F466821

General Info

Members Datasets Scaffolds Average Seq Length
588 241 587 112

Family's Representative Sequence

Representative Sequence 3300059503|Ga0587080_074552|Ga0587080_074552_205_609
Length 134
Sequence LPAAAAGVPLRLPQPKNIQEPNMTKIEAIIQPNRFDVVKKALIDIGVEGMTVSEVRGHGRQKGHKESYRGGEYSVDLLPKVKLETVLQDNVVEAAVNAIITNASTGKIGDGKIFLYKVEEAIRIRSQERGAAAV

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 3.57
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.53
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10212188 3300001989 Bacteria 567
2 JGI24737J22298_10083107 3300001990 Bacteria 952
3 Ga0070658_10243472 3300005327 Bacteria 1525
4 Ga0070658_10801807 3300005327 Unclassified 818
5 Ga0070658_11254413 3300005327 Unclassified 644
6 Ga0070683_100007613 3300005329 Bacteria 9160
7 Ga0070683_100009342 3300005329 Bacteria 8380
8 Ga0070683_100074415 3300005329 Bacteria 3173
9 Ga0070683_100490649 3300005329 Bacteria 1173
10 Ga0070683_100595490 3300005329 Bacteria 1058
11 Ga0070683_101252808 3300005329 Bacteria 713
12 Ga0070670_100308523 3300005331 Bacteria 1385
13 Ga0068869_100166301 3300005334 Unclassified 1720
14 Ga0070680_100115864 3300005336 Bacteria 2233
15 Ga0070680_100159325 3300005336 Unclassified 1896
16 Ga0070680_100207879 3300005336 Bacteria 1651
17 Ga0068868_100002892 3300005338 Bacteria 11916
18 Ga0068868_100011357 3300005338 Bacteria 6486
19 Ga0068868_100023407 3300005338 Bacteria 4675
20 Ga0070660_100813462 3300005339 Bacteria 786
21 Ga0070689_100030045 3300005340 Unclassified 4121
22 Ga0070661_100077422 3300005344 Bacteria 2452
23 Ga0070661_100797848 3300005344 Unclassified 775
24 Ga0070661_101391096 3300005344 Unclassified 590
25 Ga0070692_10309238 3300005345 Unclassified 968
26 Ga0070675_100322713 3300005354 Bacteria 1364
27 Ga0070671_100042202 3300005355 Bacteria 3792
28 Ga0070673_102354765 3300005364 Bacteria 506
29 Ga0070659_100181636 3300005366 Bacteria 1727
30 Ga0070659_100522805 3300005366 Bacteria 1013
31 Ga0070667_100516120 3300005367 Bacteria 1096
32 Ga0070709_10099769 3300005434 Bacteria 1932
33 Ga0070714_100001278 3300005435 Bacteria 18196
34 Ga0070714_100146155 3300005435 Bacteria 2127
35 Ga0070714_100317158 3300005435 Bacteria 1457
36 Ga0070714_100712498 3300005435 Bacteria 969
37 Ga0070714_100722815 3300005435 Bacteria 962
38 Ga0070714_100987096 3300005435 Bacteria 819
39 Ga0070714_102029110 3300005435 Unclassified 561
40 Ga0070713_100010422 3300005436 Bacteria 6712
41 Ga0070713_100445816 3300005436 Bacteria 1215
42 Ga0070713_100516815 3300005436 Bacteria 1128
43 Ga0070713_100543498 3300005436 Bacteria 1099
44 Ga0070713_101787737 3300005436 Bacteria 596
45 Ga0070713_101989266 3300005436 Unclassified 564
46 Ga0070713_102345368 3300005436 Unclassified 516
47 Ga0070710_10028217 3300005437 Bacteria 3000
48 Ga0070710_10775431 3300005437 Bacteria 683
49 Ga0070710_11140390 3300005437 Unclassified 574
50 Ga0070711_100077814 3300005439 Bacteria 2355
51 Ga0070711_100116217 3300005439 Bacteria 1971
52 Ga0070711_100125789 3300005439 Bacteria 1903
53 Ga0070711_100233855 3300005439 Bacteria 1434
54 Ga0070711_100980660 3300005439 Unclassified 724
55 Ga0070711_101063622 3300005439 Bacteria 696
56 Ga0070711_101626493 3300005439 Unclassified 565
57 Ga0070694_100875063 3300005444 Unclassified 740
58 Ga0070708_100501425 3300005445 Bacteria 1145
59 Ga0070663_100800547 3300005455 Unclassified 808
60 Ga0070662_100050637 3300005457 Bacteria 2996
61 Ga0070681_10001282 3300005458 Bacteria 21908
62 Ga0070681_10031615 3300005458 Bacteria 5314
63 Ga0070681_10032389 3300005458 Bacteria 5246
64 Ga0070681_10369484 3300005458 Bacteria 1345
65 Ga0070681_10444310 3300005458 Bacteria 1209
66 Ga0068867_100009183 3300005459 Bacteria 6980
67 Ga0068867_100693823 3300005459 Unclassified 898
68 Ga0070685_10923000 3300005466 Bacteria 651
69 Ga0070706_100582375 3300005467 Bacteria 1040
70 Ga0070707_100076196 3300005468 Unclassified 3236
71 Ga0070707_100681989 3300005468 Unclassified 990
72 Ga0070679_100004510 3300005530 Bacteria 12863
73 Ga0070679_100308309 3300005530 Unclassified 1533
74 Ga0070679_100493780 3300005530 Bacteria 1168
75 Ga0070679_100976104 3300005530 Bacteria 791
76 Ga0070684_100117711 3300005535 Bacteria 2388
77 Ga0070684_100151473 3300005535 Bacteria 2101
78 Ga0070684_100165012 3300005535 Bacteria 2010
79 Ga0070684_100280780 3300005535 Bacteria 1526
80 Ga0070684_100814618 3300005535 Bacteria 873
81 Ga0070684_101427488 3300005535 Unclassified 652
82 Ga0068853_100336992 3300005539 Bacteria 1401
83 Ga0068853_100377786 3300005539 Bacteria 1323
84 Ga0068853_100929481 3300005539 Bacteria 836
85 Ga0068853_101286758 3300005539 Bacteria 707
86 Ga0068853_101955511 3300005539 Unclassified 569
87 Ga0068853_101986356 3300005539 Bacteria 564
88 Ga0070672_100308831 3300005543 Bacteria 1342
89 Ga0070672_100628533 3300005543 Bacteria 937
90 Ga0070695_100141018 3300005545 Bacteria 1671
91 Ga0070695_101763695 3300005545 Unclassified 519
92 Ga0070693_100026548 3300005547 Bacteria 3128
93 Ga0070693_100079286 3300005547 Bacteria 1954
94 Ga0070693_100320493 3300005547 Unclassified 1051
95 Ga0070665_100160391 3300005548 Bacteria 2251
96 Ga0068855_100000234 3300005563 Bacteria 70713
97 Ga0068855_100000432 3300005563 Bacteria 51912
98 Ga0068855_100002034 3300005563 Bacteria 25069
99 Ga0068855_100030374 3300005563 Bacteria 6464
100 Ga0068855_100190196 3300005563 Bacteria 2316
101 Ga0068855_100239106 3300005563 Bacteria 2030
102 Ga0068855_101595520 3300005563 Unclassified 668
103 Ga0068855_101675000 3300005563 Unclassified 649
104 Ga0070664_100047322 3300005564 Bacteria 3633
105 Ga0070664_100111666 3300005564 Bacteria 2386
106 Ga0070664_100233340 3300005564 Bacteria 1650
107 Ga0070664_100634760 3300005564 Bacteria 992
108 Ga0068857_100000096 3300005577 Bacteria 51376
109 Ga0068857_100066916 3300005577 Bacteria 3197
110 Ga0068857_100072363 3300005577 Unclassified 3072
111 Ga0068857_100482048 3300005577 Unclassified 1162
112 Ga0068854_100021654 3300005578 Unclassified 4364
113 Ga0068854_100069393 3300005578 Unclassified 2573
114 Ga0068854_101258624 3300005578 Unclassified 665
115 Ga0068856_100000062 3300005614 Bacteria 100769
116 Ga0068856_100000179 3300005614 Bacteria 66149
117 Ga0068856_100002175 3300005614 Bacteria 20318
118 Ga0068856_100006231 3300005614 Bacteria 11706
119 Ga0068856_100056448 3300005614 Bacteria 3874
120 Ga0068856_102060169 3300005614 Unclassified 581
121 Ga0068852_100065418 3300005616 Bacteria 3172
122 Ga0068852_100492136 3300005616 Bacteria 1220
123 Ga0068852_101634655 3300005616 Bacteria 667
124 Ga0068859_100010599 3300005617 Bacteria 9278
125 Ga0068859_100598981 3300005617 Bacteria 1195
126 Ga0068859_100761365 3300005617 Bacteria 1057
127 Ga0068859_102522365 3300005617 Bacteria 566
128 Ga0068864_100000129 3300005618 Bacteria 73206
129 Ga0068864_101078384 3300005618 Bacteria 799
130 Ga0068866_10621363 3300005718 Bacteria 732
131 Ga0068861_100038831 3300005719 Unclassified 3550
132 Ga0068851_10100124 3300005834 Bacteria 1537
133 Ga0068851_10169279 3300005834 Bacteria 1205
134 Ga0068851_10264820 3300005834 Bacteria 979
135 Ga0068870_10316028 3300005840 Unclassified 991
136 Ga0068863_100026366 3300005841 Bacteria 5545
137 Ga0068863_100207531 3300005841 Unclassified 1886
138 Ga0068863_101149075 3300005841 Bacteria 782
139 Ga0068863_102613797 3300005841 Bacteria 514
140 Ga0068858_100022846 3300005842 Bacteria 5833
141 Ga0068858_100025071 3300005842 Bacteria 5550
142 Ga0068858_100030716 3300005842 Unclassified 4989
143 Ga0068858_100631877 3300005842 Bacteria 1040
144 Ga0068860_100062412 3300005843 Bacteria 3541
145 Ga0068860_100819175 3300005843 Bacteria 945
146 Ga0068860_102284396 3300005843 Bacteria 561
147 Ga0068860_102625124 3300005843 Bacteria 523
148 Ga0081455_10004203 3300005937 Bacteria 16225
149 Ga0070717_10008993 3300006028 Bacteria 7492
150 Ga0070717_10009110 3300006028 Bacteria 7454
151 Ga0070717_10022907 3300006028 Bacteria 4942
152 Ga0070717_10391938 3300006028 Bacteria 1247
153 Ga0070717_11177178 3300006028 Unclassified 698
154 Ga0070716_100020959 3300006173 Bacteria 3439
155 Ga0070716_101377353 3300006173 Bacteria 573
156 Ga0070712_100026229 3300006175 Bacteria 3880
157 Ga0070712_100108632 3300006175 Bacteria 2066
158 Ga0070712_100757866 3300006175 Bacteria 831
159 Ga0070712_101030200 3300006175 Bacteria 713
160 Ga0097621_100000196 3300006237 Bacteria 39296
161 Ga0097621_100000326 3300006237 Bacteria 32263
162 Ga0097621_100002114 3300006237 Bacteria 13601
163 Ga0097621_100066365 3300006237 Bacteria 2972
164 Ga0097621_101963939 3300006237 Bacteria 559
165 Ga0068871_100000049 3300006358 Bacteria 65954
166 Ga0068871_100000729 3300006358 Bacteria 22322
167 Ga0068871_100038114 3300006358 Bacteria 3836
168 Ga0068871_101419834 3300006358 Bacteria 655
169 Ga0068871_102055265 3300006358 Unclassified 544
170 Ga0075431_101447682 3300006847 Bacteria 646
171 Ga0068865_100433159 3300006881 Bacteria 1084
172 Ga0075436_100493957 3300006914 Unclassified 895
173 Ga0075436_100693741 3300006914 Unclassified 754
174 Ga0097620_100010599 3300006931 Bacteria 9278
175 Ga0097620_100599037 3300006931 Bacteria 1195
176 Ga0097620_100761191 3300006931 Bacteria 1057
177 Ga0097620_102523503 3300006931 Bacteria 566
178 Ga0105240_10001598 3300009093 Bacteria 38481
179 Ga0105240_10013638 3300009093 Bacteria 11145
180 Ga0105240_10027316 3300009093 Bacteria 7473
181 Ga0105240_10095388 3300009093 Bacteria 3627
182 Ga0105240_10097173 3300009093 Unclassified 3589
183 Ga0105240_10106552 3300009093 Bacteria 3399
184 Ga0105240_10176064 3300009093 Bacteria 2529
185 Ga0105240_10228873 3300009093 Bacteria 2162
186 Ga0105240_10718411 3300009093 Bacteria 1089
187 Ga0105240_11745621 3300009093 Bacteria 649
188 Ga0111539_12382874 3300009094 Bacteria 614
189 Ga0105245_10257481 3300009098 Unclassified 1697
190 Ga0114129_10105829 3300009147 Bacteria 3887
191 Ga0114129_10165238 3300009147 Bacteria 3021
192 Ga0105243_10168691 3300009148 Bacteria 1894
193 Ga0105241_10008156 3300009174 Bacteria 7712
194 Ga0105241_10033741 3300009174 Unclassified 3843
195 Ga0105241_10191313 3300009174 Bacteria 1704
196 Ga0105241_10196967 3300009174 Bacteria 1680
197 Ga0105241_10429589 3300009174 Bacteria 1164
198 Ga0105241_10507246 3300009174 Unclassified 1077
199 Ga0105241_11449856 3300009174 Unclassified 659
200 Ga0105242_10720222 3300009176 Bacteria 978
201 Ga0105242_11653731 3300009176 Unclassified 675
202 Ga0105242_12854410 3300009176 Unclassified 534
203 Ga0105248_10044355 3300009177 Bacteria 4987
204 Ga0105248_10073446 3300009177 Bacteria 3844
205 Ga0105248_10834464 3300009177 Bacteria 1040
206 Ga0105248_12059109 3300009177 Bacteria 649
207 Ga0105248_12863795 3300009177 Bacteria 550
208 Ga0105248_12916198 3300009177 Bacteria 545
209 Ga0105237_10008185 3300009545 Bacteria 11357
210 Ga0105237_10160393 3300009545 Bacteria 2247
211 Ga0105237_10285736 3300009545 Bacteria 1652
212 Ga0105237_10427281 3300009545 Unclassified 1330
213 Ga0105237_11532922 3300009545 Bacteria 673
214 Ga0105237_11562799 3300009545 Unclassified 667
215 Ga0105237_11757953 3300009545 Unclassified 627
216 Ga0105237_11871812 3300009545 Unclassified 608
217 Ga0105238_10000609 3300009551 Bacteria 37550
218 Ga0105238_10139935 3300009551 Bacteria 2397
219 Ga0105238_10240461 3300009551 Bacteria 1788
220 Ga0105238_10397115 3300009551 Unclassified 1372
221 Ga0105238_10758335 3300009551 Bacteria 985
222 Ga0105238_11170002 3300009551 Bacteria 793
223 Ga0105238_11292781 3300009551 Bacteria 755
224 Ga0105238_11564383 3300009551 Unclassified 689
225 Ga0105238_12741458 3300009551 Bacteria 529
226 Ga0105249_10207414 3300009553 Unclassified 1921
227 Ga0105249_10328166 3300009553 Bacteria 1543
228 Ga0105239_10012612 3300010375 Bacteria 9405
229 Ga0105239_10049542 3300010375 Bacteria 4606
230 Ga0105239_10210971 3300010375 Bacteria 2177
231 Ga0105239_10228767 3300010375 Unclassified 2086
232 Ga0105239_10625055 3300010375 Bacteria 1229
233 Ga0105239_11974254 3300010375 Bacteria 677
234 Ga0105239_12662126 3300010375 Unclassified 583
235 Ga0105246_11118563 3300011119 Unclassified 720
236 Ga0157373_10003857 3300013100 Bacteria 11328
237 Ga0157373_10058761 3300013100 Bacteria 2726
238 Ga0157371_10064749 3300013102 Bacteria 2590
239 Ga0157371_10143062 3300013102 Unclassified 1704
240 Ga0157370_10061648 3300013104 Bacteria 3559
241 Ga0157370_10176757 3300013104 Bacteria 1984
242 Ga0157370_10433236 3300013104 Bacteria 1209
243 Ga0157369_10004488 3300013105 Bacteria 16449
244 Ga0157369_10033990 3300013105 Bacteria 5599
245 Ga0157369_10046268 3300013105 Bacteria 4729
246 Ga0157369_10084750 3300013105 Bacteria 3387
247 Ga0157369_10118784 3300013105 Bacteria 2806
248 Ga0157369_10357707 3300013105 Bacteria 1516
249 Ga0157369_10389764 3300013105 Bacteria 1445
250 Ga0157369_10531414 3300013105 Bacteria 1216
251 Ga0157369_10566777 3300013105 Bacteria 1173
252 Ga0157369_10642938 3300013105 Bacteria 1094
253 Ga0157374_10000062 3300013296 Bacteria 112028
254 Ga0157374_10000338 3300013296 Bacteria 43326
255 Ga0157374_10000429 3300013296 Bacteria 38039
256 Ga0157378_10000009 3300013297 Bacteria 161557
257 Ga0157378_10000366 3300013297 Bacteria 44698
258 Ga0157378_10004757 3300013297 Bacteria 11898
259 Ga0157378_11124214 3300013297 Bacteria 823
260 Ga0157378_12706245 3300013297 Bacteria 548
261 Ga0163162_10124391 3300013306 Bacteria 2685
262 Ga0163162_10807745 3300013306 Bacteria 1055
263 Ga0163162_12301952 3300013306 Bacteria 619
264 Ga0157372_10001184 3300013307 Bacteria 28212
265 Ga0157372_10002204 3300013307 Bacteria 21156
266 Ga0157372_10003611 3300013307 Bacteria 16654
267 Ga0157372_10008115 3300013307 Bacteria 11167
268 Ga0157372_10013114 3300013307 Bacteria 8843
269 Ga0157372_10014116 3300013307 Bacteria 8532
270 Ga0157372_10015542 3300013307 Bacteria 8157
271 Ga0157372_10406393 3300013307 Bacteria 1586
272 Ga0157372_10425702 3300013307 Bacteria 1547
273 Ga0157372_10680962 3300013307 Bacteria 1197
274 Ga0157375_10874901 3300013308 Bacteria 1044
275 Ga0163163_10417152 3300014325 Bacteria 1401
276 Ga0163163_10454928 3300014325 Unclassified 1340
277 Ga0163163_11438726 3300014325 Unclassified 751
278 Ga0163163_12442646 3300014325 Bacteria 581
279 Ga0163163_12450965 3300014325 Unclassified 580
280 Ga0157380_10081637 3300014326 Bacteria 2645
281 Ga0157377_10817226 3300014745 Unclassified 689
282 Ga0157379_12659048 3300014968 Bacteria 502
283 Ga0157376_10002214 3300014969 Bacteria 13108
284 Ga0157376_10293308 3300014969 Unclassified 1536
285 Ga0157376_12068267 3300014969 Bacteria 608
286 Ga0163161_11585217 3300017792 Bacteria 577
287 Ga0206355_1332757 3300020076 Unclassified 539
288 Ga0213872_10000901 3300021361 Bacteria 21377
289 Ga0213874_10007619 3300021377 Bacteria 2607
290 Ga0213876_10118354 3300021384 Bacteria 1406
291 Ga0213875_10000038 3300021388 Bacteria 164463
292 Ga0213875_10038772 3300021388 Unclassified 2245
293 Ga0213875_10054195 3300021388 Bacteria 1878
294 Ga0213875_10105552 3300021388 Bacteria 1315
295 Ga0213875_10184044 3300021388 Bacteria 981
296 Ga0213875_10370531 3300021388 Bacteria 681
297 Ga0213875_10406238 3300021388 Bacteria 650
298 Ga0207697_10330820 3300025315 Bacteria 676
299 Ga0207656_10179152 3300025321 Bacteria 1016
300 Ga0207692_10003767 3300025898 Bacteria 5954
301 Ga0207692_10117018 3300025898 Bacteria 1487
302 Ga0207692_10802733 3300025898 Unclassified 615
303 Ga0207692_10872694 3300025898 Bacteria 591
304 Ga0207642_10442919 3300025899 Bacteria 785
305 Ga0207680_10423345 3300025903 Unclassified 943
306 Ga0207647_10015506 3300025904 Bacteria 5221
307 Ga0207699_10120990 3300025906 Bacteria 1693
308 Ga0207699_10464478 3300025906 Bacteria 910
309 Ga0207705_10722407 3300025909 Bacteria 774
310 Ga0207684_10349945 3300025910 Bacteria 1272
311 Ga0207654_10004195 3300025911 Bacteria 7275
312 Ga0207654_10056660 3300025911 Bacteria 2274
313 Ga0207654_10102401 3300025911 Bacteria 1766
314 Ga0207654_10108391 3300025911 Bacteria 1723
315 Ga0207654_10253495 3300025911 Bacteria 1180
316 Ga0207707_10001452 3300025912 Bacteria 21916
317 Ga0207707_10066848 3300025912 Bacteria 3130
318 Ga0207707_10092365 3300025912 Bacteria 2645
319 Ga0207707_10166468 3300025912 Bacteria 1926
320 Ga0207707_11353515 3300025912 Unclassified 570
321 Ga0207695_10025592 3300025913 Bacteria 6602
322 Ga0207695_10025623 3300025913 Bacteria 6597
323 Ga0207695_10040956 3300025913 Unclassified 4961
324 Ga0207695_10053771 3300025913 Bacteria 4209
325 Ga0207695_10136233 3300025913 Bacteria 2408
326 Ga0207695_10172658 3300025913 Bacteria 2086
327 Ga0207695_10204016 3300025913 Bacteria 1890
328 Ga0207695_10332623 3300025913 Bacteria 1407
329 Ga0207695_10748367 3300025913 Bacteria 858
330 Ga0207695_10807886 3300025913 Bacteria 818
331 Ga0207671_10026301 3300025914 Bacteria 4364
332 Ga0207671_10059878 3300025914 Unclassified 2824
333 Ga0207671_10726549 3300025914 Unclassified 789
334 Ga0207693_10010989 3300025915 Bacteria 7337
335 Ga0207693_10075630 3300025915 Bacteria 2637
336 Ga0207693_10483826 3300025915 Bacteria 966
337 Ga0207663_10056900 3300025916 Bacteria 2462
338 Ga0207663_10221568 3300025916 Bacteria 1377
339 Ga0207663_10405041 3300025916 Bacteria 1044
340 Ga0207663_10768890 3300025916 Bacteria 766
341 Ga0207660_10108136 3300025917 Unclassified 2088
342 Ga0207660_10933444 3300025917 Bacteria 708
343 Ga0207657_10892800 3300025919 Bacteria 685
344 Ga0207649_10050789 3300025920 Unclassified 2566
345 Ga0207649_10815561 3300025920 Unclassified 729
346 Ga0207652_10016784 3300025921 Bacteria 5983
347 Ga0207652_10236448 3300025921 Bacteria 1647
348 Ga0207652_10460896 3300025921 Bacteria 1145
349 Ga0207652_10586168 3300025921 Bacteria 1001
350 Ga0207652_11027752 3300025921 Bacteria 723
351 Ga0207646_11287529 3300025922 Unclassified 639
352 Ga0207694_10041105 3300025924 Unclassified 3562
353 Ga0207694_10548857 3300025924 Bacteria 970
354 Ga0207694_10619130 3300025924 Unclassified 911
355 Ga0207694_10856263 3300025924 Unclassified 768
356 Ga0207694_10859073 3300025924 Bacteria 767
357 Ga0207694_11713057 3300025924 Unclassified 529
358 Ga0207650_10007026 3300025925 Bacteria 7676
359 Ga0207687_10575373 3300025927 Bacteria 947
360 Ga0207700_10028987 3300025928 Bacteria 3901
361 Ga0207700_10130146 3300025928 Bacteria 2054
362 Ga0207700_10144308 3300025928 Unclassified 1960
363 Ga0207700_10154738 3300025928 Bacteria 1898
364 Ga0207700_10381119 3300025928 Bacteria 1233
365 Ga0207700_11609580 3300025928 Unclassified 574
366 Ga0207700_11685541 3300025928 Bacteria 559
367 Ga0207700_11775093 3300025928 Unclassified 543
368 Ga0207664_10018085 3300025929 Bacteria 5179
369 Ga0207664_10249767 3300025929 Bacteria 1548
370 Ga0207664_10251371 3300025929 Unclassified 1543
371 Ga0207664_10288312 3300025929 Unclassified 1442
372 Ga0207664_10349480 3300025929 Unclassified 1308
373 Ga0207664_10423162 3300025929 Unclassified 1186
374 Ga0207664_10920092 3300025929 Unclassified 785
375 Ga0207664_10967978 3300025929 Bacteria 763
376 Ga0207690_10139494 3300025932 Bacteria 1785
377 Ga0207706_10773407 3300025933 Bacteria 817
378 Ga0207686_10551604 3300025934 Bacteria 901
379 Ga0207686_11586971 3300025934 Unclassified 540
380 Ga0207670_10011513 3300025936 Bacteria 5141
381 Ga0207704_10080427 3300025938 Bacteria 2104
382 Ga0207704_11345489 3300025938 Bacteria 611
383 Ga0207665_10110320 3300025939 Bacteria 1932
384 Ga0207691_10499161 3300025940 Bacteria 1033
385 Ga0207691_11377275 3300025940 Unclassified 580
386 Ga0207711_10006557 3300025941 Bacteria 9801
387 Ga0207711_10063738 3300025941 Bacteria 3183
388 Ga0207711_10612703 3300025941 Bacteria 1016
389 Ga0207711_11438595 3300025941 Bacteria 632
390 Ga0207689_10623125 3300025942 Bacteria 908
391 Ga0207661_10010786 3300025944 Bacteria 6589
392 Ga0207661_10022700 3300025944 Bacteria 4731
393 Ga0207661_10095051 3300025944 Bacteria 2491
394 Ga0207661_10598872 3300025944 Bacteria 1011
395 Ga0207661_10969924 3300025944 Bacteria 783
396 Ga0207679_10001856 3300025945 Bacteria 13125
397 Ga0207679_10180510 3300025945 Bacteria 1746
398 Ga0207679_10323066 3300025945 Unclassified 1337
399 Ga0207667_10000465 3300025949 Bacteria 54509
400 Ga0207667_10001399 3300025949 Bacteria 30243
401 Ga0207667_10056204 3300025949 Bacteria 4135
402 Ga0207667_10203356 3300025949 Bacteria 2031
403 Ga0207667_10560641 3300025949 Bacteria 1155
404 Ga0207667_11275296 3300025949 Bacteria 712
405 Ga0207651_10562083 3300025960 Bacteria 993
406 Ga0207712_10222593 3300025961 Bacteria 1510
407 Ga0207640_10014902 3300025981 Unclassified 4487
408 Ga0207640_10032902 3300025981 Bacteria 3220
409 Ga0207640_10626605 3300025981 Bacteria 914
410 Ga0207658_10446664 3300025986 Bacteria 1144
411 Ga0207658_11449919 3300025986 Unclassified 628
412 Ga0207677_10010569 3300026023 Bacteria 5231
413 Ga0207677_10013510 3300026023 Bacteria 4736
414 Ga0207677_10086911 3300026023 Bacteria 2262
415 Ga0207703_10022458 3300026035 Bacteria 4949
416 Ga0207703_10088827 3300026035 Bacteria 2595
417 Ga0207703_10109831 3300026035 Unclassified 2351
418 Ga0207703_10750660 3300026035 Bacteria 930
419 Ga0207639_10108956 3300026041 Bacteria 2253
420 Ga0207639_10167310 3300026041 Unclassified 1859
421 Ga0207639_10255152 3300026041 Bacteria 1531
422 Ga0207639_11296254 3300026041 Bacteria 684
423 Ga0207639_12228114 3300026041 Unclassified 509
424 Ga0207678_10527815 3300026067 Bacteria 1031
425 Ga0207702_10001051 3300026078 Bacteria 28280
426 Ga0207702_10008697 3300026078 Bacteria 8562
427 Ga0207702_10010332 3300026078 Bacteria 7818
428 Ga0207702_10184432 3300026078 Unclassified 1924
429 Ga0207702_10372751 3300026078 Bacteria 1371
430 Ga0207641_10020771 3300026088 Bacteria 5397
431 Ga0207641_10119719 3300026088 Bacteria 2347
432 Ga0207648_10015075 3300026089 Bacteria 7116
433 Ga0207648_10937897 3300026089 Unclassified 809
434 Ga0207676_10030937 3300026095 Bacteria 4022
435 Ga0207676_10069123 3300026095 Bacteria 2827
436 Ga0207674_10026851 3300026116 Bacteria 6107
437 Ga0207674_10084204 3300026116 Unclassified 3178
438 Ga0207675_100080251 3300026118 Unclassified 3059
439 Ga0207683_10085205 3300026121 Bacteria 2809
440 Ga0207698_10003245 3300026142 Bacteria 9767
441 Ga0207698_12474937 3300026142 Bacteria 530
442 Ga0268266_10069735 3300028379 Bacteria 3047
443 Ga0268266_11227093 3300028379 Bacteria 725
444 Ga0268264_10086311 3300028381 Unclassified 2696
445 Ga0268264_10316227 3300028381 Bacteria 1475
446 Ga0268264_12239314 3300028381 Bacteria 554
447 Ga0265338_10548520 3300028800 Bacteria 809
448 Ga0265340_10153168 3300031247 Bacteria 1050
449 Ga0265316_10082148 3300031344 Bacteria 2469
450 Ga0373930_0186724 3300034816 Unclassified 534
451 Ga0373926_0181066 3300035083 Bacteria 808
452 Ga0373926_0264381 3300035083 Bacteria 668
453 Ga0373943_0065885 3300035170 Bacteria 1823
454 Ga0373943_0900331 3300035170 Bacteria 529
455 Ga0373935_0062625 3300035692 Bacteria 2383
456 Ga0373927_0193509 3300035695 Bacteria 1334
457 Ga0373927_0509572 3300035695 Bacteria 795
458 Ga0373927_0534642 3300035695 Bacteria 775
459 Ga0373933_0069070 3300035724 Bacteria 2147
460 Ga0373933_1083608 3300035724 Bacteria 528
461 Ga0373947_0326835 3300035725 Bacteria 1026
462 Ga0373947_1027479 3300035725 Bacteria 562
463 Ga0373937_0177714 3300036401 Bacteria 1998
464 Ga0373937_1036859 3300036401 Unclassified 769
465 Ga0373925_0015274 3300037068 Bacteria 5552
466 Ga0373925_0071685 3300037068 Bacteria 2621
467 Ga0436364_0175882 3300037853 Unclassified 4845
468 Ga0436364_0375830 3300037853 Bacteria 1024
469 Ga0436364_0439346 3300037853 Bacteria 1479
470 Ga0436364_0777617 3300037853 Bacteria 1590
471 Ga0436364_0991316 3300037853 Bacteria 187962
472 Ga0436364_1070982 3300037853 Bacteria 4142
473 Ga0436364_1176830 3300037853 Bacteria 4370
474 Ga0436364_1321514 3300037853 Bacteria 1880
475 Ga0436364_1391940 3300037853 Bacteria 969
476 Ga0436364_1419506 3300037853 Unclassified 887
477 Ga0436365_0775650 3300039437 Bacteria 781
478 Ga0436365_1233600 3300039437 Bacteria 3192
479 Ga0436365_1466134 3300039437 Bacteria 2395
480 Ga0436360_0003068 3300039438 Bacteria 1276
481 Ga0436360_0710635 3300039438 Bacteria 1002
482 Ga0436360_0728135 3300039438 Bacteria 838
483 Ga0436361_0779674 3300039447 Bacteria 61407
484 Ga0436363_0817086 3300039450 Bacteria 799
485 Ga0436363_1403142 3300039450 Bacteria 4242
486 Ga0436362_0100795 3300039453 Bacteria 920
487 Ga0451839_1610675 3300041496 Unclassified 661
488 Ga0451577_1156484 3300042876 Bacteria 691
489 Ga0451577_1904137 3300042876 Bacteria 521
490 Ga0466965_0125261 3300044683 Bacteria 1329
491 Ga0466966_0465269 3300044684 Unclassified 760
492 Ga0466961_0046669 3300044693 Bacteria 2770
493 Ga0466963_0009340 3300044694 Bacteria 5904
494 Ga0466963_0047623 3300044694 Bacteria 2830
495 Ga0466963_0987964 3300044694 Bacteria 593
496 Ga0453684_1966378 3300044712 Bacteria 590
497 Ga0466971_0337885 3300044719 Unclassified 727
498 Ga0466970_0799853 3300044765 Unclassified 552
499 Ga0466957_0566169 3300044842 Unclassified 793
500 Ga0466957_0705029 3300044842 Bacteria 713
501 Ga0466959_0802933 3300045049 Unclassified 629
502 Ga0451576_0615759 3300045051 Bacteria 1141
503 Ga0451576_0742037 3300045051 Bacteria 1031
504 Ga0466958_0083327 3300045836 Bacteria 1971
505 Ga0466958_0336930 3300045836 Unclassified 970
506 Ga0466958_0427852 3300045836 Bacteria 856
507 Ga0466958_0938008 3300045836 Bacteria 565
508 Ga0466967_0050558 3300045976 Bacteria 3640
509 Ga0466967_1001197 3300045976 Bacteria 832
510 Ga0466967_2491441 3300045976 Unclassified 512
511 Ga0495592_0113850 3300046454 Bacteria 1911
512 Ga0495651_0074977 3300046462 Bacteria 2566
513 Ga0495653_0598217 3300046463 Bacteria 678
514 Ga0495580_0014909 3300046472 Bacteria 5886
515 Ga0495639_0432943 3300046475 Unclassified 667
516 Ga0495608_0572912 3300046511 Unclassified 679
517 Ga0495628_1024094 3300046516 Unclassified 567
518 Ga0495630_1163026 3300046517 Unclassified 584
519 Ga0495652_0610062 3300046529 Unclassified 743
520 Ga0495652_0770800 3300046529 Bacteria 642
521 Ga0495640_0125202 3300046533 Unclassified 1667
522 Ga0495587_0825897 3300046536 Unclassified 506
523 Ga0495645_0397314 3300046543 Bacteria 879
524 Ga0495645_0634213 3300046543 Bacteria 654
525 Ga0495667_0077874 3300046559 Bacteria 2156
526 Ga0495667_0292892 3300046559 Unclassified 1032
527 Ga0495635_0977871 3300046663 Unclassified 539
528 Ga0495600_0046274 3300046809 Bacteria 2839
529 Ga0495600_0241216 3300046809 Bacteria 1152
530 Ga0495604_0057569 3300047317 Bacteria 2988
531 Ga0495604_0242065 3300047317 Bacteria 1233
532 Ga0495674_0002013 3300047319 Bacteria 19981
533 Ga0495680_0342574 3300047322 Unclassified 1042
534 Ga0495675_0089947 3300047444 Unclassified 1927
535 Ga0495684_0027822 3300047471 Bacteria 4343
536 Ga0495684_0119732 3300047471 Bacteria 1984
537 Ga0495684_0275862 3300047471 Bacteria 1215
538 Ga0495602_0300116 3300048088 Unclassified 1176
539 Ga0495602_0315193 3300048088 Bacteria 1140
540 Ga0495602_0774501 3300048088 Bacteria 646
541 Ga0496102_0207068 3300048905 Bacteria 1849
542 Ga0496102_0634140 3300048905 Bacteria 992
543 Ga0496104_0047477 3300048907 Bacteria 4047
544 Ga0496104_1197291 3300048907 Unclassified 663
545 Ga0496111_0131675 3300048914 Bacteria 1851
546 Ga0496112_0061488 3300048915 Bacteria 3702
547 Ga0496112_0101961 3300048915 Bacteria 2840
548 Ga0496112_0287571 3300048915 Unclassified 1590
549 Ga0496113_0334258 3300048916 Bacteria 1215
550 Ga0496126_0055369 3300048929 Bacteria 3589
551 Ga0501031_0588911 3300049568 Unclassified 716
552 Ga0501032_0938061 3300049569 Unclassified 544
553 Ga0501033_0668672 3300049570 Unclassified 708
554 Ga0501043_0724242 3300049579 Unclassified 725
555 Ga0501067_0176944 3300049583 Bacteria 1188
556 Ga0501067_0442071 3300049583 Unclassified 726
557 Ga0501070_0147947 3300049586 Bacteria 1938
558 Ga0501073_0396171 3300049589 Unclassified 954
559 Ga0501035_0232514 3300049822 Bacteria 1571
560 Ga0501044_0005497 3300049823 Bacteria 14078
561 Ga0501044_0939324 3300049823 Unclassified 738
562 nmdc:mga05p37_304434_c1 3300050507 Bacteria 1036
563 nmdc:mga05p37_857809_c1 3300050507 Bacteria 985
564 nmdc:mga08y16_1375165_c1 3300050511 Bacteria 670
565 nmdc:mga08x19_433291_c1 3300050514 Unclassified 924
566 Ga0500651_0231644 3300053093 Bacteria 1080
567 Ga0587093_112645 3300059478 Unclassified 502
568 Ga0587070_029899 3300059491 Unclassified 980
569 Ga0587077_220757 3300059493 Unclassified 534
570 Ga0587080_017140 3300059503 Unclassified 1151
571 Ga0587080_074552 3300059503 Unclassified 685
572 Ga0587082_024353 3300059504 Unclassified 1010
573 Ga0587083_0003641 3300059505 Unclassified 2069
574 Ga0587083_0020963 3300059505 Unclassified 1209
575 Ga0587083_0196326 3300059505 Bacteria 574
576 Ga0587085_119151 3300059506 Unclassified 577
577 Ga0587088_058513 3300059508 Unclassified 775
578 Ga0587067_104540 3300059640 Unclassified 660
579 Ga0587067_105031 3300059640 Unclassified 659
580 Ga0587076_032544 3300059645 Unclassified 933
581 Ga0587079_101851 3300059647 Unclassified 687
582 Ga0587102_005661 3300059649 Unclassified 1111
583 Ga0587104_020208 3300059650 Unclassified 551
584 Ga0587119_021933 3300059658 Unclassified 821
585 Ga0587081_18343 3300060246 Unclassified 542
586 Ga0587071_016987 3300060344 Unclassified 1293
587 Ga0466962_0180311 3300061719 Bacteria 1029

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2786546940 2788435976 108
2 3300001989 JGI24739J22299_10212188 JGI24739J22299_102121881 112
3 3300001990 JGI24737J22298_10083107 JGI24737J22298_100831072 112
4 3300005327 Ga0070658_10243472 Ga0070658_102434722 112
5 3300005327 Ga0070658_10801807 Ga0070658_108018071 112
6 3300005327 Ga0070658_11254413 Ga0070658_112544131 112
7 3300005329 Ga0070683_100007613 Ga0070683_1000076138 112
8 3300005329 Ga0070683_100009342 Ga0070683_1000093427 112
9 3300005329 Ga0070683_100074415 Ga0070683_1000744152 112
10 3300005329 Ga0070683_100490649 Ga0070683_1004906492 112
11 3300005329 Ga0070683_100595490 Ga0070683_1005954902 112
12 3300005329 Ga0070683_101252808 Ga0070683_1012528082 112
13 3300005331 Ga0070670_100308523 Ga0070670_1003085232 112
14 3300005334 Ga0068869_100166301 Ga0068869_1001663012 112
15 3300005336 Ga0070680_100115864 Ga0070680_1001158642 112
16 3300005336 Ga0070680_100159325 Ga0070680_1001593252 112
17 3300005336 Ga0070680_100207879 Ga0070680_1002078793 112
18 3300005338 Ga0068868_100002892 Ga0068868_10000289210 112
19 3300005338 Ga0068868_100011357 Ga0068868_1000113575 112
20 3300005338 Ga0068868_100023407 Ga0068868_1000234075 112
21 3300005339 Ga0070660_100813462 Ga0070660_1008134622 112
22 3300005340 Ga0070689_100030045 Ga0070689_1000300453 112
23 3300005344 Ga0070661_100077422 Ga0070661_1000774222 112
24 3300005344 Ga0070661_100797848 Ga0070661_1007978481 112
25 3300005344 Ga0070661_101391096 Ga0070661_1013910962 112
26 3300005345 Ga0070692_10309238 Ga0070692_103092382 112
27 3300005354 Ga0070675_100322713 Ga0070675_1003227132 112
28 3300005355 Ga0070671_100042202 Ga0070671_1000422022 112
29 3300005364 Ga0070673_102354765 Ga0070673_1023547651 112
30 3300005366 Ga0070659_100181636 Ga0070659_1001816362 112
31 3300005366 Ga0070659_100522805 Ga0070659_1005228051 112
32 3300005367 Ga0070667_100516120 Ga0070667_1005161202 112
33 3300005434 Ga0070709_10099769 Ga0070709_100997693 112
34 3300005435 Ga0070714_100001278 Ga0070714_10000127814 112
35 3300005435 Ga0070714_100146155 Ga0070714_1001461553 112
36 3300005435 Ga0070714_100317158 Ga0070714_1003171583 112
37 3300005435 Ga0070714_100712498 Ga0070714_1007124982 112
38 3300005435 Ga0070714_100722815 Ga0070714_1007228152 112
39 3300005435 Ga0070714_100987096 Ga0070714_1009870961 112
40 3300005435 Ga0070714_102029110 Ga0070714_1020291101 112
41 3300005436 Ga0070713_100010422 Ga0070713_1000104222 112
42 3300005436 Ga0070713_100445816 Ga0070713_1004458162 112
43 3300005436 Ga0070713_100516815 Ga0070713_1005168152 112
44 3300005436 Ga0070713_100543498 Ga0070713_1005434982 112
45 3300005436 Ga0070713_101787737 Ga0070713_1017877371 112
46 3300005436 Ga0070713_101989266 Ga0070713_1019892661 112
47 3300005436 Ga0070713_102345368 Ga0070713_1023453682 112
48 3300005437 Ga0070710_10028217 Ga0070710_100282173 112
49 3300005437 Ga0070710_10775431 Ga0070710_107754311 112
50 3300005437 Ga0070710_11140390 Ga0070710_111403902 112
51 3300005439 Ga0070711_100077814 Ga0070711_1000778142 112
52 3300005439 Ga0070711_100116217 Ga0070711_1001162172 112
53 3300005439 Ga0070711_100125789 Ga0070711_1001257892 112
54 3300005439 Ga0070711_100233855 Ga0070711_1002338552 112
55 3300005439 Ga0070711_100980660 Ga0070711_1009806601 112
56 3300005439 Ga0070711_101063622 Ga0070711_1010636222 112
57 3300005439 Ga0070711_101626493 Ga0070711_1016264931 112
58 3300005444 Ga0070694_100875063 Ga0070694_1008750631 112
59 3300005445 Ga0070708_100501425 Ga0070708_1005014252 112
60 3300005455 Ga0070663_100800547 Ga0070663_1008005472 112
61 3300005457 Ga0070662_100050637 Ga0070662_1000506373 112
62 3300005458 Ga0070681_10001282 Ga0070681_1000128218 112
63 3300005458 Ga0070681_10031615 Ga0070681_100316153 112
64 3300005458 Ga0070681_10032389 Ga0070681_100323891 112
65 3300005458 Ga0070681_10369484 Ga0070681_103694842 112
66 3300005458 Ga0070681_10444310 Ga0070681_104443102 112
67 3300005459 Ga0068867_100009183 Ga0068867_1000091836 112
68 3300005459 Ga0068867_100693823 Ga0068867_1006938231 112
69 3300005466 Ga0070685_10923000 Ga0070685_109230002 112
70 3300005467 Ga0070706_100582375 Ga0070706_1005823752 112
71 3300005468 Ga0070707_100076196 Ga0070707_1000761962 112
72 3300005468 Ga0070707_100681989 Ga0070707_1006819892 112
73 3300005530 Ga0070679_100004510 Ga0070679_1000045104 112
74 3300005530 Ga0070679_100308309 Ga0070679_1003083091 112
75 3300005530 Ga0070679_100493780 Ga0070679_1004937802 112
76 3300005530 Ga0070679_100976104 Ga0070679_1009761041 112
77 3300005535 Ga0070684_100117711 Ga0070684_1001177111 112
78 3300005535 Ga0070684_100151473 Ga0070684_1001514732 112
79 3300005535 Ga0070684_100165012 Ga0070684_1001650121 112
80 3300005535 Ga0070684_100280780 Ga0070684_1002807801 112
81 3300005535 Ga0070684_100814618 Ga0070684_1008146181 112
82 3300005535 Ga0070684_101427488 Ga0070684_1014274881 112
83 3300005539 Ga0068853_100336992 Ga0068853_1003369923 112
84 3300005539 Ga0068853_100377786 Ga0068853_1003777862 112
85 3300005539 Ga0068853_100929481 Ga0068853_1009294811 112
86 3300005539 Ga0068853_101286758 Ga0068853_1012867581 112
87 3300005539 Ga0068853_101955511 Ga0068853_1019555111 112
88 3300005539 Ga0068853_101986356 Ga0068853_1019863561 112
89 3300005543 Ga0070672_100308831 Ga0070672_1003088312 112
90 3300005543 Ga0070672_100628533 Ga0070672_1006285331 112
91 3300005545 Ga0070695_100141018 Ga0070695_1001410181 112
92 3300005545 Ga0070695_101763695 Ga0070695_1017636951 112
93 3300005547 Ga0070693_100026548 Ga0070693_1000265481 112
94 3300005547 Ga0070693_100079286 Ga0070693_1000792861 112
95 3300005547 Ga0070693_100320493 Ga0070693_1003204931 112
96 3300005548 Ga0070665_100160391 Ga0070665_1001603912 112
97 3300005563 Ga0068855_100000234 Ga0068855_10000023415 112
98 3300005563 Ga0068855_100000432 Ga0068855_10000043228 112
99 3300005563 Ga0068855_100002034 Ga0068855_10000203414 112
100 3300005563 Ga0068855_100030374 Ga0068855_1000303744 112
101 3300005563 Ga0068855_100190196 Ga0068855_1001901963 112
102 3300005563 Ga0068855_100239106 Ga0068855_1002391062 112
103 3300005563 Ga0068855_101595520 Ga0068855_1015955202 112
104 3300005563 Ga0068855_101675000 Ga0068855_1016750001 112
105 3300005564 Ga0070664_100047322 Ga0070664_1000473221 112
106 3300005564 Ga0070664_100111666 Ga0070664_1001116662 112
107 3300005564 Ga0070664_100233340 Ga0070664_1002333402 112
108 3300005564 Ga0070664_100634760 Ga0070664_1006347602 112
109 3300005577 Ga0068857_100000096 Ga0068857_10000009619 112
110 3300005577 Ga0068857_100066916 Ga0068857_1000669164 112
111 3300005577 Ga0068857_100072363 Ga0068857_1000723633 112
112 3300005577 Ga0068857_100482048 Ga0068857_1004820482 112
113 3300005578 Ga0068854_100021654 Ga0068854_1000216543 112
114 3300005578 Ga0068854_100069393 Ga0068854_1000693933 112
115 3300005578 Ga0068854_101258624 Ga0068854_1012586241 112
116 3300005614 Ga0068856_100000062 Ga0068856_1000000623 112
117 3300005614 Ga0068856_100000179 Ga0068856_10000017948 112
118 3300005614 Ga0068856_100002175 Ga0068856_10000217510 112
119 3300005614 Ga0068856_100006231 Ga0068856_1000062319 112
120 3300005614 Ga0068856_100056448 Ga0068856_1000564482 112
121 3300005614 Ga0068856_102060169 Ga0068856_1020601691 112
122 3300005616 Ga0068852_100065418 Ga0068852_1000654183 112
123 3300005616 Ga0068852_100492136 Ga0068852_1004921361 112
124 3300005616 Ga0068852_101634655 Ga0068852_1016346551 112
125 3300005617 Ga0068859_100010599 Ga0068859_1000105992 112
126 3300005617 Ga0068859_100598981 Ga0068859_1005989812 112
127 3300005617 Ga0068859_100761365 Ga0068859_1007613652 112
128 3300005617 Ga0068859_102522365 Ga0068859_1025223652 112
129 3300005618 Ga0068864_100000129 Ga0068864_10000012923 112
130 3300005618 Ga0068864_101078384 Ga0068864_1010783842 112
131 3300005718 Ga0068866_10621363 Ga0068866_106213632 112
132 3300005719 Ga0068861_100038831 Ga0068861_1000388312 112
133 3300005834 Ga0068851_10100124 Ga0068851_101001242 112
134 3300005834 Ga0068851_10169279 Ga0068851_101692792 112
135 3300005834 Ga0068851_10264820 Ga0068851_102648201 112
136 3300005840 Ga0068870_10316028 Ga0068870_103160282 112
137 3300005841 Ga0068863_100026366 Ga0068863_1000263662 112
138 3300005841 Ga0068863_100207531 Ga0068863_1002075313 112
139 3300005841 Ga0068863_101149075 Ga0068863_1011490751 112
140 3300005841 Ga0068863_102613797 Ga0068863_1026137971 112
141 3300005842 Ga0068858_100022846 Ga0068858_1000228462 112
142 3300005842 Ga0068858_100025071 Ga0068858_1000250716 112
143 3300005842 Ga0068858_100030716 Ga0068858_1000307166 112
144 3300005842 Ga0068858_100631877 Ga0068858_1006318772 112
145 3300005843 Ga0068860_100062412 Ga0068860_1000624123 112
146 3300005843 Ga0068860_100819175 Ga0068860_1008191751 112
147 3300005843 Ga0068860_102284396 Ga0068860_1022843962 112
148 3300005843 Ga0068860_102625124 Ga0068860_1026251242 112
149 3300005937 Ga0081455_10004203 Ga0081455_1000420322 112
150 3300006028 Ga0070717_10008993 Ga0070717_100089932 112
151 3300006028 Ga0070717_10009110 Ga0070717_100091104 112
152 3300006028 Ga0070717_10022907 Ga0070717_100229073 112
153 3300006028 Ga0070717_10391938 Ga0070717_103919382 112
154 3300006028 Ga0070717_11177178 Ga0070717_111771781 112
155 3300006173 Ga0070716_100020959 Ga0070716_1000209591 112
156 3300006173 Ga0070716_101377353 Ga0070716_1013773531 112
157 3300006175 Ga0070712_100026229 Ga0070712_1000262292 112
158 3300006175 Ga0070712_100108632 Ga0070712_1001086322 112
159 3300006175 Ga0070712_100757866 Ga0070712_1007578661 112
160 3300006175 Ga0070712_101030200 Ga0070712_1010302001 112
161 3300006237 Ga0097621_100000196 Ga0097621_10000019635 112
162 3300006237 Ga0097621_100000326 Ga0097621_10000032627 112
163 3300006237 Ga0097621_100002114 Ga0097621_10000211416 112
164 3300006237 Ga0097621_100066365 Ga0097621_1000663652 112
165 3300006237 Ga0097621_101963939 Ga0097621_1019639391 112
166 3300006358 Ga0068871_100000049 Ga0068871_10000004926 112
167 3300006358 Ga0068871_100000729 Ga0068871_10000072920 112
168 3300006358 Ga0068871_100038114 Ga0068871_1000381144 112
169 3300006358 Ga0068871_101419834 Ga0068871_1014198341 112
170 3300006358 Ga0068871_102055265 Ga0068871_1020552652 112
171 3300006847 Ga0075431_101447682 Ga0075431_1014476821 112
172 3300006881 Ga0068865_100433159 Ga0068865_1004331591 112
173 3300006914 Ga0075436_100493957 Ga0075436_1004939572 112
174 3300006914 Ga0075436_100693741 Ga0075436_1006937411 112
175 3300006931 Ga0097620_100010599 Ga0097620_1000105992 112
176 3300006931 Ga0097620_100599037 Ga0097620_1005990372 112
177 3300006931 Ga0097620_100761191 Ga0097620_1007611912 112
178 3300006931 Ga0097620_102523503 Ga0097620_1025235031 112
179 3300009093 Ga0105240_10001598 Ga0105240_1000159819 112
180 3300009093 Ga0105240_10013638 Ga0105240_1001363811 112
181 3300009093 Ga0105240_10027316 Ga0105240_100273167 112
182 3300009093 Ga0105240_10095388 Ga0105240_100953883 112
183 3300009093 Ga0105240_10097173 Ga0105240_100971731 112
184 3300009093 Ga0105240_10106552 Ga0105240_101065523 112
185 3300009093 Ga0105240_10176064 Ga0105240_101760641 112
186 3300009093 Ga0105240_10228873 Ga0105240_102288732 112
187 3300009093 Ga0105240_10718411 Ga0105240_107184112 112
188 3300009093 Ga0105240_11745621 Ga0105240_117456211 112
189 3300009094 Ga0111539_12382874 Ga0111539_123828742 112
190 3300009098 Ga0105245_10257481 Ga0105245_102574813 112
191 3300009147 Ga0114129_10105829 Ga0114129_101058293 112
192 3300009147 Ga0114129_10165238 Ga0114129_101652382 112
193 3300009148 Ga0105243_10168691 Ga0105243_101686911 112
194 3300009174 Ga0105241_10008156 Ga0105241_100081563 112
195 3300009174 Ga0105241_10033741 Ga0105241_100337413 112
196 3300009174 Ga0105241_10191313 Ga0105241_101913132 112
197 3300009174 Ga0105241_10196967 Ga0105241_101969671 112
198 3300009174 Ga0105241_10429589 Ga0105241_104295892 112
199 3300009174 Ga0105241_10507246 Ga0105241_105072462 112
200 3300009174 Ga0105241_11449856 Ga0105241_114498561 112
201 3300009176 Ga0105242_10720222 Ga0105242_107202222 112
202 3300009176 Ga0105242_11653731 Ga0105242_116537312 112
203 3300009176 Ga0105242_12854410 Ga0105242_128544102 112
204 3300009177 Ga0105248_10044355 Ga0105248_100443552 112
205 3300009177 Ga0105248_10073446 Ga0105248_100734462 112
206 3300009177 Ga0105248_10834464 Ga0105248_108344642 112
207 3300009177 Ga0105248_12059109 Ga0105248_120591092 112
208 3300009177 Ga0105248_12863795 Ga0105248_128637952 112
209 3300009177 Ga0105248_12916198 Ga0105248_129161981 112
210 3300009545 Ga0105237_10008185 Ga0105237_100081852 112
211 3300009545 Ga0105237_10160393 Ga0105237_101603932 112
212 3300009545 Ga0105237_10285736 Ga0105237_102857362 112
213 3300009545 Ga0105237_10427281 Ga0105237_104272811 112
214 3300009545 Ga0105237_11532922 Ga0105237_115329222 112
215 3300009545 Ga0105237_11562799 Ga0105237_115627992 112
216 3300009545 Ga0105237_11757953 Ga0105237_117579531 112
217 3300009545 Ga0105237_11871812 Ga0105237_118718121 112
218 3300009551 Ga0105238_10000609 Ga0105238_1000060928 112
219 3300009551 Ga0105238_10139935 Ga0105238_101399352 112
220 3300009551 Ga0105238_10240461 Ga0105238_102404611 112
221 3300009551 Ga0105238_10397115 Ga0105238_103971151 112
222 3300009551 Ga0105238_10758335 Ga0105238_107583352 112
223 3300009551 Ga0105238_11170002 Ga0105238_111700022 112
224 3300009551 Ga0105238_11292781 Ga0105238_112927812 112
225 3300009551 Ga0105238_11564383 Ga0105238_115643832 112
226 3300009551 Ga0105238_12741458 Ga0105238_127414582 112
227 3300009553 Ga0105249_10207414 Ga0105249_102074142 112
228 3300009553 Ga0105249_10328166 Ga0105249_103281662 112
229 3300010375 Ga0105239_10012612 Ga0105239_100126125 112
230 3300010375 Ga0105239_10049542 Ga0105239_100495425 112
231 3300010375 Ga0105239_10210971 Ga0105239_102109711 112
232 3300010375 Ga0105239_10228767 Ga0105239_102287672 112
233 3300010375 Ga0105239_10625055 Ga0105239_106250552 112
234 3300010375 Ga0105239_11974254 Ga0105239_119742541 112
235 3300010375 Ga0105239_12662126 Ga0105239_126621261 112
236 3300011119 Ga0105246_11118563 Ga0105246_111185632 112
237 3300013100 Ga0157373_10003857 Ga0157373_100038575 112
238 3300013100 Ga0157373_10058761 Ga0157373_100587614 112
239 3300013102 Ga0157371_10064749 Ga0157371_100647492 112
240 3300013102 Ga0157371_10143062 Ga0157371_101430622 112
241 3300013104 Ga0157370_10061648 Ga0157370_100616482 112
242 3300013104 Ga0157370_10176757 Ga0157370_101767571 112
243 3300013104 Ga0157370_10433236 Ga0157370_104332362 112
244 3300013105 Ga0157369_10004488 Ga0157369_1000448814 112
245 3300013105 Ga0157369_10033990 Ga0157369_100339905 112
246 3300013105 Ga0157369_10046268 Ga0157369_100462683 112
247 3300013105 Ga0157369_10084750 Ga0157369_100847504 112
248 3300013105 Ga0157369_10118784 Ga0157369_101187842 112
249 3300013105 Ga0157369_10357707 Ga0157369_103577072 112
250 3300013105 Ga0157369_10389764 Ga0157369_103897642 112
251 3300013105 Ga0157369_10531414 Ga0157369_105314142 112
252 3300013105 Ga0157369_10566777 Ga0157369_105667772 112
253 3300013105 Ga0157369_10642938 Ga0157369_106429382 112
254 3300013296 Ga0157374_10000062 Ga0157374_1000006246 112
255 3300013296 Ga0157374_10000338 Ga0157374_1000033827 112
256 3300013296 Ga0157374_10000429 Ga0157374_1000042934 112
257 3300013297 Ga0157378_10000009 Ga0157378_1000000963 112
258 3300013297 Ga0157378_10000366 Ga0157378_100003666 112
259 3300013297 Ga0157378_10004757 Ga0157378_1000475711 112
260 3300013297 Ga0157378_11124214 Ga0157378_111242142 112
261 3300013297 Ga0157378_12706245 Ga0157378_127062451 112
262 3300013306 Ga0163162_10124391 Ga0163162_101243912 112
263 3300013306 Ga0163162_10807745 Ga0163162_108077452 112
264 3300013306 Ga0163162_12301952 Ga0163162_123019521 112
265 3300013307 Ga0157372_10001184 Ga0157372_1000118424 112
266 3300013307 Ga0157372_10002204 Ga0157372_1000220420 112
267 3300013307 Ga0157372_10003611 Ga0157372_100036115 112
268 3300013307 Ga0157372_10008115 Ga0157372_100081151 112
269 3300013307 Ga0157372_10013114 Ga0157372_100131146 112
270 3300013307 Ga0157372_10014116 Ga0157372_100141165 112
271 3300013307 Ga0157372_10015542 Ga0157372_100155423 112
272 3300013307 Ga0157372_10406393 Ga0157372_104063933 112
273 3300013307 Ga0157372_10425702 Ga0157372_104257022 112
274 3300013307 Ga0157372_10680962 Ga0157372_106809622 112
275 3300013308 Ga0157375_10874901 Ga0157375_108749012 112
276 3300014325 Ga0163163_10417152 Ga0163163_104171522 112
277 3300014325 Ga0163163_10454928 Ga0163163_104549282 112
278 3300014325 Ga0163163_11438726 Ga0163163_114387262 112
279 3300014325 Ga0163163_12442646 Ga0163163_124426461 112
280 3300014325 Ga0163163_12450965 Ga0163163_124509651 112
281 3300014326 Ga0157380_10081637 Ga0157380_100816372 112
282 3300014745 Ga0157377_10817226 Ga0157377_108172261 112
283 3300014968 Ga0157379_12659048 Ga0157379_126590481 112
284 3300014969 Ga0157376_10002214 Ga0157376_1000221415 112
285 3300014969 Ga0157376_10293308 Ga0157376_102933082 112
286 3300014969 Ga0157376_12068267 Ga0157376_120682672 112
287 3300017792 Ga0163161_11585217 Ga0163161_115852171 112
288 3300020076 Ga0206355_1332757 Ga0206355_13327572 112
289 3300021361 Ga0213872_10000901 Ga0213872_100009017 112
290 3300021377 Ga0213874_10007619 Ga0213874_100076193 112
291 3300021384 Ga0213876_10118354 Ga0213876_101183542 112
292 3300021388 Ga0213875_10000038 Ga0213875_1000003882 112
293 3300021388 Ga0213875_10038772 Ga0213875_100387722 112
294 3300021388 Ga0213875_10054195 Ga0213875_100541952 112
295 3300021388 Ga0213875_10105552 Ga0213875_101055522 112
296 3300021388 Ga0213875_10184044 Ga0213875_101840442 112
297 3300021388 Ga0213875_10370531 Ga0213875_103705311 112
298 3300021388 Ga0213875_10406238 Ga0213875_104062382 112
299 3300025315 Ga0207697_10330820 Ga0207697_103308202 112
300 3300025321 Ga0207656_10179152 Ga0207656_101791522 112
301 3300025898 Ga0207692_10003767 Ga0207692_100037674 112
302 3300025898 Ga0207692_10117018 Ga0207692_101170181 112
303 3300025898 Ga0207692_10802733 Ga0207692_108027331 112
304 3300025898 Ga0207692_10872694 Ga0207692_108726941 112
305 3300025899 Ga0207642_10442919 Ga0207642_104429191 112
306 3300025903 Ga0207680_10423345 Ga0207680_104233452 112
307 3300025904 Ga0207647_10015506 Ga0207647_100155065 112
308 3300025906 Ga0207699_10120990 Ga0207699_101209902 112
309 3300025906 Ga0207699_10464478 Ga0207699_104644782 112
310 3300025909 Ga0207705_10722407 Ga0207705_107224072 112
311 3300025910 Ga0207684_10349945 Ga0207684_103499452 112
312 3300025911 Ga0207654_10004195 Ga0207654_100041956 112
313 3300025911 Ga0207654_10056660 Ga0207654_100566602 112
314 3300025911 Ga0207654_10102401 Ga0207654_101024011 112
315 3300025911 Ga0207654_10108391 Ga0207654_101083913 112
316 3300025911 Ga0207654_10253495 Ga0207654_102534952 112
317 3300025912 Ga0207707_10001452 Ga0207707_100014526 112
318 3300025912 Ga0207707_10066848 Ga0207707_100668482 112
319 3300025912 Ga0207707_10092365 Ga0207707_100923652 112
320 3300025912 Ga0207707_10166468 Ga0207707_101664682 112
321 3300025912 Ga0207707_11353515 Ga0207707_113535152 112
322 3300025913 Ga0207695_10025592 Ga0207695_100255926 112
323 3300025913 Ga0207695_10025623 Ga0207695_100256235 112
324 3300025913 Ga0207695_10040956 Ga0207695_100409562 112
325 3300025913 Ga0207695_10053771 Ga0207695_100537715 112
326 3300025913 Ga0207695_10136233 Ga0207695_101362331 112
327 3300025913 Ga0207695_10172658 Ga0207695_101726582 112
328 3300025913 Ga0207695_10204016 Ga0207695_102040161 112
329 3300025913 Ga0207695_10332623 Ga0207695_103326231 112
330 3300025913 Ga0207695_10748367 Ga0207695_107483672 112
331 3300025913 Ga0207695_10807886 Ga0207695_108078862 112
332 3300025914 Ga0207671_10026301 Ga0207671_100263012 112
333 3300025914 Ga0207671_10059878 Ga0207671_100598781 112
334 3300025914 Ga0207671_10726549 Ga0207671_107265491 112
335 3300025915 Ga0207693_10010989 Ga0207693_100109898 112
336 3300025915 Ga0207693_10075630 Ga0207693_100756301 112
337 3300025915 Ga0207693_10483826 Ga0207693_104838261 112
338 3300025916 Ga0207663_10056900 Ga0207663_100569002 112
339 3300025916 Ga0207663_10221568 Ga0207663_102215681 112
340 3300025916 Ga0207663_10405041 Ga0207663_104050412 112
341 3300025916 Ga0207663_10768890 Ga0207663_107688902 112
342 3300025917 Ga0207660_10108136 Ga0207660_101081362 112
343 3300025917 Ga0207660_10933444 Ga0207660_109334442 112
344 3300025919 Ga0207657_10892800 Ga0207657_108928002 112
345 3300025920 Ga0207649_10050789 Ga0207649_100507892 112
346 3300025920 Ga0207649_10815561 Ga0207649_108155612 112
347 3300025921 Ga0207652_10016784 Ga0207652_100167842 112
348 3300025921 Ga0207652_10236448 Ga0207652_102364482 112
349 3300025921 Ga0207652_10460896 Ga0207652_104608962 112
350 3300025921 Ga0207652_10586168 Ga0207652_105861681 112
351 3300025921 Ga0207652_11027752 Ga0207652_110277522 112
352 3300025922 Ga0207646_11287529 Ga0207646_112875291 112
353 3300025924 Ga0207694_10041105 Ga0207694_100411052 112
354 3300025924 Ga0207694_10548857 Ga0207694_105488572 112
355 3300025924 Ga0207694_10619130 Ga0207694_106191302 112
356 3300025924 Ga0207694_10856263 Ga0207694_108562631 112
357 3300025924 Ga0207694_10859073 Ga0207694_108590731 112
358 3300025924 Ga0207694_11713057 Ga0207694_117130572 112
359 3300025925 Ga0207650_10007026 Ga0207650_100070262 112
360 3300025927 Ga0207687_10575373 Ga0207687_105753732 112
361 3300025928 Ga0207700_10028987 Ga0207700_100289874 112
362 3300025928 Ga0207700_10130146 Ga0207700_101301462 112
363 3300025928 Ga0207700_10144308 Ga0207700_101443082 112
364 3300025928 Ga0207700_10154738 Ga0207700_101547382 112
365 3300025928 Ga0207700_10381119 Ga0207700_103811191 112
366 3300025928 Ga0207700_11609580 Ga0207700_116095801 112
367 3300025928 Ga0207700_11685541 Ga0207700_116855411 112
368 3300025928 Ga0207700_11775093 Ga0207700_117750932 112
369 3300025929 Ga0207664_10018085 Ga0207664_100180853 112
370 3300025929 Ga0207664_10249767 Ga0207664_102497672 112
371 3300025929 Ga0207664_10251371 Ga0207664_102513712 112
372 3300025929 Ga0207664_10288312 Ga0207664_102883121 112
373 3300025929 Ga0207664_10349480 Ga0207664_103494802 112
374 3300025929 Ga0207664_10423162 Ga0207664_104231621 112
375 3300025929 Ga0207664_10920092 Ga0207664_109200922 112
376 3300025929 Ga0207664_10967978 Ga0207664_109679782 112
377 3300025932 Ga0207690_10139494 Ga0207690_101394942 112
378 3300025933 Ga0207706_10773407 Ga0207706_107734072 112
379 3300025934 Ga0207686_10551604 Ga0207686_105516041 112
380 3300025934 Ga0207686_11586971 Ga0207686_115869711 112
381 3300025936 Ga0207670_10011513 Ga0207670_100115135 112
382 3300025938 Ga0207704_10080427 Ga0207704_100804272 112
383 3300025938 Ga0207704_11345489 Ga0207704_113454892 112
384 3300025939 Ga0207665_10110320 Ga0207665_101103202 112
385 3300025940 Ga0207691_10499161 Ga0207691_104991612 112
386 3300025940 Ga0207691_11377275 Ga0207691_113772751 112
387 3300025941 Ga0207711_10006557 Ga0207711_100065572 112
388 3300025941 Ga0207711_10063738 Ga0207711_100637382 112
389 3300025941 Ga0207711_10612703 Ga0207711_106127031 112
390 3300025941 Ga0207711_11438595 Ga0207711_114385951 112
391 3300025942 Ga0207689_10623125 Ga0207689_106231252 112
392 3300025944 Ga0207661_10010786 Ga0207661_100107866 112
393 3300025944 Ga0207661_10022700 Ga0207661_100227002 112
394 3300025944 Ga0207661_10095051 Ga0207661_100950512 112
395 3300025944 Ga0207661_10598872 Ga0207661_105988721 112
396 3300025944 Ga0207661_10969924 Ga0207661_109699241 112
397 3300025945 Ga0207679_10001856 Ga0207679_100018563 112
398 3300025945 Ga0207679_10180510 Ga0207679_101805102 112
399 3300025945 Ga0207679_10323066 Ga0207679_103230661 112
400 3300025949 Ga0207667_10000465 Ga0207667_1000046531 112
401 3300025949 Ga0207667_10001399 Ga0207667_1000139922 112
402 3300025949 Ga0207667_10056204 Ga0207667_100562044 112
403 3300025949 Ga0207667_10203356 Ga0207667_102033562 112
404 3300025949 Ga0207667_10560641 Ga0207667_105606411 112
405 3300025949 Ga0207667_11275296 Ga0207667_112752962 112
406 3300025960 Ga0207651_10562083 Ga0207651_105620831 112
407 3300025961 Ga0207712_10222593 Ga0207712_102225932 112
408 3300025981 Ga0207640_10014902 Ga0207640_100149022 112
409 3300025981 Ga0207640_10032902 Ga0207640_100329023 112
410 3300025981 Ga0207640_10626605 Ga0207640_106266051 112
411 3300025986 Ga0207658_10446664 Ga0207658_104466642 112
412 3300025986 Ga0207658_11449919 Ga0207658_114499192 112
413 3300026023 Ga0207677_10010569 Ga0207677_100105695 112
414 3300026023 Ga0207677_10013510 Ga0207677_100135104 112
415 3300026023 Ga0207677_10086911 Ga0207677_100869111 112
416 3300026035 Ga0207703_10022458 Ga0207703_100224582 112
417 3300026035 Ga0207703_10088827 Ga0207703_100888272 112
418 3300026035 Ga0207703_10109831 Ga0207703_101098312 112
419 3300026035 Ga0207703_10750660 Ga0207703_107506602 112
420 3300026041 Ga0207639_10108956 Ga0207639_101089562 112
421 3300026041 Ga0207639_10167310 Ga0207639_101673103 112
422 3300026041 Ga0207639_10255152 Ga0207639_102551522 112
423 3300026041 Ga0207639_11296254 Ga0207639_112962542 112
424 3300026041 Ga0207639_12228114 Ga0207639_122281141 112
425 3300026067 Ga0207678_10527815 Ga0207678_105278152 112
426 3300026078 Ga0207702_10001051 Ga0207702_100010515 112
427 3300026078 Ga0207702_10008697 Ga0207702_100086973 112
428 3300026078 Ga0207702_10010332 Ga0207702_100103326 112
429 3300026078 Ga0207702_10184432 Ga0207702_101844322 112
430 3300026078 Ga0207702_10372751 Ga0207702_103727512 112
431 3300026088 Ga0207641_10020771 Ga0207641_100207715 112
432 3300026088 Ga0207641_10119719 Ga0207641_101197192 112
433 3300026089 Ga0207648_10015075 Ga0207648_100150753 112
434 3300026089 Ga0207648_10937897 Ga0207648_109378971 112
435 3300026095 Ga0207676_10030937 Ga0207676_100309372 112
436 3300026095 Ga0207676_10069123 Ga0207676_100691232 112
437 3300026116 Ga0207674_10026851 Ga0207674_100268515 112
438 3300026116 Ga0207674_10084204 Ga0207674_100842044 112
439 3300026118 Ga0207675_100080251 Ga0207675_1000802514 112
440 3300026121 Ga0207683_10085205 Ga0207683_100852052 112
441 3300026142 Ga0207698_10003245 Ga0207698_100032458 112
442 3300026142 Ga0207698_12474937 Ga0207698_124749372 112
443 3300028379 Ga0268266_10069735 Ga0268266_100697352 112
444 3300028379 Ga0268266_11227093 Ga0268266_112270932 112
445 3300028381 Ga0268264_10086311 Ga0268264_100863113 112
446 3300028381 Ga0268264_10316227 Ga0268264_103162272 112
447 3300028381 Ga0268264_12239314 Ga0268264_122393141 112
448 3300028800 Ga0265338_10548520 Ga0265338_105485201 112
449 3300031247 Ga0265340_10153168 Ga0265340_101531683 112
450 3300031344 Ga0265316_10082148 Ga0265316_100821482 112
451 3300034816 Ga0373930_0186724 Ga0373930_0186724_18_356 112
452 3300035083 Ga0373926_0181066 Ga0373926_0181066_223_561 112
453 3300035083 Ga0373926_0264381 Ga0373926_0264381_163_501 112
454 3300035170 Ga0373943_0065885 Ga0373943_0065885_142_480 112
455 3300035170 Ga0373943_0900331 Ga0373943_0900331_96_434 112
456 3300035692 Ga0373935_0062625 Ga0373935_0062625_1233_1571 112
457 3300035695 Ga0373927_0193509 Ga0373927_0193509_625_963 112
458 3300035695 Ga0373927_0509572 Ga0373927_0509572_268_606 112
459 3300035695 Ga0373927_0534642 Ga0373927_0534642_293_631 112
460 3300035724 Ga0373933_0069070 Ga0373933_0069070_1589_1927 112
461 3300035724 Ga0373933_1083608 Ga0373933_1083608_141_479 112
462 3300035725 Ga0373947_0326835 Ga0373947_0326835_337_675 112
463 3300035725 Ga0373947_1027479 Ga0373947_1027479_59_397 112
464 3300036401 Ga0373937_0177714 Ga0373937_0177714_21_362 112
465 3300036401 Ga0373937_1036859 Ga0373937_1036859_235_573 112
466 3300037068 Ga0373925_0015274 Ga0373925_0015274_3067_3405 112
467 3300037068 Ga0373925_0071685 Ga0373925_0071685_377_715 112
468 3300037853 Ga0436364_0175882 Ga0436364_0175882_4020_4358 112
469 3300037853 Ga0436364_0375830 Ga0436364_0375830_140_478 112
470 3300037853 Ga0436364_0439346 Ga0436364_0439346_641_979 112
471 3300037853 Ga0436364_0777617 Ga0436364_0777617_450_788 112
472 3300037853 Ga0436364_0991316 Ga0436364_0991316_178355_178693 112
473 3300037853 Ga0436364_1070982 Ga0436364_1070982_2533_2871 112
474 3300037853 Ga0436364_1176830 Ga0436364_1176830_362_700 112
475 3300037853 Ga0436364_1321514 Ga0436364_1321514_1481_1819 112
476 3300037853 Ga0436364_1391940 Ga0436364_1391940_298_636 112
477 3300037853 Ga0436364_1419506 Ga0436364_1419506_536_874 112
478 3300039437 Ga0436365_0775650 Ga0436365_0775650_352_690 112
479 3300039437 Ga0436365_1233600 Ga0436365_1233600_903_1241 112
480 3300039437 Ga0436365_1466134 Ga0436365_1466134_252_590 112
481 3300039438 Ga0436360_0003068 Ga0436360_0003068_476_814 112
482 3300039438 Ga0436360_0710635 Ga0436360_0710635_368_706 112
483 3300039438 Ga0436360_0728135 Ga0436360_0728135_121_459 112
484 3300039447 Ga0436361_0779674 Ga0436361_0779674_13809_14147 112
485 3300039450 Ga0436363_0817086 Ga0436363_0817086_118_456 112
486 3300039450 Ga0436363_1403142 Ga0436363_1403142_2248_2586 112
487 3300039453 Ga0436362_0100795 Ga0436362_0100795_78_416 112
488 3300041496 Ga0451839_1610675 Ga0451839_1610675_307_645 112
489 3300042876 Ga0451577_1156484 Ga0451577_1156484_49_387 112
490 3300042876 Ga0451577_1904137 Ga0451577_1904137_52_390 112
491 3300044683 Ga0466965_0125261 Ga0466965_0125261_431_769 112
492 3300044684 Ga0466966_0465269 Ga0466966_0465269_367_705 112
493 3300044693 Ga0466961_0046669 Ga0466961_0046669_371_709 112
494 3300044694 Ga0466963_0009340 Ga0466963_0009340_3107_3445 112
495 3300044694 Ga0466963_0047623 Ga0466963_0047623_1989_2327 112
496 3300044694 Ga0466963_0987964 Ga0466963_0987964_156_494 112
497 3300044712 Ga0453684_1966378 Ga0453684_1966378_234_572 112
498 3300044719 Ga0466971_0337885 Ga0466971_0337885_211_549 112
499 3300044765 Ga0466970_0799853 Ga0466970_0799853_164_502 112
500 3300044842 Ga0466957_0566169 Ga0466957_0566169_219_557 112
501 3300044842 Ga0466957_0705029 Ga0466957_0705029_161_499 112
502 3300045049 Ga0466959_0802933 Ga0466959_0802933_226_564 112
503 3300045051 Ga0451576_0615759 Ga0451576_0615759_19_357 112
504 3300045051 Ga0451576_0742037 Ga0451576_0742037_506_844 112
505 3300045836 Ga0466958_0083327 Ga0466958_0083327_1607_1945 112
506 3300045836 Ga0466958_0336930 Ga0466958_0336930_607_945 112
507 3300045836 Ga0466958_0427852 Ga0466958_0427852_179_517 112
508 3300045836 Ga0466958_0938008 Ga0466958_0938008_67_405 112
509 3300045976 Ga0466967_0050558 Ga0466967_0050558_971_1309 112
510 3300045976 Ga0466967_1001197 Ga0466967_1001197_30_368 112
511 3300045976 Ga0466967_2491441 Ga0466967_2491441_47_448 112
512 3300046454 Ga0495592_0113850 Ga0495592_0113850_117_455 112
513 3300046462 Ga0495651_0074977 Ga0495651_0074977_191_529 112
514 3300046463 Ga0495653_0598217 Ga0495653_0598217_225_563 112
515 3300046472 Ga0495580_0014909 Ga0495580_0014909_4606_4944 112
516 3300046475 Ga0495639_0432943 Ga0495639_0432943_237_575 112
517 3300046511 Ga0495608_0572912 Ga0495608_0572912_290_631 112
518 3300046516 Ga0495628_1024094 Ga0495628_1024094_107_445 112
519 3300046517 Ga0495630_1163026 Ga0495630_1163026_184_522 112
520 3300046529 Ga0495652_0610062 Ga0495652_0610062_219_560 112
521 3300046529 Ga0495652_0770800 Ga0495652_0770800_233_571 112
522 3300046533 Ga0495640_0125202 Ga0495640_0125202_871_1209 112
523 3300046536 Ga0495587_0825897 Ga0495587_0825897_38_376 112
524 3300046543 Ga0495645_0397314 Ga0495645_0397314_438_776 112
525 3300046543 Ga0495645_0634213 Ga0495645_0634213_285_623 112
526 3300046559 Ga0495667_0077874 Ga0495667_0077874_12_350 112
527 3300046559 Ga0495667_0292892 Ga0495667_0292892_227_568 112
528 3300046663 Ga0495635_0977871 Ga0495635_0977871_185_523 112
529 3300046809 Ga0495600_0046274 Ga0495600_0046274_2419_2757 112
530 3300046809 Ga0495600_0241216 Ga0495600_0241216_400_738 112
531 3300047317 Ga0495604_0057569 Ga0495604_0057569_1192_1530 112
532 3300047317 Ga0495604_0242065 Ga0495604_0242065_148_489 112
533 3300047319 Ga0495674_0002013 Ga0495674_0002013_15552_15890 112
534 3300047322 Ga0495680_0342574 Ga0495680_0342574_169_507 112
535 3300047444 Ga0495675_0089947 Ga0495675_0089947_1225_1563 112
536 3300047471 Ga0495684_0027822 Ga0495684_0027822_2456_2794 112
537 3300047471 Ga0495684_0119732 Ga0495684_0119732_739_1077 112
538 3300047471 Ga0495684_0275862 Ga0495684_0275862_652_990 112
539 3300048088 Ga0495602_0300116 Ga0495602_0300116_178_516 112
540 3300048088 Ga0495602_0315193 Ga0495602_0315193_752_1090 112
541 3300048088 Ga0495602_0774501 Ga0495602_0774501_29_367 112
542 3300048905 Ga0496102_0207068 Ga0496102_0207068_499_837 112
543 3300048905 Ga0496102_0634140 Ga0496102_0634140_530_868 112
544 3300048907 Ga0496104_0047477 Ga0496104_0047477_2719_3057 112
545 3300048907 Ga0496104_1197291 Ga0496104_1197291_11_349 112
546 3300048914 Ga0496111_0131675 Ga0496111_0131675_640_978 112
547 3300048915 Ga0496112_0061488 Ga0496112_0061488_413_751 112
548 3300048915 Ga0496112_0101961 Ga0496112_0101961_871_1209 112
549 3300048915 Ga0496112_0287571 Ga0496112_0287571_248_586 112
550 3300048916 Ga0496113_0334258 Ga0496113_0334258_189_527 112
551 3300048929 Ga0496126_0055369 Ga0496126_0055369_1850_2188 112
552 3300049568 Ga0501031_0588911 Ga0501031_0588911_133_471 112
553 3300049569 Ga0501032_0938061 Ga0501032_0938061_87_425 112
554 3300049570 Ga0501033_0668672 Ga0501033_0668672_267_605 112
555 3300049579 Ga0501043_0724242 Ga0501043_0724242_123_461 112
556 3300049583 Ga0501067_0176944 Ga0501067_0176944_485_823 112
557 3300049583 Ga0501067_0442071 Ga0501067_0442071_276_614 112
558 3300049586 Ga0501070_0147947 Ga0501070_0147947_1561_1899 112
559 3300049589 Ga0501073_0396171 Ga0501073_0396171_27_365 112
560 3300049822 Ga0501035_0232514 Ga0501035_0232514_930_1268 112
561 3300049823 Ga0501044_0005497 Ga0501044_0005497_5693_6031 112
562 3300049823 Ga0501044_0939324 Ga0501044_0939324_82_420 112
563 3300050507 nmdc:mga05p37_304434_c1 nmdc:mga05p37_304434_c1_344_682 112
564 3300050507 nmdc:mga05p37_857809_c1 nmdc:mga05p37_857809_c1_472_810 112
565 3300050511 nmdc:mga08y16_1375165_c1 nmdc:mga08y16_1375165_c1_141_479 112
566 3300050514 nmdc:mga08x19_433291_c1 nmdc:mga08x19_433291_c1_320_658 112
567 3300053093 Ga0500651_0231644 Ga0500651_0231644_266_604 112
568 3300059478 Ga0587093_112645 Ga0587093_112645_78_416 112
569 3300059491 Ga0587070_029899 Ga0587070_029899_628_966 112
570 3300059493 Ga0587077_220757 Ga0587077_220757_184_522 112
571 3300059503 Ga0587080_017140 Ga0587080_017140_78_416 112
572 3300059503 Ga0587080_074552 Ga0587080_074552_205_609 112
573 3300059504 Ga0587082_024353 Ga0587082_024353_553_891 112
574 3300059505 Ga0587083_0003641 Ga0587083_0003641_12_350 112
575 3300059505 Ga0587083_0020963 Ga0587083_0020963_856_1194 112
576 3300059505 Ga0587083_0196326 Ga0587083_0196326_226_564 112
577 3300059506 Ga0587085_119151 Ga0587085_119151_168_506 112
578 3300059508 Ga0587088_058513 Ga0587088_058513_78_416 112
579 3300059640 Ga0587067_104540 Ga0587067_104540_222_560 112
580 3300059640 Ga0587067_105031 Ga0587067_105031_237_575 112
581 3300059645 Ga0587076_032544 Ga0587076_032544_198_536 112
582 3300059647 Ga0587079_101851 Ga0587079_101851_115_453 112
583 3300059649 Ga0587102_005661 Ga0587102_005661_532_870 112
584 3300059650 Ga0587104_020208 Ga0587104_020208_184_522 112
585 3300059658 Ga0587119_021933 Ga0587119_021933_91_429 112
586 3300060246 Ga0587081_18343 Ga0587081_18343_192_530 112
587 3300060344 Ga0587071_016987 Ga0587071_016987_776_1114 112
588 3300061719 Ga0466962_0180311 Ga0466962_0180311_674_1012 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

23

128

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4y-assembly4.cif.gz_K glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.9861 2 112
1v9o-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9826 1 108
1v3s-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9781 1 108
1vfj-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.978 1 108
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9774 1 112
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9634 1 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9538 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9532 2 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9397 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9354 2 108 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9385 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A7C3Q2H0-F1-model_v4 P-II family nitrogen regulator 0.9311 1 108 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9294 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1F7F2C5-F1-model_v4 Transcriptional regulator 0.9292 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A7C4QCA3-F1-model_v4 P-II family nitrogen regulator 0.9206 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Feature Viewer

pLDDT pTM Quality
87.04 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map