3300009176 | Unclassified | 534 |
| 203 | Ga0105248_10044355 | 3300009177 | Bacteria | 4987 |
| 204 | Ga0105248_10073446 | 3300009177 | Bacteria | 3844 |
| 205 | Ga0105248_10834464 | 3300009177 | Bacteria | 1040 |
| 206 | Ga0105248_12059109 | 3300009177 | Bacteria | 649 |
| 207 | Ga0105248_12863795 | 3300009177 | Bacteria | 550 |
| 208 | Ga0105248_12916198 | 3300009177 | Bacteria | 545 |
| 209 | Ga0105237_10008185 | 3300009545 | Bacteria | 11357 |
| 210 | Ga0105237_10160393 | 3300009545 | Bacteria | 2247 |
| 211 | Ga0105237_10285736 | 3300009545 | Bacteria | 1652 |
| 212 | Ga0105237_10427281 | 3300009545 | Unclassified | 1330 |
| 213 | Ga0105237_11532922 | 3300009545 | Bacteria | 673 |
| 214 | Ga0105237_11562799 | 3300009545 | Unclassified | 667 |
| 215 | Ga0105237_11757953 | 3300009545 | Unclassified | 627 |
| 216 | Ga0105237_11871812 | 3300009545 | Unclassified | 608 |
| 217 | Ga0105238_10000609 | 3300009551 | Bacteria | 37550 |
| 218 | Ga0105238_10139935 | 3300009551 | Bacteria | 2397 |
| 219 | Ga0105238_10240461 | 3300009551 | Bacteria | 1788 |
| 220 | Ga0105238_10397115 | 3300009551 | Unclassified | 1372 |
| 221 | Ga0105238_10758335 | 3300009551 | Bacteria | 985 |
| 222 | Ga0105238_11170002 | 3300009551 | Bacteria | 793 |
| 223 | Ga0105238_11292781 | 3300009551 | Bacteria | 755 |
| 224 | Ga0105238_11564383 | 3300009551 | Unclassified | 689 |
| 225 | Ga0105238_12741458 | 3300009551 | Bacteria | 529 |
| 226 | Ga0105249_10207414 | 3300009553 | Unclassified | 1921 |
| 227 | Ga0105249_10328166 | 3300009553 | Bacteria | 1543 |
| 228 | Ga0105239_10012612 | 3300010375 | Bacteria | 9405 |
| 229 | Ga0105239_10049542 | 3300010375 | Bacteria | 4606 |
| 230 | Ga0105239_10210971 | 3300010375 | Bacteria | 2177 |
| 231 | Ga0105239_10228767 | 3300010375 | Unclassified | 2086 |
| 232 | Ga0105239_10625055 | 3300010375 | Bacteria | 1229 |
| 233 | Ga0105239_11974254 | 3300010375 | Bacteria | 677 |
| 234 | Ga0105239_12662126 | 3300010375 | Unclassified | 583 |
| 235 | Ga0105246_11118563 | 3300011119 | Unclassified | 720 |
| 236 | Ga0157373_10003857 | 3300013100 | Bacteria | 11328 |
| 237 | Ga0157373_10058761 | 3300013100 | Bacteria | 2726 |
| 238 | Ga0157371_10064749 | 3300013102 | Bacteria | 2590 |
| 239 | Ga0157371_10143062 | 3300013102 | Unclassified | 1704 |
| 240 | Ga0157370_10061648 | 3300013104 | Bacteria | 3559 |
| 241 | Ga0157370_10176757 | 3300013104 | Bacteria | 1984 |
| 242 | Ga0157370_10433236 | 3300013104 | Bacteria | 1209 |
| 243 | Ga0157369_10004488 | 3300013105 | Bacteria | 16449 |
| 244 | Ga0157369_10033990 | 3300013105 | Bacteria | 5599 |
| 245 | Ga0157369_10046268 | 3300013105 | Bacteria | 4729 |
| 246 | Ga0157369_10084750 | 3300013105 | Bacteria | 3387 |
| 247 | Ga0157369_10118784 | 3300013105 | Bacteria | 2806 |
| 248 | Ga0157369_10357707 | 3300013105 | Bacteria | 1516 |
| 249 | Ga0157369_10389764 | 3300013105 | Bacteria | 1445 |
| 250 | Ga0157369_10531414 | 3300013105 | Bacteria | 1216 |
| 251 | Ga0157369_10566777 | 3300013105 | Bacteria | 1173 |
| 252 | Ga0157369_10642938 | 3300013105 | Bacteria | 1094 |
| 253 | Ga0157374_10000062 | 3300013296 | Bacteria | 112028 |
| 254 | Ga0157374_10000338 | 3300013296 | Bacteria | 43326 |
| 255 | Ga0157374_10000429 | 3300013296 | Bacteria | 38039 |
| 256 | Ga0157378_10000009 | 3300013297 | Bacteria | 161557 |
| 257 | Ga0157378_10000366 | 3300013297 | Bacteria | 44698 |
| 258 | Ga0157378_10004757 | 3300013297 | Bacteria | 11898 |
| 259 | Ga0157378_11124214 | 3300013297 | Bacteria | 823 |
| 260 | Ga0157378_12706245 | 3300013297 | Bacteria | 548 |
| 261 | Ga0163162_10124391 | 3300013306 | Bacteria | 2685 |
| 262 | Ga0163162_10807745 | 3300013306 | Bacteria | 1055 |
| 263 | Ga0163162_12301952 | 3300013306 | Bacteria | 619 |
| 264 | Ga0157372_10001184 | 3300013307 | Bacteria | 28212 |
| 265 | Ga0157372_10002204 | 3300013307 | Bacteria | 21156 |
| 266 | Ga0157372_10003611 | 3300013307 | Bacteria | 16654 |
| 267 | Ga0157372_10008115 | 3300013307 | Bacteria | 11167 |
| 268 | Ga0157372_10013114 | 3300013307 | Bacteria | 8843 |
| 269 | Ga0157372_10014116 | 3300013307 | Bacteria | 8532 |
| 270 | Ga0157372_10015542 | 3300013307 | Bacteria | 8157 |
| 271 | Ga0157372_10406393 | 3300013307 | Bacteria | 1586 |
| 272 | Ga0157372_10425702 | 3300013307 | Bacteria | 1547 |
| 273 | Ga0157372_10680962 | 3300013307 | Bacteria | 1197 |
| 274 | Ga0157375_10874901 | 3300013308 | Bacteria | 1044 |
| 275 | Ga0163163_10417152 | 3300014325 | Bacteria | 1401 |
| 276 | Ga0163163_10454928 | 3300014325 | Unclassified | 1340 |
| 277 | Ga0163163_11438726 | 3300014325 | Unclassified | 751 |
| 278 | Ga0163163_12442646 | 3300014325 | Bacteria | 581 |
| 279 | Ga0163163_12450965 | 3300014325 | Unclassified | 580 |
| 280 | Ga0157380_10081637 | 3300014326 | Bacteria | 2645 |
| 281 | Ga0157377_10817226 | 3300014745 | Unclassified | 689 |
| 282 | Ga0157379_12659048 | 3300014968 | Bacteria | 502 |
| 283 | Ga0157376_10002214 | 3300014969 | Bacteria | 13108 |
| 284 | Ga0157376_10293308 | 3300014969 | Unclassified | 1536 |
| 285 | Ga0157376_12068267 | 3300014969 | Bacteria | 608 |
| 286 | Ga0163161_11585217 | 3300017792 | Bacteria | 577 |
| 287 | Ga0206355_1332757 | 3300020076 | Unclassified | 539 |
| 288 | Ga0213872_10000901 | 3300021361 | Bacteria | 21377 |
| 289 | Ga0213874_10007619 | 3300021377 | Bacteria | 2607 |
| 290 | Ga0213876_10118354 | 3300021384 | Bacteria | 1406 |
| 291 | Ga0213875_10000038 | 3300021388 | Bacteria | 164463 |
| 292 | Ga0213875_10038772 | 3300021388 | Unclassified | 2245 |
| 293 | Ga0213875_10054195 | 3300021388 | Bacteria | 1878 |
| 294 | Ga0213875_10105552 | 3300021388 | Bacteria | 1315 |
| 295 | Ga0213875_10184044 | 3300021388 | Bacteria | 981 |
| 296 | Ga0213875_10370531 | 3300021388 | Bacteria | 681 |
| 297 | Ga0213875_10406238 | 3300021388 | Bacteria | 650 |
| 298 | Ga0207697_10330820 | 3300025315 | Bacteria | 676 |
| 299 | Ga0207656_10179152 | 3300025321 | Bacteria | 1016 |
| 300 | Ga0207692_10003767 | 3300025898 | Bacteria | 5954 |
| 301 | Ga0207692_10117018 | 3300025898 | Bacteria | 1487 |
| 302 | Ga0207692_10802733 | 3300025898 | Unclassified | 615 |
| 303 | Ga0207692_10872694 | 3300025898 | Bacteria | 591 |
| 304 | Ga0207642_10442919 | 3300025899 | Bacteria | 785 |
| 305 | Ga0207680_10423345 | 3300025903 | Unclassified | 943 |
| 306 | Ga0207647_10015506 | 3300025904 | Bacteria | 5221 |
| 307 | Ga0207699_10120990 | 3300025906 | Bacteria | 1693 |
| 308 | Ga0207699_10464478 | 3300025906 | Bacteria | 910 |
| 309 | Ga0207705_10722407 | 3300025909 | Bacteria | 774 |
| 310 | Ga0207684_10349945 | 3300025910 | Bacteria | 1272 |
| 311 | Ga0207654_10004195 | 3300025911 | Bacteria | 7275 |
| 312 | Ga0207654_10056660 | 3300025911 | Bacteria | 2274 |
| 313 | Ga0207654_10102401 | 3300025911 | Bacteria | 1766 |
| 314 | Ga0207654_10108391 | 3300025911 | Bacteria | 1723 |
| 315 | Ga0207654_10253495 | 3300025911 | Bacteria | 1180 |
| 316 | Ga0207707_10001452 | 3300025912 | Bacteria | 21916 |
| 317 | Ga0207707_10066848 | 3300025912 | Bacteria | 3130 |
| 318 | Ga0207707_10092365 | 3300025912 | Bacteria | 2645 |
| 319 | Ga0207707_10166468 | 3300025912 | Bacteria | 1926 |
| 320 | Ga0207707_11353515 | 3300025912 | Unclassified | 570 |
| 321 | Ga0207695_10025592 | 3300025913 | Bacteria | 6602 |
| 322 | Ga0207695_10025623 | 3300025913 | Bacteria | 6597 |
| 323 | Ga0207695_10040956 | 3300025913 | Unclassified | 4961 |
| 324 | Ga0207695_10053771 | 3300025913 | Bacteria | 4209 |
| 325 | Ga0207695_10136233 | 3300025913 | Bacteria | 2408 |
| 326 | Ga0207695_10172658 | 3300025913 | Bacteria | 2086 |
| 327 | Ga0207695_10204016 | 3300025913 | Bacteria | 1890 |
| 328 | Ga0207695_10332623 | 3300025913 | Bacteria | 1407 |
| 329 | Ga0207695_10748367 | 3300025913 | Bacteria | 858 |
| 330 | Ga0207695_10807886 | 3300025913 | Bacteria | 818 |
| 331 | Ga0207671_10026301 | 3300025914 | Bacteria | 4364 |
| 332 | Ga0207671_10059878 | 3300025914 | Unclassified | 2824 |
| 333 | Ga0207671_10726549 | 3300025914 | Unclassified | 789 |
| 334 | Ga0207693_10010989 | 3300025915 | Bacteria | 7337 |
| 335 | Ga0207693_10075630 | 3300025915 | Bacteria | 2637 |
| 336 | Ga0207693_10483826 | 3300025915 | Bacteria | 966 |
| 337 | Ga0207663_10056900 | 3300025916 | Bacteria | 2462 |
| 338 | Ga0207663_10221568 | 3300025916 | Bacteria | 1377 |
| 339 | Ga0207663_10405041 | 3300025916 | Bacteria | 1044 |
| 340 | Ga0207663_10768890 | 3300025916 | Bacteria | 766 |
| 341 | Ga0207660_10108136 | 3300025917 | Unclassified | 2088 |
| 342 | Ga0207660_10933444 | 3300025917 | Bacteria | 708 |
| 343 | Ga0207657_10892800 | 3300025919 | Bacteria | 685 |
| 344 | Ga0207649_10050789 | 3300025920 | Unclassified | 2566 |
| 345 | Ga0207649_10815561 | 3300025920 | Unclassified | 729 |
| 346 | Ga0207652_10016784 | 3300025921 | Bacteria | 5983 |
| 347 | Ga0207652_10236448 | 3300025921 | Bacteria | 1647 |
| 348 | Ga0207652_10460896 | 3300025921 | Bacteria | 1145 |
| 349 | Ga0207652_10586168 | 3300025921 | Bacteria | 1001 |
| 350 | Ga0207652_11027752 | 3300025921 | Bacteria | 723 |
| 351 | Ga0207646_11287529 | 3300025922 | Unclassified | 639 |
| 352 | Ga0207694_10041105 | 3300025924 | Unclassified | 3562 |
| 353 | Ga0207694_10548857 | 3300025924 | Bacteria | 970 |
| 354 | Ga0207694_10619130 | 3300025924 | Unclassified | 911 |
| 355 | Ga0207694_10856263 | 3300025924 | Unclassified | 768 |
| 356 | Ga0207694_10859073 | 3300025924 | Bacteria | 767 |
| 357 | Ga0207694_11713057 | 3300025924 | Unclassified | 529 |
| 358 | Ga0207650_10007026 | 3300025925 | Bacteria | 7676 |
| 359 | Ga0207687_10575373 | 3300025927 | Bacteria | 947 |
| 360 | Ga0207700_10028987 | 3300025928 | Bacteria | 3901 |
| 361 | Ga0207700_10130146 | 3300025928 | Bacteria | 2054 |
| 362 | Ga0207700_10144308 | 3300025928 | Unclassified | 1960 |
| 363 | Ga0207700_10154738 | 3300025928 | Bacteria | 1898 |
| 364 | Ga0207700_10381119 | 3300025928 | Bacteria | 1233 |
| 365 | Ga0207700_11609580 | 3300025928 | Unclassified | 574 |
| 366 | Ga0207700_11685541 | 3300025928 | Bacteria | 559 |
| 367 | Ga0207700_11775093 | 3300025928 | Unclassified | 543 |
| 368 | Ga0207664_10018085 | 3300025929 | Bacteria | 5179 |
| 369 | Ga0207664_10249767 | 3300025929 | Bacteria | 1548 |
| 370 | Ga0207664_10251371 | 3300025929 | Unclassified | 1543 |
| 371 | Ga0207664_10288312 | 3300025929 | Unclassified | 1442 |
| 372 | Ga0207664_10349480 | 3300025929 | Unclassified | 1308 |
| 373 | Ga0207664_10423162 | 3300025929 | Unclassified | 1186 |
| 374 | Ga0207664_10920092 | 3300025929 | Unclassified | 785 |
| 375 | Ga0207664_10967978 | 3300025929 | Bacteria | 763 |
| 376 | Ga0207690_10139494 | 3300025932 | Bacteria | 1785 |
| 377 | Ga0207706_10773407 | 3300025933 | Bacteria | 817 |
| 378 | Ga0207686_10551604 | 3300025934 | Bacteria | 901 |
| 379 | Ga0207686_11586971 | 3300025934 | Unclassified | 540 |
| 380 | Ga0207670_10011513 | 3300025936 | Bacteria | 5141 |
| 381 | Ga0207704_10080427 | 3300025938 | Bacteria | 2104 |
| 382 | Ga0207704_11345489 | 3300025938 | Bacteria | 611 |
| 383 | Ga0207665_10110320 | 3300025939 | Bacteria | 1932 |
| 384 | Ga0207691_10499161 | 3300025940 | Bacteria | 1033 |
| 385 | Ga0207691_11377275 | 3300025940 | Unclassified | 580 |
| 386 | Ga0207711_10006557 | 3300025941 | Bacteria | 9801 |
| 387 | Ga0207711_10063738 | 3300025941 | Bacteria | 3183 |
| 388 | Ga0207711_10612703 | 3300025941 | Bacteria | 1016 |
| 389 | Ga0207711_11438595 | 3300025941 | Bacteria | 632 |
| 390 | Ga0207689_10623125 | 3300025942 | Bacteria | 908 |
| 391 | Ga0207661_10010786 | 3300025944 | Bacteria | 6589 |
| 392 | Ga0207661_10022700 | 3300025944 | Bacteria | 4731 |
| 393 | Ga0207661_10095051 | 3300025944 | Bacteria | 2491 |
| 394 | Ga0207661_10598872 | 3300025944 | Bacteria | 1011 |
| 395 | Ga0207661_10969924 | 3300025944 | Bacteria | 783 |
| 396 | Ga0207679_10001856 | 3300025945 | Bacteria | 13125 |
| 397 | Ga0207679_10180510 | 3300025945 | Bacteria | 1746 |
| 398 | Ga0207679_10323066 | 3300025945 | Unclassified | 1337 |
| 399 | Ga0207667_10000465 | 3300025949 | Bacteria | 54509 |
| 400 | Ga0207667_10001399 | 3300025949 | Bacteria | 30243 |
| 401 | Ga0207667_10056204 | 3300025949 | Bacteria | 4135 |
| 402 | Ga0207667_10203356 | 3300025949 | Bacteria | 2031 |
| 403 | Ga0207667_10560641 | 3300025949 | Bacteria | 1155 |
| 404 | Ga0207667_11275296 | 3300025949 | Bacteria | 712 |
| 405 | Ga0207651_10562083 | 3300025960 | Bacteria | 993 |
| 406 | Ga0207712_10222593 | 3300025961 | Bacteria | 1510 |
| 407 | Ga0207640_10014902 | 3300025981 | Unclassified | 4487 |
| 408 | Ga0207640_10032902 | 3300025981 | Bacteria | 3220 |
| 409 | Ga0207640_10626605 | 3300025981 | Bacteria | 914 |
| 410 | Ga0207658_10446664 | 3300025986 | Bacteria | 1144 |
| 411 | Ga0207658_11449919 | 3300025986 | Unclassified | 628 |
| 412 | Ga0207677_10010569 | 3300026023 | Bacteria | 5231 |
| 413 | Ga0207677_10013510 | 3300026023 | Bacteria | 4736 |
| 414 | Ga0207677_10086911 | 3300026023 | Bacteria | 2262 |
| 415 | Ga0207703_10022458 | 3300026035 | Bacteria | 4949 |
| 416 | Ga0207703_10088827 | 3300026035 | Bacteria | 2595 |
| 417 | Ga0207703_10109831 | 3300026035 | Unclassified | 2351 |
| 418 | Ga0207703_10750660 | 3300026035 | Bacteria | 930 |
| 419 | Ga0207639_10108956 | 3300026041 | Bacteria | 2253 |
| 420 | Ga0207639_10167310 | 3300026041 | Unclassified | 1859 |
| 421 | Ga0207639_10255152 | 3300026041 | Bacteria | 1531 |
| 422 | Ga0207639_11296254 | 3300026041 | Bacteria | 684 |
| 423 | Ga0207639_12228114 | 3300026041 | Unclassified | 509 |
| 424 | Ga0207678_10527815 | 3300026067 | Bacteria | 1031 |
| 425 | Ga0207702_10001051 | 3300026078 | Bacteria | 28280 |
| 426 | Ga0207702_10008697 | 3300026078 | Bacteria | 8562 |
| 427 | Ga0207702_10010332 | 3300026078 | Bacteria | 7818 |
| 428 | Ga0207702_10184432 | 3300026078 | Unclassified | 1924 |
| 429 | Ga0207702_10372751 | 3300026078 | Bacteria | 1371 |
| 430 | Ga0207641_10020771 | 3300026088 | Bacteria | 5397 |
| 431 | Ga0207641_10119719 | 3300026088 | Bacteria | 2347 |
| 432 | Ga0207648_10015075 | 3300026089 | Bacteria | 7116 |
| 433 | Ga0207648_10937897 | 3300026089 | Unclassified | 809 |
| 434 | Ga0207676_10030937 | 3300026095 | Bacteria | 4022 |
| 435 | Ga0207676_10069123 | 3300026095 | Bacteria | 2827 |
| 436 | Ga0207674_10026851 | 3300026116 | Bacteria | 6107 |
| 437 | Ga0207674_10084204 | 3300026116 | Unclassified | 3178 |
| 438 | Ga0207675_100080251 | 3300026118 | Unclassified | 3059 |
| 439 | Ga0207683_10085205 | 3300026121 | Bacteria | 2809 |
| 440 | Ga0207698_10003245 | 3300026142 | Bacteria | 9767 |
| 441 | Ga0207698_12474937 | 3300026142 | Bacteria | 530 |
| 442 | Ga0268266_10069735 | 3300028379 | Bacteria | 3047 |
| 443 | Ga0268266_11227093 | 3300028379 | Bacteria | 725 |
| 444 | Ga0268264_10086311 | 3300028381 | Unclassified | 2696 |
| 445 | Ga0268264_10316227 | 3300028381 | Bacteria | 1475 |
| 446 | Ga0268264_12239314 | 3300028381 | Bacteria | 554 |
| 447 | Ga0265338_10548520 | 3300028800 | Bacteria | 809 |
| 448 | Ga0265340_10153168 | 3300031247 | Bacteria | 1050 |
| 449 | Ga0265316_10082148 | 3300031344 | Bacteria | 2469 |
| 450 | Ga0373930_0186724 | 3300034816 | Unclassified | 534 |
| 451 | Ga0373926_0181066 | 3300035083 | Bacteria | 808 |
| 452 | Ga0373926_0264381 | 3300035083 | Bacteria | 668 |
| 453 | Ga0373943_0065885 | 3300035170 | Bacteria | 1823 |
| 454 | Ga0373943_0900331 | 3300035170 | Bacteria | 529 |
| 455 | Ga0373935_0062625 | 3300035692 | Bacteria | 2383 |
| 456 | Ga0373927_0193509 | 3300035695 | Bacteria | 1334 |
| 457 | Ga0373927_0509572 | 3300035695 | Bacteria | 795 |
| 458 | Ga0373927_0534642 | 3300035695 | Bacteria | 775 |
| 459 | Ga0373933_0069070 | 3300035724 | Bacteria | 2147 |
| 460 | Ga0373933_1083608 | 3300035724 | Bacteria | 528 |
| 461 | Ga0373947_0326835 | 3300035725 | Bacteria | 1026 |
| 462 | Ga0373947_1027479 | 3300035725 | Bacteria | 562 |
| 463 | Ga0373937_0177714 | 3300036401 | Bacteria | 1998 |
| 464 | Ga0373937_1036859 | 3300036401 | Unclassified | 769 |
| 465 | Ga0373925_0015274 | 3300037068 | Bacteria | 5552 |
| 466 | Ga0373925_0071685 | 3300037068 | Bacteria | 2621 |
| 467 | Ga0436364_0175882 | 3300037853 | Unclassified | 4845 |
| 468 | Ga0436364_0375830 | 3300037853 | Bacteria | 1024 |
| 469 | Ga0436364_0439346 | 3300037853 | Bacteria | 1479 |
| 470 | Ga0436364_0777617 | 3300037853 | Bacteria | 1590 |
| 471 | Ga0436364_0991316 | 3300037853 | Bacteria | 187962 |
| 472 | Ga0436364_1070982 | 3300037853 | Bacteria | 4142 |
| 473 | Ga0436364_1176830 | 3300037853 | Bacteria | 4370 |
| 474 | Ga0436364_1321514 | 3300037853 | Bacteria | 1880 |
| 475 | Ga0436364_1391940 | 3300037853 | Bacteria | 969 |
| 476 | Ga0436364_1419506 | 3300037853 | Unclassified | 887 |
| 477 | Ga0436365_0775650 | 3300039437 | Bacteria | 781 |
| 478 | Ga0436365_1233600 | 3300039437 | Bacteria | 3192 |
| 479 | Ga0436365_1466134 | 3300039437 | Bacteria | 2395 |
| 480 | Ga0436360_0003068 | 3300039438 | Bacteria | 1276 |
| 481 | Ga0436360_0710635 | 3300039438 | Bacteria | 1002 |
| 482 | Ga0436360_0728135 | 3300039438 | Bacteria | 838 |
| 483 | Ga0436361_0779674 | 3300039447 | Bacteria | 61407 |
| 484 | Ga0436363_0817086 | 3300039450 | Bacteria | 799 |
| 485 | Ga0436363_1403142 | 3300039450 | Bacteria | 4242 |
| 486 | Ga0436362_0100795 | 3300039453 | Bacteria | 920 |
| 487 | Ga0451839_1610675 | 3300041496 | Unclassified | 661 |
| 488 | Ga0451577_1156484 | 3300042876 | Bacteria | 691 |
| 489 | Ga0451577_1904137 | 3300042876 | Bacteria | 521 |
| 490 | Ga0466965_0125261 | 3300044683 | Bacteria | 1329 |
| 491 | Ga0466966_0465269 | 3300044684 | Unclassified | 760 |
| 492 | Ga0466961_0046669 | 3300044693 | Bacteria | 2770 |
| 493 | Ga0466963_0009340 | 3300044694 | Bacteria | 5904 |
| 494 | Ga0466963_0047623 | 3300044694 | Bacteria | 2830 |
| 495 | Ga0466963_0987964 | 3300044694 | Bacteria | 593 |
| 496 | Ga0453684_1966378 | 3300044712 | Bacteria | 590 |
| 497 | Ga0466971_0337885 | 3300044719 | Unclassified | 727 |
| 498 | Ga0466970_0799853 | 3300044765 | Unclassified | 552 |
| 499 | Ga0466957_0566169 | 3300044842 | Unclassified | 793 |
| 500 | Ga0466957_0705029 | 3300044842 | Bacteria | 713 |
| 501 | Ga0466959_0802933 | 3300045049 | Unclassified | 629 |
| 502 | Ga0451576_0615759 | 3300045051 | Bacteria | 1141 |
| 503 | Ga0451576_0742037 | 3300045051 | Bacteria | 1031 |
| 504 | Ga0466958_0083327 | 3300045836 | Bacteria | 1971 |
| 505 | Ga0466958_0336930 | 3300045836 | Unclassified | 970 |
| 506 | Ga0466958_0427852 | 3300045836 | Bacteria | 856 |
| 507 | Ga0466958_0938008 | 3300045836 | Bacteria | 565 |
| 508 | Ga0466967_0050558 | 3300045976 | Bacteria | 3640 |
| 509 | Ga0466967_1001197 | 3300045976 | Bacteria | 832 |
| 510 | Ga0466967_2491441 | 3300045976 | Unclassified | 512 |
| 511 | Ga0495592_0113850 | 3300046454 | Bacteria | 1911 |
| 512 | Ga0495651_0074977 | 3300046462 | Bacteria | 2566 |
| 513 | Ga0495653_0598217 | 3300046463 | Bacteria | 678 |
| 514 | Ga0495580_0014909 | 3300046472 | Bacteria | 5886 |
| 515 | Ga0495639_0432943 | 3300046475 | Unclassified | 667 |
| 516 | Ga0495608_0572912 | 3300046511 | Unclassified | 679 |
| 517 | Ga0495628_1024094 | 3300046516 | Unclassified | 567 |
| 518 | Ga0495630_1163026 | 3300046517 | Unclassified | 584 |
| 519 | Ga0495652_0610062 | 3300046529 | Unclassified | 743 |
| 520 | Ga0495652_0770800 | 3300046529 | Bacteria | 642 |
| 521 | Ga0495640_0125202 | 3300046533 | Unclassified | 1667 |
| 522 | Ga0495587_0825897 | 3300046536 | Unclassified | 506 |
| 523 | Ga0495645_0397314 | 3300046543 | Bacteria | 879 |
| 524 | Ga0495645_0634213 | 3300046543 | Bacteria | 654 |
| 525 | Ga0495667_0077874 | 3300046559 | Bacteria | 2156 |
| 526 | Ga0495667_0292892 | 3300046559 | Unclassified | 1032 |
| 527 | Ga0495635_0977871 | 3300046663 | Unclassified | 539 |
| 528 | Ga0495600_0046274 | 3300046809 | Bacteria | 2839 |
| 529 | Ga0495600_0241216 | 3300046809 | Bacteria | 1152 |
| 530 | Ga0495604_0057569 | 3300047317 | Bacteria | 2988 |
| 531 | Ga0495604_0242065 | 3300047317 | Bacteria | 1233 |
| 532 | Ga0495674_0002013 | 3300047319 | Bacteria | 19981 |
| 533 | Ga0495680_0342574 | 3300047322 | Unclassified | 1042 |
| 534 | Ga0495675_0089947 | 3300047444 | Unclassified | 1927 |
| 535 | Ga0495684_0027822 | 3300047471 | Bacteria | 4343 |
| 536 | Ga0495684_0119732 | 3300047471 | Bacteria | 1984 |
| 537 | Ga0495684_0275862 | 3300047471 | Bacteria | 1215 |
| 538 | Ga0495602_0300116 | 3300048088 | Unclassified | 1176 |
| 539 | Ga0495602_0315193 | 3300048088 | Bacteria | 1140 |
| 540 | Ga0495602_0774501 | 3300048088 | Bacteria | 646 |
| 541 | Ga0496102_0207068 | 3300048905 | Bacteria | 1849 |
| 542 | Ga0496102_0634140 | 3300048905 | Bacteria | 992 |
| 543 | Ga0496104_0047477 | 3300048907 | Bacteria | 4047 |
| 544 | Ga0496104_1197291 | 3300048907 | Unclassified | 663 |
| 545 | Ga0496111_0131675 | 3300048914 | Bacteria | 1851 |
| 546 | Ga0496112_0061488 | 3300048915 | Bacteria | 3702 |
| 547 | Ga0496112_0101961 | 3300048915 | Bacteria | 2840 |
| 548 | Ga0496112_0287571 | 3300048915 | Unclassified | 1590 |
| 549 | Ga0496113_0334258 | 3300048916 | Bacteria | 1215 |
| 550 | Ga0496126_0055369 | 3300048929 | Bacteria | 3589 |
| 551 | Ga0501031_0588911 | 3300049568 | Unclassified | 716 |
| 552 | Ga0501032_0938061 | 3300049569 | Unclassified | 544 |
| 553 | Ga0501033_0668672 | 3300049570 | Unclassified | 708 |
| 554 | Ga0501043_0724242 | 3300049579 | Unclassified | 725 |
| 555 | Ga0501067_0176944 | 3300049583 | Bacteria | 1188 |
| 556 | Ga0501067_0442071 | 3300049583 | Unclassified | 726 |
| 557 | Ga0501070_0147947 | 3300049586 | Bacteria | 1938 |
| 558 | Ga0501073_0396171 | 3300049589 | Unclassified | 954 |
| 559 | Ga0501035_0232514 | 3300049822 | Bacteria | 1571 |
| 560 | Ga0501044_0005497 | 3300049823 | Bacteria | 14078 |
| 561 | Ga0501044_0939324 | 3300049823 | Unclassified | 738 |
| 562 | nmdc:mga05p37_304434_c1 | 3300050507 | Bacteria | 1036 |
| 563 | nmdc:mga05p37_857809_c1 | 3300050507 | Bacteria | 985 |
| 564 | nmdc:mga08y16_1375165_c1 | 3300050511 | Bacteria | 670 |
| 565 | nmdc:mga08x19_433291_c1 | 3300050514 | Unclassified | 924 |
| 566 | Ga0500651_0231644 | 3300053093 | Bacteria | 1080 |
| 567 | Ga0587093_112645 | 3300059478 | Unclassified | 502 |
| 568 | Ga0587070_029899 | 3300059491 | Unclassified | 980 |
| 569 | Ga0587077_220757 | 3300059493 | Unclassified | 534 |
| 570 | Ga0587080_017140 | 3300059503 | Unclassified | 1151 |
| 571 | Ga0587080_074552 | 3300059503 | Unclassified | 685 |
| 572 | Ga0587082_024353 | 3300059504 | Unclassified | 1010 |
| 573 | Ga0587083_0003641 | 3300059505 | Unclassified | 2069 |
| 574 | Ga0587083_0020963 | 3300059505 | Unclassified | 1209 |
| 575 | Ga0587083_0196326 | 3300059505 | Bacteria | 574 |
| 576 | Ga0587085_119151 | 3300059506 | Unclassified | 577 |
| 577 | Ga0587088_058513 | 3300059508 | Unclassified | 775 |
| 578 | Ga0587067_104540 | 3300059640 | Unclassified | 660 |
| 579 | Ga0587067_105031 | 3300059640 | Unclassified | 659 |
| 580 | Ga0587076_032544 | 3300059645 | Unclassified | 933 |
| 581 | Ga0587079_101851 | 3300059647 | Unclassified | 687 |
| 582 | Ga0587102_005661 | 3300059649 | Unclassified | 1111 |
| 583 | Ga0587104_020208 | 3300059650 | Unclassified | 551 |
| 584 | Ga0587119_021933 | 3300059658 | Unclassified | 821 |
| 585 | Ga0587081_18343 | 3300060246 | Unclassified | 542 |
| 586 | Ga0587071_016987 | 3300060344 | Unclassified | 1293 |
| 587 | Ga0466962_0180311 | 3300061719 | Bacteria | 1029 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2786546940 | 2788435976 | 108 |
| 2 | 3300001989 | JGI24739J22299_10212188 | JGI24739J22299_102121881 | 112 |
| 3 | 3300001990 | JGI24737J22298_10083107 | JGI24737J22298_100831072 | 112 |
| 4 | 3300005327 | Ga0070658_10243472 | Ga0070658_102434722 | 112 |
| 5 | 3300005327 | Ga0070658_10801807 | Ga0070658_108018071 | 112 |
| 6 | 3300005327 | Ga0070658_11254413 | Ga0070658_112544131 | 112 |
| 7 | 3300005329 | Ga0070683_100007613 | Ga0070683_1000076138 | 112 |
| 8 | 3300005329 | Ga0070683_100009342 | Ga0070683_1000093427 | 112 |
| 9 | 3300005329 | Ga0070683_100074415 | Ga0070683_1000744152 | 112 |
| 10 | 3300005329 | Ga0070683_100490649 | Ga0070683_1004906492 | 112 |
| 11 | 3300005329 | Ga0070683_100595490 | Ga0070683_1005954902 | 112 |
| 12 | 3300005329 | Ga0070683_101252808 | Ga0070683_1012528082 | 112 |
| 13 | 3300005331 | Ga0070670_100308523 | Ga0070670_1003085232 | 112 |
| 14 | 3300005334 | Ga0068869_100166301 | Ga0068869_1001663012 | 112 |
| 15 | 3300005336 | Ga0070680_100115864 | Ga0070680_1001158642 | 112 |
| 16 | 3300005336 | Ga0070680_100159325 | Ga0070680_1001593252 | 112 |
| 17 | 3300005336 | Ga0070680_100207879 | Ga0070680_1002078793 | 112 |
| 18 | 3300005338 | Ga0068868_100002892 | Ga0068868_10000289210 | 112 |
| 19 | 3300005338 | Ga0068868_100011357 | Ga0068868_1000113575 | 112 |
| 20 | 3300005338 | Ga0068868_100023407 | Ga0068868_1000234075 | 112 |
| 21 | 3300005339 | Ga0070660_100813462 | Ga0070660_1008134622 | 112 |
| 22 | 3300005340 | Ga0070689_100030045 | Ga0070689_1000300453 | 112 |
| 23 | 3300005344 | Ga0070661_100077422 | Ga0070661_1000774222 | 112 |
| 24 | 3300005344 | Ga0070661_100797848 | Ga0070661_1007978481 | 112 |
| 25 | 3300005344 | Ga0070661_101391096 | Ga0070661_1013910962 | 112 |
| 26 | 3300005345 | Ga0070692_10309238 | Ga0070692_103092382 | 112 |
| 27 | 3300005354 | Ga0070675_100322713 | Ga0070675_1003227132 | 112 |
| 28 | 3300005355 | Ga0070671_100042202 | Ga0070671_1000422022 | 112 |
| 29 | 3300005364 | Ga0070673_102354765 | Ga0070673_1023547651 | 112 |
| 30 | 3300005366 | Ga0070659_100181636 | Ga0070659_1001816362 | 112 |
| 31 | 3300005366 | Ga0070659_100522805 | Ga0070659_1005228051 | 112 |
| 32 | 3300005367 | Ga0070667_100516120 | Ga0070667_1005161202 | 112 |
| 33 | 3300005434 | Ga0070709_10099769 | Ga0070709_100997693 | 112 |
| 34 | 3300005435 | Ga0070714_100001278 | Ga0070714_10000127814 | 112 |
| 35 | 3300005435 | Ga0070714_100146155 | Ga0070714_1001461553 | 112 |
| 36 | 3300005435 | Ga0070714_100317158 | Ga0070714_1003171583 | 112 |
| 37 | 3300005435 | Ga0070714_100712498 | Ga0070714_1007124982 | 112 |
| 38 | 3300005435 | Ga0070714_100722815 | Ga0070714_1007228152 | 112 |
| 39 | 3300005435 | Ga0070714_100987096 | Ga0070714_1009870961 | 112 |
| 40 | 3300005435 | Ga0070714_102029110 | Ga0070714_1020291101 | 112 |
| 41 | 3300005436 | Ga0070713_100010422 | Ga0070713_1000104222 | 112 |
| 42 | 3300005436 | Ga0070713_100445816 | Ga0070713_1004458162 | 112 |
| 43 | 3300005436 | Ga0070713_100516815 | Ga0070713_1005168152 | 112 |
| 44 | 3300005436 | Ga0070713_100543498 | Ga0070713_1005434982 | 112 |
| 45 | 3300005436 | Ga0070713_101787737 | Ga0070713_1017877371 | 112 |
| 46 | 3300005436 | Ga0070713_101989266 | Ga0070713_1019892661 | 112 |
| 47 | 3300005436 | Ga0070713_102345368 | Ga0070713_1023453682 | 112 |
| 48 | 3300005437 | Ga0070710_10028217 | Ga0070710_100282173 | 112 |
| 49 | 3300005437 | Ga0070710_10775431 | Ga0070710_107754311 | 112 |
| 50 | 3300005437 | Ga0070710_11140390 | Ga0070710_111403902 | 112 |
| 51 | 3300005439 | Ga0070711_100077814 | Ga0070711_1000778142 | 112 |
| 52 | 3300005439 | Ga0070711_100116217 | Ga0070711_1001162172 | 112 |
| 53 | 3300005439 | Ga0070711_100125789 | Ga0070711_1001257892 | 112 |
| 54 | 3300005439 | Ga0070711_100233855 | Ga0070711_1002338552 | 112 |
| 55 | 3300005439 | Ga0070711_100980660 | Ga0070711_1009806601 | 112 |
| 56 | 3300005439 | Ga0070711_101063622 | Ga0070711_1010636222 | 112 |
| 57 | 3300005439 | Ga0070711_101626493 | Ga0070711_1016264931 | 112 |
| 58 | 3300005444 | Ga0070694_100875063 | Ga0070694_1008750631 | 112 |
| 59 | 3300005445 | Ga0070708_100501425 | Ga0070708_1005014252 | 112 |
| 60 | 3300005455 | Ga0070663_100800547 | Ga0070663_1008005472 | 112 |
| 61 | 3300005457 | Ga0070662_100050637 | Ga0070662_1000506373 | 112 |
| 62 | 3300005458 | Ga0070681_10001282 | Ga0070681_1000128218 | 112 |
| 63 | 3300005458 | Ga0070681_10031615 | Ga0070681_100316153 | 112 |
| 64 | 3300005458 | Ga0070681_10032389 | Ga0070681_100323891 | 112 |
| 65 | 3300005458 | Ga0070681_10369484 | Ga0070681_103694842 | 112 |
| 66 | 3300005458 | Ga0070681_10444310 | Ga0070681_104443102 | 112 |
| 67 | 3300005459 | Ga0068867_100009183 | Ga0068867_1000091836 | 112 |
| 68 | 3300005459 | Ga0068867_100693823 | Ga0068867_1006938231 | 112 |
| 69 | 3300005466 | Ga0070685_10923000 | Ga0070685_109230002 | 112 |
| 70 | 3300005467 | Ga0070706_100582375 | Ga0070706_1005823752 | 112 |
| 71 | 3300005468 | Ga0070707_100076196 | Ga0070707_1000761962 | 112 |
| 72 | 3300005468 | Ga0070707_100681989 | Ga0070707_1006819892 | 112 |
| 73 | 3300005530 | Ga0070679_100004510 | Ga0070679_1000045104 | 112 |
| 74 | 3300005530 | Ga0070679_100308309 | Ga0070679_1003083091 | 112 |
| 75 | 3300005530 | Ga0070679_100493780 | Ga0070679_1004937802 | 112 |
| 76 | 3300005530 | Ga0070679_100976104 | Ga0070679_1009761041 | 112 |
| 77 | 3300005535 | Ga0070684_100117711 | Ga0070684_1001177111 | 112 |
| 78 | 3300005535 | Ga0070684_100151473 | Ga0070684_1001514732 | 112 |
| 79 | 3300005535 | Ga0070684_100165012 | Ga0070684_1001650121 | 112 |
| 80 | 3300005535 | Ga0070684_100280780 | Ga0070684_1002807801 | 112 |
| 81 | 3300005535 | Ga0070684_100814618 | Ga0070684_1008146181 | 112 |
| 82 | 3300005535 | Ga0070684_101427488 | Ga0070684_1014274881 | 112 |
| 83 | 3300005539 | Ga0068853_100336992 | Ga0068853_1003369923 | 112 |
| 84 | 3300005539 | Ga0068853_100377786 | Ga0068853_1003777862 | 112 |
| 85 | 3300005539 | Ga0068853_100929481 | Ga0068853_1009294811 | 112 |
| 86 | 3300005539 | Ga0068853_101286758 | Ga0068853_1012867581 | 112 |
| 87 | 3300005539 | Ga0068853_101955511 | Ga0068853_1019555111 | 112 |
| 88 | 3300005539 | Ga0068853_101986356 | Ga0068853_1019863561 | 112 |
| 89 | 3300005543 | Ga0070672_100308831 | Ga0070672_1003088312 | 112 |
| 90 | 3300005543 | Ga0070672_100628533 | Ga0070672_1006285331 | 112 |
| 91 | 3300005545 | Ga0070695_100141018 | Ga0070695_1001410181 | 112 |
| 92 | 3300005545 | Ga0070695_101763695 | Ga0070695_1017636951 | 112 |
| 93 | 3300005547 | Ga0070693_100026548 | Ga0070693_1000265481 | 112 |
| 94 | 3300005547 | Ga0070693_100079286 | Ga0070693_1000792861 | 112 |
| 95 | 3300005547 | Ga0070693_100320493 | Ga0070693_1003204931 | 112 |
| 96 | 3300005548 | Ga0070665_100160391 | Ga0070665_1001603912 | 112 |
| 97 | 3300005563 | Ga0068855_100000234 | Ga0068855_10000023415 | 112 |
| 98 | 3300005563 | Ga0068855_100000432 | Ga0068855_10000043228 | 112 |
| 99 | 3300005563 | Ga0068855_100002034 | Ga0068855_10000203414 | 112 |
| 100 | 3300005563 | Ga0068855_100030374 | Ga0068855_1000303744 | 112 |
| 101 | 3300005563 | Ga0068855_100190196 | Ga0068855_1001901963 | 112 |
| 102 | 3300005563 | Ga0068855_100239106 | Ga0068855_1002391062 | 112 |
| 103 | 3300005563 | Ga0068855_101595520 | Ga0068855_1015955202 | 112 |
| 104 | 3300005563 | Ga0068855_101675000 | Ga0068855_1016750001 | 112 |
| 105 | 3300005564 | Ga0070664_100047322 | Ga0070664_1000473221 | 112 |
| 106 | 3300005564 | Ga0070664_100111666 | Ga0070664_1001116662 | 112 |
| 107 | 3300005564 | Ga0070664_100233340 | Ga0070664_1002333402 | 112 |
| 108 | 3300005564 | Ga0070664_100634760 | Ga0070664_1006347602 | 112 |
| 109 | 3300005577 | Ga0068857_100000096 | Ga0068857_10000009619 | 112 |
| 110 | 3300005577 | Ga0068857_100066916 | Ga0068857_1000669164 | 112 |
| 111 | 3300005577 | Ga0068857_100072363 | Ga0068857_1000723633 | 112 |
| 112 | 3300005577 | Ga0068857_100482048 | Ga0068857_1004820482 | 112 |
| 113 | 3300005578 | Ga0068854_100021654 | Ga0068854_1000216543 | 112 |
| 114 | 3300005578 | Ga0068854_100069393 | Ga0068854_1000693933 | 112 |
| 115 | 3300005578 | Ga0068854_101258624 | Ga0068854_1012586241 | 112 |
| 116 | 3300005614 | Ga0068856_100000062 | Ga0068856_1000000623 | 112 |
| 117 | 3300005614 | Ga0068856_100000179 | Ga0068856_10000017948 | 112 |
| 118 | 3300005614 | Ga0068856_100002175 | Ga0068856_10000217510 | 112 |
| 119 | 3300005614 | Ga0068856_100006231 | Ga0068856_1000062319 | 112 |
| 120 | 3300005614 | Ga0068856_100056448 | Ga0068856_1000564482 | 112 |
| 121 | 3300005614 | Ga0068856_102060169 | Ga0068856_1020601691 | 112 |
| 122 | 3300005616 | Ga0068852_100065418 | Ga0068852_1000654183 | 112 |
| 123 | 3300005616 | Ga0068852_100492136 | Ga0068852_1004921361 | 112 |
| 124 | 3300005616 | Ga0068852_101634655 | Ga0068852_1016346551 | 112 |
| 125 | 3300005617 | Ga0068859_100010599 | Ga0068859_1000105992 | 112 |
| 126 | 3300005617 | Ga0068859_100598981 | Ga0068859_1005989812 | 112 |
| 127 | 3300005617 | Ga0068859_100761365 | Ga0068859_1007613652 | 112 |
| 128 | 3300005617 | Ga0068859_102522365 | Ga0068859_1025223652 | 112 |
| 129 | 3300005618 | Ga0068864_100000129 | Ga0068864_10000012923 | 112 |
| 130 | 3300005618 | Ga0068864_101078384 | Ga0068864_1010783842 | 112 |
| 131 | 3300005718 | Ga0068866_10621363 | Ga0068866_106213632 | 112 |
| 132 | 3300005719 | Ga0068861_100038831 | Ga0068861_1000388312 | 112 |
| 133 | 3300005834 | Ga0068851_10100124 | Ga0068851_101001242 | 112 |
| 134 | 3300005834 | Ga0068851_10169279 | Ga0068851_101692792 | 112 |
| 135 | 3300005834 | Ga0068851_10264820 | Ga0068851_102648201 | 112 |
| 136 | 3300005840 | Ga0068870_10316028 | Ga0068870_103160282 | 112 |
| 137 | 3300005841 | Ga0068863_100026366 | Ga0068863_1000263662 | 112 |
| 138 | 3300005841 | Ga0068863_100207531 | Ga0068863_1002075313 | 112 |
| 139 | 3300005841 | Ga0068863_101149075 | Ga0068863_1011490751 | 112 |
| 140 | 3300005841 | Ga0068863_102613797 | Ga0068863_1026137971 | 112 |
| 141 | 3300005842 | Ga0068858_100022846 | Ga0068858_1000228462 | 112 |
| 142 | 3300005842 | Ga0068858_100025071 | Ga0068858_1000250716 | 112 |
| 143 | 3300005842 | Ga0068858_100030716 | Ga0068858_1000307166 | 112 |
| 144 | 3300005842 | Ga0068858_100631877 | Ga0068858_1006318772 | 112 |
| 145 | 3300005843 | Ga0068860_100062412 | Ga0068860_1000624123 | 112 |
| 146 | 3300005843 | Ga0068860_100819175 | Ga0068860_1008191751 | 112 |
| 147 | 3300005843 | Ga0068860_102284396 | Ga0068860_1022843962 | 112 |
| 148 | 3300005843 | Ga0068860_102625124 | Ga0068860_1026251242 | 112 |
| 149 | 3300005937 | Ga0081455_10004203 | Ga0081455_1000420322 | 112 |
| 150 | 3300006028 | Ga0070717_10008993 | Ga0070717_100089932 | 112 |
| 151 | 3300006028 | Ga0070717_10009110 | Ga0070717_100091104 | 112 |
| 152 | 3300006028 | Ga0070717_10022907 | Ga0070717_100229073 | 112 |
| 153 | 3300006028 | Ga0070717_10391938 | Ga0070717_103919382 | 112 |
| 154 | 3300006028 | Ga0070717_11177178 | Ga0070717_111771781 | 112 |
| 155 | 3300006173 | Ga0070716_100020959 | Ga0070716_1000209591 | 112 |
| 156 | 3300006173 | Ga0070716_101377353 | Ga0070716_1013773531 | 112 |
| 157 | 3300006175 | Ga0070712_100026229 | Ga0070712_1000262292 | 112 |
| 158 | 3300006175 | Ga0070712_100108632 | Ga0070712_1001086322 | 112 |
| 159 | 3300006175 | Ga0070712_100757866 | Ga0070712_1007578661 | 112 |
| 160 | 3300006175 | Ga0070712_101030200 | Ga0070712_1010302001 | 112 |
| 161 | 3300006237 | Ga0097621_100000196 | Ga0097621_10000019635 | 112 |
| 162 | 3300006237 | Ga0097621_100000326 | Ga0097621_10000032627 | 112 |
| 163 | 3300006237 | Ga0097621_100002114 | Ga0097621_10000211416 | 112 |
| 164 | 3300006237 | Ga0097621_100066365 | Ga0097621_1000663652 | 112 |
| 165 | 3300006237 | Ga0097621_101963939 | Ga0097621_1019639391 | 112 |
| 166 | 3300006358 | Ga0068871_100000049 | Ga0068871_10000004926 | 112 |
| 167 | 3300006358 | Ga0068871_100000729 | Ga0068871_10000072920 | 112 |
| 168 | 3300006358 | Ga0068871_100038114 | Ga0068871_1000381144 | 112 |
| 169 | 3300006358 | Ga0068871_101419834 | Ga0068871_1014198341 | 112 |
| 170 | 3300006358 | Ga0068871_102055265 | Ga0068871_1020552652 | 112 |
| 171 | 3300006847 | Ga0075431_101447682 | Ga0075431_1014476821 | 112 |
| 172 | 3300006881 | Ga0068865_100433159 | Ga0068865_1004331591 | 112 |
| 173 | 3300006914 | Ga0075436_100493957 | Ga0075436_1004939572 | 112 |
| 174 | 3300006914 | Ga0075436_100693741 | Ga0075436_1006937411 | 112 |
| 175 | 3300006931 | Ga0097620_100010599 | Ga0097620_1000105992 | 112 |
| 176 | 3300006931 | Ga0097620_100599037 | Ga0097620_1005990372 | 112 |
| 177 | 3300006931 | Ga0097620_100761191 | Ga0097620_1007611912 | 112 |
| 178 | 3300006931 | Ga0097620_102523503 | Ga0097620_1025235031 | 112 |
| 179 | 3300009093 | Ga0105240_10001598 | Ga0105240_1000159819 | 112 |
| 180 | 3300009093 | Ga0105240_10013638 | Ga0105240_1001363811 | 112 |
| 181 | 3300009093 | Ga0105240_10027316 | Ga0105240_100273167 | 112 |
| 182 | 3300009093 | Ga0105240_10095388 | Ga0105240_100953883 | 112 |
| 183 | 3300009093 | Ga0105240_10097173 | Ga0105240_100971731 | 112 |
| 184 | 3300009093 | Ga0105240_10106552 | Ga0105240_101065523 | 112 |
| 185 | 3300009093 | Ga0105240_10176064 | Ga0105240_101760641 | 112 |
| 186 | 3300009093 | Ga0105240_10228873 | Ga0105240_102288732 | 112 |
| 187 | 3300009093 | Ga0105240_10718411 | Ga0105240_107184112 | 112 |
| 188 | 3300009093 | Ga0105240_11745621 | Ga0105240_117456211 | 112 |
| 189 | 3300009094 | Ga0111539_12382874 | Ga0111539_123828742 | 112 |
| 190 | 3300009098 | Ga0105245_10257481 | Ga0105245_102574813 | 112 |
| 191 | 3300009147 | Ga0114129_10105829 | Ga0114129_101058293 | 112 |
| 192 | 3300009147 | Ga0114129_10165238 | Ga0114129_101652382 | 112 |
| 193 | 3300009148 | Ga0105243_10168691 | Ga0105243_101686911 | 112 |
| 194 | 3300009174 | Ga0105241_10008156 | Ga0105241_100081563 | 112 |
| 195 | 3300009174 | Ga0105241_10033741 | Ga0105241_100337413 | 112 |
| 196 | 3300009174 | Ga0105241_10191313 | Ga0105241_101913132 | 112 |
| 197 | 3300009174 | Ga0105241_10196967 | Ga0105241_101969671 | 112 |
| 198 | 3300009174 | Ga0105241_10429589 | Ga0105241_104295892 | 112 |
| 199 | 3300009174 | Ga0105241_10507246 | Ga0105241_105072462 | 112 |
| 200 | 3300009174 | Ga0105241_11449856 | Ga0105241_114498561 | 112 |
| 201 | 3300009176 | Ga0105242_10720222 | Ga0105242_107202222 | 112 |
| 202 | 3300009176 | Ga0105242_11653731 | Ga0105242_116537312 | 112 |
| 203 | 3300009176 | Ga0105242_12854410 | Ga0105242_128544102 | 112 |
| 204 | 3300009177 | Ga0105248_10044355 | Ga0105248_100443552 | 112 |
| 205 | 3300009177 | Ga0105248_10073446 | Ga0105248_100734462 | 112 |
| 206 | 3300009177 | Ga0105248_10834464 | Ga0105248_108344642 | 112 |
| 207 | 3300009177 | Ga0105248_12059109 | Ga0105248_120591092 | 112 |
| 208 | 3300009177 | Ga0105248_12863795 | Ga0105248_128637952 | 112 |
| 209 | 3300009177 | Ga0105248_12916198 | Ga0105248_129161981 | 112 |
| 210 | 3300009545 | Ga0105237_10008185 | Ga0105237_100081852 | 112 |
| 211 | 3300009545 | Ga0105237_10160393 | Ga0105237_101603932 | 112 |
| 212 | 3300009545 | Ga0105237_10285736 | Ga0105237_102857362 | 112 |
| 213 | 3300009545 | Ga0105237_10427281 | Ga0105237_104272811 | 112 |
| 214 | 3300009545 | Ga0105237_11532922 | Ga0105237_115329222 | 112 |
| 215 | 3300009545 | Ga0105237_11562799 | Ga0105237_115627992 | 112 |
| 216 | 3300009545 | Ga0105237_11757953 | Ga0105237_117579531 | 112 |
| 217 | 3300009545 | Ga0105237_11871812 | Ga0105237_118718121 | 112 |
| 218 | 3300009551 | Ga0105238_10000609 | Ga0105238_1000060928 | 112 |
| 219 | 3300009551 | Ga0105238_10139935 | Ga0105238_101399352 | 112 |
| 220 | 3300009551 | Ga0105238_10240461 | Ga0105238_102404611 | 112 |
| 221 | 3300009551 | Ga0105238_10397115 | Ga0105238_103971151 | 112 |
| 222 | 3300009551 | Ga0105238_10758335 | Ga0105238_107583352 | 112 |
| 223 | 3300009551 | Ga0105238_11170002 | Ga0105238_111700022 | 112 |
| 224 | 3300009551 | Ga0105238_11292781 | Ga0105238_112927812 | 112 |
| 225 | 3300009551 | Ga0105238_11564383 | Ga0105238_115643832 | 112 |
| 226 | 3300009551 | Ga0105238_12741458 | Ga0105238_127414582 | 112 |
| 227 | 3300009553 | Ga0105249_10207414 | Ga0105249_102074142 | 112 |
| 228 | 3300009553 | Ga0105249_10328166 | Ga0105249_103281662 | 112 |
| 229 | 3300010375 | Ga0105239_10012612 | Ga0105239_100126125 | 112 |
| 230 | 3300010375 | Ga0105239_10049542 | Ga0105239_100495425 | 112 |
| 231 | 3300010375 | Ga0105239_10210971 | Ga0105239_102109711 | 112 |
| 232 | 3300010375 | Ga0105239_10228767 | Ga0105239_102287672 | 112 |
| 233 | 3300010375 | Ga0105239_10625055 | Ga0105239_106250552 | 112 |
| 234 | 3300010375 | Ga0105239_11974254 | Ga0105239_119742541 | 112 |
| 235 | 3300010375 | Ga0105239_12662126 | Ga0105239_126621261 | 112 |
| 236 | 3300011119 | Ga0105246_11118563 | Ga0105246_111185632 | 112 |
| 237 | 3300013100 | Ga0157373_10003857 | Ga0157373_100038575 | 112 |
| 238 | 3300013100 | Ga0157373_10058761 | Ga0157373_100587614 | 112 |
| 239 | 3300013102 | Ga0157371_10064749 | Ga0157371_100647492 | 112 |
| 240 | 3300013102 | Ga0157371_10143062 | Ga0157371_101430622 | 112 |
| 241 | 3300013104 | Ga0157370_10061648 | Ga0157370_100616482 | 112 |
| 242 | 3300013104 | Ga0157370_10176757 | Ga0157370_101767571 | 112 |
| 243 | 3300013104 | Ga0157370_10433236 | Ga0157370_104332362 | 112 |
| 244 | 3300013105 | Ga0157369_10004488 | Ga0157369_1000448814 | 112 |
| 245 | 3300013105 | Ga0157369_10033990 | Ga0157369_100339905 | 112 |
| 246 | 3300013105 | Ga0157369_10046268 | Ga0157369_100462683 | 112 |
| 247 | 3300013105 | Ga0157369_10084750 | Ga0157369_100847504 | 112 |
| 248 | 3300013105 | Ga0157369_10118784 | Ga0157369_101187842 | 112 |
| 249 | 3300013105 | Ga0157369_10357707 | Ga0157369_103577072 | 112 |
| 250 | 3300013105 | Ga0157369_10389764 | Ga0157369_103897642 | 112 |
| 251 | 3300013105 | Ga0157369_10531414 | Ga0157369_105314142 | 112 |
| 252 | 3300013105 | Ga0157369_10566777 | Ga0157369_105667772 | 112 |
| 253 | 3300013105 | Ga0157369_10642938 | Ga0157369_106429382 | 112 |
| 254 | 3300013296 | Ga0157374_10000062 | Ga0157374_1000006246 | 112 |
| 255 | 3300013296 | Ga0157374_10000338 | Ga0157374_1000033827 | 112 |
| 256 | 3300013296 | Ga0157374_10000429 | Ga0157374_1000042934 | 112 |
| 257 | 3300013297 | Ga0157378_10000009 | Ga0157378_1000000963 | 112 |
| 258 | 3300013297 | Ga0157378_10000366 | Ga0157378_100003666 | 112 |
| 259 | 3300013297 | Ga0157378_10004757 | Ga0157378_1000475711 | 112 |
| 260 | 3300013297 | Ga0157378_11124214 | Ga0157378_111242142 | 112 |
| 261 | 3300013297 | Ga0157378_12706245 | Ga0157378_127062451 | 112 |
| 262 | 3300013306 | Ga0163162_10124391 | Ga0163162_101243912 | 112 |
| 263 | 3300013306 | Ga0163162_10807745 | Ga0163162_108077452 | 112 |
| 264 | 3300013306 | Ga0163162_12301952 | Ga0163162_123019521 | 112 |
| 265 | 3300013307 | Ga0157372_10001184 | Ga0157372_1000118424 | 112 |
| 266 | 3300013307 | Ga0157372_10002204 | Ga0157372_1000220420 | 112 |
| 267 | 3300013307 | Ga0157372_10003611 | Ga0157372_100036115 | 112 |
| 268 | 3300013307 | Ga0157372_10008115 | Ga0157372_100081151 | 112 |
| 269 | 3300013307 | Ga0157372_10013114 | Ga0157372_100131146 | 112 |
| 270 | 3300013307 | Ga0157372_10014116 | Ga0157372_100141165 | 112 |
| 271 | 3300013307 | Ga0157372_10015542 | Ga0157372_100155423 | 112 |
| 272 | 3300013307 | Ga0157372_10406393 | Ga0157372_104063933 | 112 |
| 273 | 3300013307 | Ga0157372_10425702 | Ga0157372_104257022 | 112 |
| 274 | 3300013307 | Ga0157372_10680962 | Ga0157372_106809622 | 112 |
| 275 | 3300013308 | Ga0157375_10874901 | Ga0157375_108749012 | 112 |
| 276 | 3300014325 | Ga0163163_10417152 | Ga0163163_104171522 | 112 |
| 277 | 3300014325 | Ga0163163_10454928 | Ga0163163_104549282 | 112 |
| 278 | 3300014325 | Ga0163163_11438726 | Ga0163163_114387262 | 112 |
| 279 | 3300014325 | Ga0163163_12442646 | Ga0163163_124426461 | 112 |
| 280 | 3300014325 | Ga0163163_12450965 | Ga0163163_124509651 | 112 |
| 281 | 3300014326 | Ga0157380_10081637 | Ga0157380_100816372 | 112 |
| 282 | 3300014745 | Ga0157377_10817226 | Ga0157377_108172261 | 112 |
| 283 | 3300014968 | Ga0157379_12659048 | Ga0157379_126590481 | 112 |
| 284 | 3300014969 | Ga0157376_10002214 | Ga0157376_1000221415 | 112 |
| 285 | 3300014969 | Ga0157376_10293308 | Ga0157376_102933082 | 112 |
| 286 | 3300014969 | Ga0157376_12068267 | Ga0157376_120682672 | 112 |
| 287 | 3300017792 | Ga0163161_11585217 | Ga0163161_115852171 | 112 |
| 288 | 3300020076 | Ga0206355_1332757 | Ga0206355_13327572 | 112 |
| 289 | 3300021361 | Ga0213872_10000901 | Ga0213872_100009017 | 112 |
| 290 | 3300021377 | Ga0213874_10007619 | Ga0213874_100076193 | 112 |
| 291 | 3300021384 | Ga0213876_10118354 | Ga0213876_101183542 | 112 |
| 292 | 3300021388 | Ga0213875_10000038 | Ga0213875_1000003882 | 112 |
| 293 | 3300021388 | Ga0213875_10038772 | Ga0213875_100387722 | 112 |
| 294 | 3300021388 | Ga0213875_10054195 | Ga0213875_100541952 | 112 |
| 295 | 3300021388 | Ga0213875_10105552 | Ga0213875_101055522 | 112 |
| 296 | 3300021388 | Ga0213875_10184044 | Ga0213875_101840442 | 112 |
| 297 | 3300021388 | Ga0213875_10370531 | Ga0213875_103705311 | 112 |
| 298 | 3300021388 | Ga0213875_10406238 | Ga0213875_104062382 | 112 |
| 299 | 3300025315 | Ga0207697_10330820 | Ga0207697_103308202 | 112 |
| 300 | 3300025321 | Ga0207656_10179152 | Ga0207656_101791522 | 112 |
| 301 | 3300025898 | Ga0207692_10003767 | Ga0207692_100037674 | 112 |
| 302 | 3300025898 | Ga0207692_10117018 | Ga0207692_101170181 | 112 |
| 303 | 3300025898 | Ga0207692_10802733 | Ga0207692_108027331 | 112 |
| 304 | 3300025898 | Ga0207692_10872694 | Ga0207692_108726941 | 112 |
| 305 | 3300025899 | Ga0207642_10442919 | Ga0207642_104429191 | 112 |
| 306 | 3300025903 | Ga0207680_10423345 | Ga0207680_104233452 | 112 |
| 307 | 3300025904 | Ga0207647_10015506 | Ga0207647_100155065 | 112 |
| 308 | 3300025906 | Ga0207699_10120990 | Ga0207699_101209902 | 112 |
| 309 | 3300025906 | Ga0207699_10464478 | Ga0207699_104644782 | 112 |
| 310 | 3300025909 | Ga0207705_10722407 | Ga0207705_107224072 | 112 |
| 311 | 3300025910 | Ga0207684_10349945 | Ga0207684_103499452 | 112 |
| 312 | 3300025911 | Ga0207654_10004195 | Ga0207654_100041956 | 112 |
| 313 | 3300025911 | Ga0207654_10056660 | Ga0207654_100566602 | 112 |
| 314 | 3300025911 | Ga0207654_10102401 | Ga0207654_101024011 | 112 |
| 315 | 3300025911 | Ga0207654_10108391 | Ga0207654_101083913 | 112 |
| 316 | 3300025911 | Ga0207654_10253495 | Ga0207654_102534952 | 112 |
| 317 | 3300025912 | Ga0207707_10001452 | Ga0207707_100014526 | 112 |
| 318 | 3300025912 | Ga0207707_10066848 | Ga0207707_100668482 | 112 |
| 319 | 3300025912 | Ga0207707_10092365 | Ga0207707_100923652 | 112 |
| 320 | 3300025912 | Ga0207707_10166468 | Ga0207707_101664682 | 112 |
| 321 | 3300025912 | Ga0207707_11353515 | Ga0207707_113535152 | 112 |
| 322 | 3300025913 | Ga0207695_10025592 | Ga0207695_100255926 | 112 |
| 323 | 3300025913 | Ga0207695_10025623 | Ga0207695_100256235 | 112 |
| 324 | 3300025913 | Ga0207695_10040956 | Ga0207695_100409562 | 112 |
| 325 | 3300025913 | Ga0207695_10053771 | Ga0207695_100537715 | 112 |
| 326 | 3300025913 | Ga0207695_10136233 | Ga0207695_101362331 | 112 |
| 327 | 3300025913 | Ga0207695_10172658 | Ga0207695_101726582 | 112 |
| 328 | 3300025913 | Ga0207695_10204016 | Ga0207695_102040161 | 112 |
| 329 | 3300025913 | Ga0207695_10332623 | Ga0207695_103326231 | 112 |
| 330 | 3300025913 | Ga0207695_10748367 | Ga0207695_107483672 | 112 |
| 331 | 3300025913 | Ga0207695_10807886 | Ga0207695_108078862 | 112 |
| 332 | 3300025914 | Ga0207671_10026301 | Ga0207671_100263012 | 112 |
| 333 | 3300025914 | Ga0207671_10059878 | Ga0207671_100598781 | 112 |
| 334 | 3300025914 | Ga0207671_10726549 | Ga0207671_107265491 | 112 |
| 335 | 3300025915 | Ga0207693_10010989 | Ga0207693_100109898 | 112 |
| 336 | 3300025915 | Ga0207693_10075630 | Ga0207693_100756301 | 112 |
| 337 | 3300025915 | Ga0207693_10483826 | Ga0207693_104838261 | 112 |
| 338 | 3300025916 | Ga0207663_10056900 | Ga0207663_100569002 | 112 |
| 339 | 3300025916 | Ga0207663_10221568 | Ga0207663_102215681 | 112 |
| 340 | 3300025916 | Ga0207663_10405041 | Ga0207663_104050412 | 112 |
| 341 | 3300025916 | Ga0207663_10768890 | Ga0207663_107688902 | 112 |
| 342 | 3300025917 | Ga0207660_10108136 | Ga0207660_101081362 | 112 |
| 343 | 3300025917 | Ga0207660_10933444 | Ga0207660_109334442 | 112 |
| 344 | 3300025919 | Ga0207657_10892800 | Ga0207657_108928002 | 112 |
| 345 | 3300025920 | Ga0207649_10050789 | Ga0207649_100507892 | 112 |
| 346 | 3300025920 | Ga0207649_10815561 | Ga0207649_108155612 | 112 |
| 347 | 3300025921 | Ga0207652_10016784 | Ga0207652_100167842 | 112 |
| 348 | 3300025921 | Ga0207652_10236448 | Ga0207652_102364482 | 112 |
| 349 | 3300025921 | Ga0207652_10460896 | Ga0207652_104608962 | 112 |
| 350 | 3300025921 | Ga0207652_10586168 | Ga0207652_105861681 | 112 |
| 351 | 3300025921 | Ga0207652_11027752 | Ga0207652_110277522 | 112 |
| 352 | 3300025922 | Ga0207646_11287529 | Ga0207646_112875291 | 112 |
| 353 | 3300025924 | Ga0207694_10041105 | Ga0207694_100411052 | 112 |
| 354 | 3300025924 | Ga0207694_10548857 | Ga0207694_105488572 | 112 |
| 355 | 3300025924 | Ga0207694_10619130 | Ga0207694_106191302 | 112 |
| 356 | 3300025924 | Ga0207694_10856263 | Ga0207694_108562631 | 112 |
| 357 | 3300025924 | Ga0207694_10859073 | Ga0207694_108590731 | 112 |
| 358 | 3300025924 | Ga0207694_11713057 | Ga0207694_117130572 | 112 |
| 359 | 3300025925 | Ga0207650_10007026 | Ga0207650_100070262 | 112 |
| 360 | 3300025927 | Ga0207687_10575373 | Ga0207687_105753732 | 112 |
| 361 | 3300025928 | Ga0207700_10028987 | Ga0207700_100289874 | 112 |
| 362 | 3300025928 | Ga0207700_10130146 | Ga0207700_101301462 | 112 |
| 363 | 3300025928 | Ga0207700_10144308 | Ga0207700_101443082 | 112 |
| 364 | 3300025928 | Ga0207700_10154738 | Ga0207700_101547382 | 112 |
| 365 | 3300025928 | Ga0207700_10381119 | Ga0207700_103811191 | 112 |
| 366 | 3300025928 | Ga0207700_11609580 | Ga0207700_116095801 | 112 |
| 367 | 3300025928 | Ga0207700_11685541 | Ga0207700_116855411 | 112 |
| 368 | 3300025928 | Ga0207700_11775093 | Ga0207700_117750932 | 112 |
| 369 | 3300025929 | Ga0207664_10018085 | Ga0207664_100180853 | 112 |
| 370 | 3300025929 | Ga0207664_10249767 | Ga0207664_102497672 | 112 |
| 371 | 3300025929 | Ga0207664_10251371 | Ga0207664_102513712 | 112 |
| 372 | 3300025929 | Ga0207664_10288312 | Ga0207664_102883121 | 112 |
| 373 | 3300025929 | Ga0207664_10349480 | Ga0207664_103494802 | 112 |
| 374 | 3300025929 | Ga0207664_10423162 | Ga0207664_104231621 | 112 |
| 375 | 3300025929 | Ga0207664_10920092 | Ga0207664_109200922 | 112 |
| 376 | 3300025929 | Ga0207664_10967978 | Ga0207664_109679782 | 112 |
| 377 | 3300025932 | Ga0207690_10139494 | Ga0207690_101394942 | 112 |
| 378 | 3300025933 | Ga0207706_10773407 | Ga0207706_107734072 | 112 |
| 379 | 3300025934 | Ga0207686_10551604 | Ga0207686_105516041 | 112 |
| 380 | 3300025934 | Ga0207686_11586971 | Ga0207686_115869711 | 112 |
| 381 | 3300025936 | Ga0207670_10011513 | Ga0207670_100115135 | 112 |
| 382 | 3300025938 | Ga0207704_10080427 | Ga0207704_100804272 | 112 |
| 383 | 3300025938 | Ga0207704_11345489 | Ga0207704_113454892 | 112 |
| 384 | 3300025939 | Ga0207665_10110320 | Ga0207665_101103202 | 112 |
| 385 | 3300025940 | Ga0207691_10499161 | Ga0207691_104991612 | 112 |
| 386 | 3300025940 | Ga0207691_11377275 | Ga0207691_113772751 | 112 |
| 387 | 3300025941 | Ga0207711_10006557 | Ga0207711_100065572 | 112 |
| 388 | 3300025941 | Ga0207711_10063738 | Ga0207711_100637382 | 112 |
| 389 | 3300025941 | Ga0207711_10612703 | Ga0207711_106127031 | 112 |
| 390 | 3300025941 | Ga0207711_11438595 | Ga0207711_114385951 | 112 |
| 391 | 3300025942 | Ga0207689_10623125 | Ga0207689_106231252 | 112 |
| 392 | 3300025944 | Ga0207661_10010786 | Ga0207661_100107866 | 112 |
| 393 | 3300025944 | Ga0207661_10022700 | Ga0207661_100227002 | 112 |
| 394 | 3300025944 | Ga0207661_10095051 | Ga0207661_100950512 | 112 |
| 395 | 3300025944 | Ga0207661_10598872 | Ga0207661_105988721 | 112 |
| 396 | 3300025944 | Ga0207661_10969924 | Ga0207661_109699241 | 112 |
| 397 | 3300025945 | Ga0207679_10001856 | Ga0207679_100018563 | 112 |
| 398 | 3300025945 | Ga0207679_10180510 | Ga0207679_101805102 | 112 |
| 399 | 3300025945 | Ga0207679_10323066 | Ga0207679_103230661 | 112 |
| 400 | 3300025949 | Ga0207667_10000465 | Ga0207667_1000046531 | 112 |
| 401 | 3300025949 | Ga0207667_10001399 | Ga0207667_1000139922 | 112 |
| 402 | 3300025949 | Ga0207667_10056204 | Ga0207667_100562044 | 112 |
| 403 | 3300025949 | Ga0207667_10203356 | Ga0207667_102033562 | 112 |
| 404 | 3300025949 | Ga0207667_10560641 | Ga0207667_105606411 | 112 |
| 405 | 3300025949 | Ga0207667_11275296 | Ga0207667_112752962 | 112 |
| 406 | 3300025960 | Ga0207651_10562083 | Ga0207651_105620831 | 112 |
| 407 | 3300025961 | Ga0207712_10222593 | Ga0207712_102225932 | 112 |
| 408 | 3300025981 | Ga0207640_10014902 | Ga0207640_100149022 | 112 |
| 409 | 3300025981 | Ga0207640_10032902 | Ga0207640_100329023 | 112 |
| 410 | 3300025981 | Ga0207640_10626605 | Ga0207640_106266051 | 112 |
| 411 | 3300025986 | Ga0207658_10446664 | Ga0207658_104466642 | 112 |
| 412 | 3300025986 | Ga0207658_11449919 | Ga0207658_114499192 | 112 |
| 413 | 3300026023 | Ga0207677_10010569 | Ga0207677_100105695 | 112 |
| 414 | 3300026023 | Ga0207677_10013510 | Ga0207677_100135104 | 112 |
| 415 | 3300026023 | Ga0207677_10086911 | Ga0207677_100869111 | 112 |
| 416 | 3300026035 | Ga0207703_10022458 | Ga0207703_100224582 | 112 |
| 417 | 3300026035 | Ga0207703_10088827 | Ga0207703_100888272 | 112 |
| 418 | 3300026035 | Ga0207703_10109831 | Ga0207703_101098312 | 112 |
| 419 | 3300026035 | Ga0207703_10750660 | Ga0207703_107506602 | 112 |
| 420 | 3300026041 | Ga0207639_10108956 | Ga0207639_101089562 | 112 |
| 421 | 3300026041 | Ga0207639_10167310 | Ga0207639_101673103 | 112 |
| 422 | 3300026041 | Ga0207639_10255152 | Ga0207639_102551522 | 112 |
| 423 | 3300026041 | Ga0207639_11296254 | Ga0207639_112962542 | 112 |
| 424 | 3300026041 | Ga0207639_12228114 | Ga0207639_122281141 | 112 |
| 425 | 3300026067 | Ga0207678_10527815 | Ga0207678_105278152 | 112 |
| 426 | 3300026078 | Ga0207702_10001051 | Ga0207702_100010515 | 112 |
| 427 | 3300026078 | Ga0207702_10008697 | Ga0207702_100086973 | 112 |
| 428 | 3300026078 | Ga0207702_10010332 | Ga0207702_100103326 | 112 |
| 429 | 3300026078 | Ga0207702_10184432 | Ga0207702_101844322 | 112 |
| 430 | 3300026078 | Ga0207702_10372751 | Ga0207702_103727512 | 112 |
| 431 | 3300026088 | Ga0207641_10020771 | Ga0207641_100207715 | 112 |
| 432 | 3300026088 | Ga0207641_10119719 | Ga0207641_101197192 | 112 |
| 433 | 3300026089 | Ga0207648_10015075 | Ga0207648_100150753 | 112 |
| 434 | 3300026089 | Ga0207648_10937897 | Ga0207648_109378971 | 112 |
| 435 | 3300026095 | Ga0207676_10030937 | Ga0207676_100309372 | 112 |
| 436 | 3300026095 | Ga0207676_10069123 | Ga0207676_100691232 | 112 |
| 437 | 3300026116 | Ga0207674_10026851 | Ga0207674_100268515 | 112 |
| 438 | 3300026116 | Ga0207674_10084204 | Ga0207674_100842044 | 112 |
| 439 | 3300026118 | Ga0207675_100080251 | Ga0207675_1000802514 | 112 |
| 440 | 3300026121 | Ga0207683_10085205 | Ga0207683_100852052 | 112 |
| 441 | 3300026142 | Ga0207698_10003245 | Ga0207698_100032458 | 112 |
| 442 | 3300026142 | Ga0207698_12474937 | Ga0207698_124749372 | 112 |
| 443 | 3300028379 | Ga0268266_10069735 | Ga0268266_100697352 | 112 |
| 444 | 3300028379 | Ga0268266_11227093 | Ga0268266_112270932 | 112 |
| 445 | 3300028381 | Ga0268264_10086311 | Ga0268264_100863113 | 112 |
| 446 | 3300028381 | Ga0268264_10316227 | Ga0268264_103162272 | 112 |
| 447 | 3300028381 | Ga0268264_12239314 | Ga0268264_122393141 | 112 |
| 448 | 3300028800 | Ga0265338_10548520 | Ga0265338_105485201 | 112 |
| 449 | 3300031247 | Ga0265340_10153168 | Ga0265340_101531683 | 112 |
| 450 | 3300031344 | Ga0265316_10082148 | Ga0265316_100821482 | 112 |
| 451 | 3300034816 | Ga0373930_0186724 | Ga0373930_0186724_18_356 | 112 |
| 452 | 3300035083 | Ga0373926_0181066 | Ga0373926_0181066_223_561 | 112 |
| 453 | 3300035083 | Ga0373926_0264381 | Ga0373926_0264381_163_501 | 112 |
| 454 | 3300035170 | Ga0373943_0065885 | Ga0373943_0065885_142_480 | 112 |
| 455 | 3300035170 | Ga0373943_0900331 | Ga0373943_0900331_96_434 | 112 |
| 456 | 3300035692 | Ga0373935_0062625 | Ga0373935_0062625_1233_1571 | 112 |
| 457 | 3300035695 | Ga0373927_0193509 | Ga0373927_0193509_625_963 | 112 |
| 458 | 3300035695 | Ga0373927_0509572 | Ga0373927_0509572_268_606 | 112 |
| 459 | 3300035695 | Ga0373927_0534642 | Ga0373927_0534642_293_631 | 112 |
| 460 | 3300035724 | Ga0373933_0069070 | Ga0373933_0069070_1589_1927 | 112 |
| 461 | 3300035724 | Ga0373933_1083608 | Ga0373933_1083608_141_479 | 112 |
| 462 | 3300035725 | Ga0373947_0326835 | Ga0373947_0326835_337_675 | 112 |
| 463 | 3300035725 | Ga0373947_1027479 | Ga0373947_1027479_59_397 | 112 |
| 464 | 3300036401 | Ga0373937_0177714 | Ga0373937_0177714_21_362 | 112 |
| 465 | 3300036401 | Ga0373937_1036859 | Ga0373937_1036859_235_573 | 112 |
| 466 | 3300037068 | Ga0373925_0015274 | Ga0373925_0015274_3067_3405 | 112 |
| 467 | 3300037068 | Ga0373925_0071685 | Ga0373925_0071685_377_715 | 112 |
| 468 | 3300037853 | Ga0436364_0175882 | Ga0436364_0175882_4020_4358 | 112 |
| 469 | 3300037853 | Ga0436364_0375830 | Ga0436364_0375830_140_478 | 112 |
| 470 | 3300037853 | Ga0436364_0439346 | Ga0436364_0439346_641_979 | 112 |
| 471 | 3300037853 | Ga0436364_0777617 | Ga0436364_0777617_450_788 | 112 |
| 472 | 3300037853 | Ga0436364_0991316 | Ga0436364_0991316_178355_178693 | 112 |
| 473 | 3300037853 | Ga0436364_1070982 | Ga0436364_1070982_2533_2871 | 112 |
| 474 | 3300037853 | Ga0436364_1176830 | Ga0436364_1176830_362_700 | 112 |
| 475 | 3300037853 | Ga0436364_1321514 | Ga0436364_1321514_1481_1819 | 112 |
| 476 | 3300037853 | Ga0436364_1391940 | Ga0436364_1391940_298_636 | 112 |
| 477 | 3300037853 | Ga0436364_1419506 | Ga0436364_1419506_536_874 | 112 |
| 478 | 3300039437 | Ga0436365_0775650 | Ga0436365_0775650_352_690 | 112 |
| 479 | 3300039437 | Ga0436365_1233600 | Ga0436365_1233600_903_1241 | 112 |
| 480 | 3300039437 | Ga0436365_1466134 | Ga0436365_1466134_252_590 | 112 |
| 481 | 3300039438 | Ga0436360_0003068 | Ga0436360_0003068_476_814 | 112 |
| 482 | 3300039438 | Ga0436360_0710635 | Ga0436360_0710635_368_706 | 112 |
| 483 | 3300039438 | Ga0436360_0728135 | Ga0436360_0728135_121_459 | 112 |
| 484 | 3300039447 | Ga0436361_0779674 | Ga0436361_0779674_13809_14147 | 112 |
| 485 | 3300039450 | Ga0436363_0817086 | Ga0436363_0817086_118_456 | 112 |
| 486 | 3300039450 | Ga0436363_1403142 | Ga0436363_1403142_2248_2586 | 112 |
| 487 | 3300039453 | Ga0436362_0100795 | Ga0436362_0100795_78_416 | 112 |
| 488 | 3300041496 | Ga0451839_1610675 | Ga0451839_1610675_307_645 | 112 |
| 489 | 3300042876 | Ga0451577_1156484 | Ga0451577_1156484_49_387 | 112 |
| 490 | 3300042876 | Ga0451577_1904137 | Ga0451577_1904137_52_390 | 112 |
| 491 | 3300044683 | Ga0466965_0125261 | Ga0466965_0125261_431_769 | 112 |
| 492 | 3300044684 | Ga0466966_0465269 | Ga0466966_0465269_367_705 | 112 |
| 493 | 3300044693 | Ga0466961_0046669 | Ga0466961_0046669_371_709 | 112 |
| 494 | 3300044694 | Ga0466963_0009340 | Ga0466963_0009340_3107_3445 | 112 |
| 495 | 3300044694 | Ga0466963_0047623 | Ga0466963_0047623_1989_2327 | 112 |
| 496 | 3300044694 | Ga0466963_0987964 | Ga0466963_0987964_156_494 | 112 |
| 497 | 3300044712 | Ga0453684_1966378 | Ga0453684_1966378_234_572 | 112 |
| 498 | 3300044719 | Ga0466971_0337885 | Ga0466971_0337885_211_549 | 112 |
| 499 | 3300044765 | Ga0466970_0799853 | Ga0466970_0799853_164_502 | 112 |
| 500 | 3300044842 | Ga0466957_0566169 | Ga0466957_0566169_219_557 | 112 |
| 501 | 3300044842 | Ga0466957_0705029 | Ga0466957_0705029_161_499 | 112 |
| 502 | 3300045049 | Ga0466959_0802933 | Ga0466959_0802933_226_564 | 112 |
| 503 | 3300045051 | Ga0451576_0615759 | Ga0451576_0615759_19_357 | 112 |
| 504 | 3300045051 | Ga0451576_0742037 | Ga0451576_0742037_506_844 | 112 |
| 505 | 3300045836 | Ga0466958_0083327 | Ga0466958_0083327_1607_1945 | 112 |
| 506 | 3300045836 | Ga0466958_0336930 | Ga0466958_0336930_607_945 | 112 |
| 507 | 3300045836 | Ga0466958_0427852 | Ga0466958_0427852_179_517 | 112 |
| 508 | 3300045836 | Ga0466958_0938008 | Ga0466958_0938008_67_405 | 112 |
| 509 | 3300045976 | Ga0466967_0050558 | Ga0466967_0050558_971_1309 | 112 |
| 510 | 3300045976 | Ga0466967_1001197 | Ga0466967_1001197_30_368 | 112 |
| 511 | 3300045976 | Ga0466967_2491441 | Ga0466967_2491441_47_448 | 112 |
| 512 | 3300046454 | Ga0495592_0113850 | Ga0495592_0113850_117_455 | 112 |
| 513 | 3300046462 | Ga0495651_0074977 | Ga0495651_0074977_191_529 | 112 |
| 514 | 3300046463 | Ga0495653_0598217 | Ga0495653_0598217_225_563 | 112 |
| 515 | 3300046472 | Ga0495580_0014909 | Ga0495580_0014909_4606_4944 | 112 |
| 516 | 3300046475 | Ga0495639_0432943 | Ga0495639_0432943_237_575 | 112 |
| 517 | 3300046511 | Ga0495608_0572912 | Ga0495608_0572912_290_631 | 112 |
| 518 | 3300046516 | Ga0495628_1024094 | Ga0495628_1024094_107_445 | 112 |
| 519 | 3300046517 | Ga0495630_1163026 | Ga0495630_1163026_184_522 | 112 |
| 520 | 3300046529 | Ga0495652_0610062 | Ga0495652_0610062_219_560 | 112 |
| 521 | 3300046529 | Ga0495652_0770800 | Ga0495652_0770800_233_571 | 112 |
| 522 | 3300046533 | Ga0495640_0125202 | Ga0495640_0125202_871_1209 | 112 |
| 523 | 3300046536 | Ga0495587_0825897 | Ga0495587_0825897_38_376 | 112 |
| 524 | 3300046543 | Ga0495645_0397314 | Ga0495645_0397314_438_776 | 112 |
| 525 | 3300046543 | Ga0495645_0634213 | Ga0495645_0634213_285_623 | 112 |
| 526 | 3300046559 | Ga0495667_0077874 | Ga0495667_0077874_12_350 | 112 |
| 527 | 3300046559 | Ga0495667_0292892 | Ga0495667_0292892_227_568 | 112 |
| 528 | 3300046663 | Ga0495635_0977871 | Ga0495635_0977871_185_523 | 112 |
| 529 | 3300046809 | Ga0495600_0046274 | Ga0495600_0046274_2419_2757 | 112 |
| 530 | 3300046809 | Ga0495600_0241216 | Ga0495600_0241216_400_738 | 112 |
| 531 | 3300047317 | Ga0495604_0057569 | Ga0495604_0057569_1192_1530 | 112 |
| 532 | 3300047317 | Ga0495604_0242065 | Ga0495604_0242065_148_489 | 112 |
| 533 | 3300047319 | Ga0495674_0002013 | Ga0495674_0002013_15552_15890 | 112 |
| 534 | 3300047322 | Ga0495680_0342574 | Ga0495680_0342574_169_507 | 112 |
| 535 | 3300047444 | Ga0495675_0089947 | Ga0495675_0089947_1225_1563 | 112 |
| 536 | 3300047471 | Ga0495684_0027822 | Ga0495684_0027822_2456_2794 | 112 |
| 537 | 3300047471 | Ga0495684_0119732 | Ga0495684_0119732_739_1077 | 112 |
| 538 | 3300047471 | Ga0495684_0275862 | Ga0495684_0275862_652_990 | 112 |
| 539 | 3300048088 | Ga0495602_0300116 | Ga0495602_0300116_178_516 | 112 |
| 540 | 3300048088 | Ga0495602_0315193 | Ga0495602_0315193_752_1090 | 112 |
| 541 | 3300048088 | Ga0495602_0774501 | Ga0495602_0774501_29_367 | 112 |
| 542 | 3300048905 | Ga0496102_0207068 | Ga0496102_0207068_499_837 | 112 |
| 543 | 3300048905 | Ga0496102_0634140 | Ga0496102_0634140_530_868 | 112 |
| 544 | 3300048907 | Ga0496104_0047477 | Ga0496104_0047477_2719_3057 | 112 |
| 545 | 3300048907 | Ga0496104_1197291 | Ga0496104_1197291_11_349 | 112 |
| 546 | 3300048914 | Ga0496111_0131675 | Ga0496111_0131675_640_978 | 112 |
| 547 | 3300048915 | Ga0496112_0061488 | Ga0496112_0061488_413_751 | 112 |
| 548 | 3300048915 | Ga0496112_0101961 | Ga0496112_0101961_871_1209 | 112 |
| 549 | 3300048915 | Ga0496112_0287571 | Ga0496112_0287571_248_586 | 112 |
| 550 | 3300048916 | Ga0496113_0334258 | Ga0496113_0334258_189_527 | 112 |
| 551 | 3300048929 | Ga0496126_0055369 | Ga0496126_0055369_1850_2188 | 112 |
| 552 | 3300049568 | Ga0501031_0588911 | Ga0501031_0588911_133_471 | 112 |
| 553 | 3300049569 | Ga0501032_0938061 | Ga0501032_0938061_87_425 | 112 |
| 554 | 3300049570 | Ga0501033_0668672 | Ga0501033_0668672_267_605 | 112 |
| 555 | 3300049579 | Ga0501043_0724242 | Ga0501043_0724242_123_461 | 112 |
| 556 | 3300049583 | Ga0501067_0176944 | Ga0501067_0176944_485_823 | 112 |
| 557 | 3300049583 | Ga0501067_0442071 | Ga0501067_0442071_276_614 | 112 |
| 558 | 3300049586 | Ga0501070_0147947 | Ga0501070_0147947_1561_1899 | 112 |
| 559 | 3300049589 | Ga0501073_0396171 | Ga0501073_0396171_27_365 | 112 |
| 560 | 3300049822 | Ga0501035_0232514 | Ga0501035_0232514_930_1268 | 112 |
| 561 | 3300049823 | Ga0501044_0005497 | Ga0501044_0005497_5693_6031 | 112 |
| 562 | 3300049823 | Ga0501044_0939324 | Ga0501044_0939324_82_420 | 112 |
| 563 | 3300050507 | nmdc:mga05p37_304434_c1 | nmdc:mga05p37_304434_c1_344_682 | 112 |
| 564 | 3300050507 | nmdc:mga05p37_857809_c1 | nmdc:mga05p37_857809_c1_472_810 | 112 |
| 565 | 3300050511 | nmdc:mga08y16_1375165_c1 | nmdc:mga08y16_1375165_c1_141_479 | 112 |
| 566 | 3300050514 | nmdc:mga08x19_433291_c1 | nmdc:mga08x19_433291_c1_320_658 | 112 |
| 567 | 3300053093 | Ga0500651_0231644 | Ga0500651_0231644_266_604 | 112 |
| 568 | 3300059478 | Ga0587093_112645 | Ga0587093_112645_78_416 | 112 |
| 569 | 3300059491 | Ga0587070_029899 | Ga0587070_029899_628_966 | 112 |
| 570 | 3300059493 | Ga0587077_220757 | Ga0587077_220757_184_522 | 112 |
| 571 | 3300059503 | Ga0587080_017140 | Ga0587080_017140_78_416 | 112 |
| 572 | 3300059503 | Ga0587080_074552 | Ga0587080_074552_205_609 | 112 |
| 573 | 3300059504 | Ga0587082_024353 | Ga0587082_024353_553_891 | 112 |
| 574 | 3300059505 | Ga0587083_0003641 | Ga0587083_0003641_12_350 | 112 |
| 575 | 3300059505 | Ga0587083_0020963 | Ga0587083_0020963_856_1194 | 112 |
| 576 | 3300059505 | Ga0587083_0196326 | Ga0587083_0196326_226_564 | 112 |
| 577 | 3300059506 | Ga0587085_119151 | Ga0587085_119151_168_506 | 112 |
| 578 | 3300059508 | Ga0587088_058513 | Ga0587088_058513_78_416 | 112 |
| 579 | 3300059640 | Ga0587067_104540 | Ga0587067_104540_222_560 | 112 |
| 580 | 3300059640 | Ga0587067_105031 | Ga0587067_105031_237_575 | 112 |
| 581 | 3300059645 | Ga0587076_032544 | Ga0587076_032544_198_536 | 112 |
| 582 | 3300059647 | Ga0587079_101851 | Ga0587079_101851_115_453 | 112 |
| 583 | 3300059649 | Ga0587102_005661 | Ga0587102_005661_532_870 | 112 |
| 584 | 3300059650 | Ga0587104_020208 | Ga0587104_020208_184_522 | 112 |
| 585 | 3300059658 | Ga0587119_021933 | Ga0587119_021933_91_429 | 112 |
| 586 | 3300060246 | Ga0587081_18343 | Ga0587081_18343_192_530 | 112 |
| 587 | 3300060344 | Ga0587071_016987 | Ga0587071_016987_776_1114 | 112 |
| 588 | 3300061719 | Ga0466962_0180311 | Ga0466962_0180311_674_1012 | 112 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p4y-assembly4.cif.gz_K | glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a | 0.9861 | 2 | 112 |
| 1v9o-assembly1.cif.gz_C | crystal structure of tt1020 from thermus thermophilus hb8 | 0.9826 | 1 | 108 |
| 1v3s-assembly1.cif.gz_C | crystal structure of tt1020 from thermus thermophilus hb8 | 0.9781 | 1 | 108 |
| 1vfj-assembly1.cif.gz_C | crystal structure of tt1020 from thermus thermophilus hb8 | 0.978 | 1 | 108 |
| 2eg1-assembly1.cif.gz_A | the crystal structure of pii protein | 0.9774 | 1 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9634 | 1 | 111 | 3.30.70.120 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9538 | 1 | 111 | 3.30.70.120 |
| 2o66C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9532 | 2 | 111 | 3.30.70.120 |
| 4oznB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9397 | 2 | 112 | 3.30.70.120 |
| 4usiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9354 | 2 | 108 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357BKJ3-F1-model_v4 | P-II family nitrogen regulator | 0.9385 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A7C3Q2H0-F1-model_v4 | P-II family nitrogen regulator | 0.9311 | 1 | 108 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A357BKJ3-F1-model_v4 | P-II family nitrogen regulator | 0.9294 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A1F7F2C5-F1-model_v4 | Transcriptional regulator | 0.9292 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A7C4QCA3-F1-model_v4 | P-II family nitrogen regulator | 0.9206 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar