F466810

General Info

Members Datasets Scaffolds Average Seq Length
588 395 426 172

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0002844|Ga0496118_0002844_3477_4085
Length 202
Sequence MSSTIPQKNLPVMPSCWIKDSADFPRQELLMATIRVLNRAETINALPELCDVIADCVNGGASVGFMLPFSPKDAEPFWQDVADAVEAGGTIHVVAEVNDKVVGTVQVGLASKPNQPHRGDLMKLLVHRSARGLGLARKLMEKVEQEAAKRGRTLLVLDTATGSDAEAIYPRLGWERVGVIPDYALFPDGRYCGTTLFYKRIG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
5 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
6 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
7 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
8 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
9 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
10 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
11 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
12 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
13 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
14 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
15 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
16 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
17 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
18 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
19 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
20 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
21 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
22 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
23 2643221582 Rhizobium sp. Root651 Isolate Unclassified
24 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
25 2643221693 Rhizobium sp. Root491 Isolate Unclassified
26 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
27 2718217882 Rhizobium sp. N741 Isolate Nodule
28 2718217927 Rhizobium sp. N324 Isolate Nodule
29 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
30 2718218009 Rhizobium sp. N561 Isolate Nodule
31 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
32 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
33 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
34 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
35 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
36 2718218363 Rhizobium sp. N113 Isolate Nodule
37 2718218365 Rhizobium sp. N731 Isolate Nodule
38 2718218366 Rhizobium sp. N621 Isolate Nodule
39 2718218423 Rhizobium sp. N941 Isolate Nodule
40 2721755514 Rhizobium sp. N6212 Isolate Nodule
41 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
42 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
43 2721755809 Rhizobium sp. N541 Isolate Nodule
44 2721755810 Rhizobium sp. N871 Isolate Nodule
45 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
46 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
47 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
48 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
49 2728369365 Rhizobium sp. N1341 Isolate Nodule
50 2728369397 Rhizobium sp. N1314 Isolate Nodule
51 2738541293 Rhizobium sp. GV031 Isolate Unclassified
52 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
53 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
54 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
55 2791355256 Rhizobium sp. M10 Isolate Nodule
56 2791355260 Rhizobium sp. L9 Isolate Nodule
57 2791355262 Rhizobium sp. M1 Isolate Nodule
58 2791355264 Rhizobium sp. S9 Isolate Nodule
59 2791355265 Rhizobium sp. H4 Isolate Nodule
60 2791355267 Rhizobium sp. L18 Isolate Nodule
61 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
62 2802429633 Rhizobium anhuiense J3 Isolate Nodule
63 2802429634 Rhizobium anhuiense S10 Isolate Nodule
64 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
65 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
66 2802429637 Rhizobium anhuiense C15 Isolate Nodule
67 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
68 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
69 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
70 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
71 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
72 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
73 2838048938 Rhizobium pisi 27/80 Isolate Nodule
74 2838061910 Rhizobium phaseoli L15 Isolate Nodule
75 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
76 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
77 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
78 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
79 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
80 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
81 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
82 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
83 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
84 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
85 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
86 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
87 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
88 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
89 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
90 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
91 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
92 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
93 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
94 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
95 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
96 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
97 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
98 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
99 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
100 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
101 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
102 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
103 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
104 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
105 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
106 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
107 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
108 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
109 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
110 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
111 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
112 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
113 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
114 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
115 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
116 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
117 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
118 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
119 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
120 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
121 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
122 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
123 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
124 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
125 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
126 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
127 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
128 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
129 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
130 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
131 2933599457 Rhizobium phaseoli M3 Isolate Nodule
132 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
133 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
134 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
135 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
136 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
137 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
138 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
139 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
140 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
141 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
142 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
143 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
144 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
145 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
146 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
147 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
148 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
149 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
150 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
151 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
152 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
153 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
154 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
155 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
156 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
157 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
158 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
159 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
160 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
161 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
162 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
163 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
164 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
165 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
166 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
167 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
168 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
169 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
170 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
171 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
172 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
173 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
174 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
175 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
176 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
177 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
178 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
179 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
180 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
181 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
182 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
183 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
184 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
185 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
186 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
187 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
188 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
189 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
190 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
191 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
192 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
193 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
194 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
195 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
196 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
197 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
198 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
199 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
200 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
201 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
202 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
203 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
204 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
205 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
206 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
207 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
210 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
211 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
212 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
213 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
214 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
215 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
217 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
218 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
219 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
220 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
222 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
223 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
224 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
227 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
230 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
232 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
234 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
253 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
257 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
258 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
264 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
265 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
349 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
362 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
372 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
375 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
376 8005275841 Rhizobium sp. N4311 Isolate Nodule
377 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
378 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
379 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
380 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
381 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
382 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
383 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
384 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
385 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
386 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
387 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
388 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
389 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
390 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
391 8018176218 Rhizobium sp. N122 Isolate Nodule
392 8024501048 Rhizobium sp. H4 Isolate Nodule
393 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
394 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
395 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.28
Metatranscriptomes 0
Isolates 27.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 20.24
Nodule 18.88
Rhizoplane 3.57
Rhizosphere 36.05
Stem 0
Stem Tuber 0
Unclassified 20.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000053 3300001979 Bacteria 37167
2 JGI25155J39150_1000050 3300002704 Bacteria 76996
3 JGI25156J39149_1000074 3300002705 Bacteria 76996
4 JGI25162J39368_1001736 3300002737 Bacteria 10482
5 JGI25162J39368_1001902 3300002737 Bacteria 9577
6 JGI25154J39366_1000099 3300002738 Bacteria 76996
7 JGI25157J39369_1000090 3300002741 Bacteria 76996
8 JGI25150J39212_1000203 3300002774 Bacteria 32405
9 JGI25151J46595_10000278 3300003187 Bacteria 58449
10 JGI25151J46595_10000439 3300003187 Bacteria 41010
11 JGI25151J46595_10025464 3300003187 Bacteria 2407
12 JGI25165J46597_1001637 3300003214 Bacteria 10466
13 JGI25153J46596_10009890 3300003215 Bacteria 4373
14 rootH1_10031817 3300003316 Bacteria 2013
15 rootH1_10031817 3300003323 Bacteria 9177
16 rootL2_10004234 3300003322 Bacteria 4285
17 rootH1_10092702 3300003323 Bacteria 1194
18 JGI25161J50226_1005391 3300003374 Bacteria 2489
19 Ga0055526_1003108 3300003771 Bacteria 10766
20 Ga0055526_1008483 3300003771 Bacteria 5122
21 Ga0055526_1009488 3300003771 Bacteria 4670
22 Ga0055524_1002915 3300003775 Bacteria 8546
23 Ga0055528_1002379 3300003790 Bacteria 10154
24 Ga0055528_1002548 3300003790 Bacteria 9669
25 Ga0055528_1022196 3300003790 Bacteria 1984
26 Ga0055528_1023949 3300003790 Bacteria 1845
27 Ga0055540_1002511 3300003792 Bacteria 9595
28 Ga0058692_1000689 3300003856 Bacteria 13918
29 Ga0058692_1005646 3300003856 Bacteria 3542
30 Ga0055543_1000963 3300004625 Bacteria 13124
31 Ga0065165_1003744 3300005262 Bacteria 10230
32 Ga0070692_10289200 3300005345 Unclassified 996
33 Ga0070668_100051170 3300005347 Bacteria 3182
34 Ga0070668_100123966 3300005347 Bacteria 2068
35 Ga0070669_100180936 3300005353 Bacteria 1649
36 Ga0070671_100008057 3300005355 Bacteria 8434
37 Ga0070667_100476304 3300005367 Bacteria 1143
38 Ga0070713_100433435 3300005436 Unclassified 1232
39 Ga0070701_10014015 3300005438 Bacteria 3665
40 Ga0070711_100163193 3300005439 Unclassified 1691
41 Ga0070705_100000075 3300005440 Bacteria 54228
42 Ga0070705_100233628 3300005440 Bacteria 1281
43 Ga0070705_101113288 3300005440 Unclassified 647
44 Ga0070694_100000624 3300005444 Bacteria 19495
45 Ga0070694_100428801 3300005444 Bacteria 1040
46 Ga0070663_100202778 3300005455 Bacteria 1549
47 Ga0070707_101345325 3300005468 Bacteria 681
48 Ga0070698_100010742 3300005471 Bacteria 9743
49 Ga0070699_100006269 3300005518 Bacteria 10378
50 Ga0070699_100880935 3300005518 Bacteria 820
51 Ga0070699_101713126 3300005518 Bacteria 576
52 Ga0070697_100059408 3300005536 Bacteria 3114
53 Ga0070697_100329102 3300005536 Bacteria 1317
54 Ga0070695_100000372 3300005545 Bacteria 22981
55 Ga0070696_100001322 3300005546 Bacteria 16160
56 Ga0070696_100004082 3300005546 Bacteria 9735
57 Ga0070696_100033773 3300005546 Unclassified 3517
58 Ga0070665_100003012 3300005548 Bacteria 18172
59 Ga0070665_100787846 3300005548 Bacteria 964
60 Ga0070704_100077962 3300005549 Unclassified 2429
61 Ga0070664_100132215 3300005564 Bacteria 2192
62 Ga0070664_100425773 3300005564 Bacteria 1216
63 Ga0068856_100043723 3300005614 Bacteria 4407
64 Ga0070702_100014011 3300005615 Unclassified 4061
65 Ga0070702_100128525 3300005615 Bacteria 1597
66 Ga0068861_100434465 3300005719 Bacteria 1172
67 Ga0075365_10001132 3300006038 Bacteria 11668
68 Ga0075365_10279871 3300006038 Bacteria 1174
69 Ga0075368_10000391 3300006042 Bacteria 12927
70 Ga0075368_10058098 3300006042 Bacteria 1545
71 Ga0075368_10074020 3300006042 Bacteria 1379
72 Ga0075363_100258873 3300006048 Bacteria 1003
73 Ga0075364_10091333 3300006051 Bacteria 2020
74 Ga0070712_100005457 3300006175 Bacteria 7877
75 Ga0075362_10162655 3300006177 Bacteria 1075
76 Ga0075367_10002704 3300006178 Bacteria 8180
77 Ga0075367_10026689 3300006178 Bacteria 3277
78 Ga0075367_10071640 3300006178 Bacteria 2085
79 Ga0075367_10075331 3300006178 Bacteria 2035
80 Ga0075367_10273499 3300006178 Bacteria 1061
81 Ga0075369_10106870 3300006186 Bacteria 1259
82 Ga0075369_10349512 3300006186 Bacteria 693
83 Ga0075366_10004917 3300006195 Bacteria 7207
84 Ga0075366_10136653 3300006195 Bacteria 1480
85 Ga0075370_10011402 3300006353 Bacteria 4669
86 Ga0075370_10019344 3300006353 Bacteria 3708
87 Ga0075428_100000601 3300006844 Bacteria 36748
88 Ga0075431_100292640 3300006847 Unclassified 1647
89 Ga0075433_10072977 3300006852 Bacteria 3018
90 Ga0075433_10126162 3300006852 Bacteria 2273
91 Ga0075433_10163629 3300006852 Bacteria 1980
92 Ga0075434_100012223 3300006871 Bacteria 8134
93 Ga0075434_100012374 3300006871 Bacteria 8086
94 Ga0075434_100545453 3300006871 Bacteria 1179
95 Ga0075429_100037275 3300006880 Bacteria 4233
96 Ga0075436_100021863 3300006914 Unclassified 4392
97 Ga0099826_10001162 3300006948 Bacteria 15168
98 Ga0075435_100015084 3300007076 Bacteria 5801
99 Ga0075435_100149377 3300007076 Bacteria 1964
100 Ga0105250_10015632 3300009092 Bacteria 3107
101 Ga0105250_10233830 3300009092 Bacteria 782
102 Ga0105247_10133399 3300009101 Bacteria 1620
103 Ga0114129_10002054 3300009147 Bacteria 27646
104 Ga0114129_10006329 3300009147 Bacteria 16791
105 Ga0114129_10163947 3300009147 Bacteria 3034
106 Ga0105243_10044822 3300009148 Bacteria 3472
107 Ga0105243_10087173 3300009148 Bacteria 2562
108 Ga0105243_10458479 3300009148 Bacteria 1198
109 Ga0105248_10006268 3300009177 Bacteria 13043
110 Ga0105249_10026805 3300009553 Bacteria 5197
111 Ga0105246_10027302 3300011119 Bacteria 3739
112 Ga0105246_10216373 3300011119 Bacteria 1499
113 Ga0157373_10009759 3300013100 Bacteria 7081
114 Ga0157371_10000004 3300013102 Bacteria 512593
115 Ga0157370_10002827 3300013104 Bacteria 20746
116 Ga0209435_100063 3300025206 Bacteria 77066
117 Ga0209672_104087 3300025228 Bacteria 2804
118 Ga0209437_100050 3300025233 Bacteria 394010
119 Ga0209437_100412 3300025233 Bacteria 39209
120 Ga0207425_1000052 3300025245 Bacteria 162123
121 Ga0207425_1006026 3300025245 Bacteria 3372
122 Ga0209646_1000187 3300025246 Bacteria 77066
123 Ga0209646_1003218 3300025246 Bacteria 3276
124 Ga0209026_1000227 3300025250 Bacteria 77066
125 Ga0209148_1017747 3300025254 Bacteria 1204
126 Ga0209759_1000258 3300025256 Bacteria 77066
127 Ga0209129_1000446 3300025258 Bacteria 30875
128 Ga0209129_1000511 3300025258 Bacteria 27738
129 Ga0209129_1002569 3300025258 Bacteria 8734
130 Ga0209129_1002598 3300025258 Bacteria 8634
131 Ga0209233_1000037 3300025261 Bacteria 554620
132 Ga0209233_1000374 3300025261 Bacteria 39322
133 Ga0209455_1027798 3300025272 Bacteria 996
134 Ga0209673_1000135 3300025273 Bacteria 160333
135 Ga0209673_1000378 3300025273 Bacteria 80351
136 Ga0209673_1012682 3300025273 Bacteria 3379
137 Ga0209673_1019956 3300025273 Bacteria 2390
138 Ga0209673_1056152 3300025273 Bacteria 1010
139 Ga0209130_1038379 3300025284 Bacteria 939
140 Ga0209675_1029429 3300025291 Bacteria 1323
141 Ga0209675_1084714 3300025291 Bacteria 581
142 Ga0209676_1022760 3300025292 Bacteria 2068
143 Ga0209025_1000060 3300025294 Bacteria 305017
144 Ga0209025_1000144 3300025294 Bacteria 181446
145 Ga0209025_1000921 3300025294 Bacteria 45037
146 Ga0209025_1033493 3300025294 Bacteria 2372
147 Ga0209025_1055066 3300025294 Bacteria 1541
148 Ga0209564_1000138 3300025295 Bacteria 181512
149 Ga0209564_1000917 3300025295 Bacteria 38479
150 Ga0209564_1042467 3300025295 Bacteria 1205
151 Ga0209758_1000519 3300025297 Bacteria 61859
152 Ga0209758_1003402 3300025297 Bacteria 14535
153 Ga0209758_1003665 3300025297 Bacteria 13681
154 Ga0209758_1004523 3300025297 Bacteria 11519
155 Ga0209256_1001375 3300025299 Bacteria 25501
156 Ga0209256_1003005 3300025299 Bacteria 12515
157 Ga0209256_1011535 3300025299 Bacteria 3517
158 Ga0207426_1000142 3300025302 Bacteria 194023
159 Ga0207426_1000608 3300025302 Bacteria 46209
160 Ga0209051_1001981 3300025303 Bacteria 15736
161 Ga0209051_1003694 3300025303 Bacteria 9879
162 Ga0209257_1004390 3300025304 Bacteria 10962
163 Ga0207696_1086664 3300025711 Bacteria 861
164 Ga0207653_10047979 3300025885 Bacteria 1415
165 Ga0207699_10109083 3300025906 Bacteria 1771
166 Ga0207693_10000079 3300025915 Bacteria 86388
167 Ga0207663_10060316 3300025916 Bacteria 2404
168 Ga0207681_10253886 3300025923 Bacteria 1374
169 Ga0207681_10392872 3300025923 Bacteria 1119
170 Ga0207700_10307973 3300025928 Bacteria 1369
171 Ga0207700_10407157 3300025928 Bacteria 1193
172 Ga0207709_10528132 3300025935 Unclassified 925
173 Ga0207709_11183710 3300025935 Bacteria 629
174 Ga0207711_11136361 3300025941 Bacteria 722
175 Ga0207668_10182818 3300025972 Bacteria 1655
176 Ga0207668_10736785 3300025972 Bacteria 869
177 Ga0207658_10387149 3300025986 Bacteria 1226
178 Ga0207678_10070371 3300026067 Bacteria 3000
179 Ga0207702_10068536 3300026078 Bacteria 3048
180 Ga0207641_11385903 3300026088 Bacteria 704
181 Ga0207675_100221926 3300026118 Bacteria 1821
182 Ga0209371_1000009 3300027312 Bacteria 963030
183 Ga0209371_1000732 3300027312 Bacteria 27595
184 Ga0209371_1002043 3300027312 Bacteria 12066
185 Ga0209371_1006919 3300027312 Bacteria 4080
186 Ga0209282_1000179 3300027666 Bacteria 34839
187 Ga0209813_10020985 3300027866 Bacteria 1833
188 Ga0209813_10059388 3300027866 Bacteria 1217
189 Ga0268266_10005424 3300028379 Bacteria 11894
190 Ga0268265_10921516 3300028380 Bacteria 859
191 Ga0268256_1000010 3300030500 Bacteria 963034
192 Ga0268256_1006562 3300030500 Bacteria 4302
193 Ga0268256_1007368 3300030500 Bacteria 3935
194 Ga0316181_1290736 3300030744 Bacteria 1163
195 Ga0316182_1001511 3300030745 Bacteria 2679
196 Ga0307405_10000276 3300031731 Bacteria 18944
197 Ga0307406_10029557 3300031901 Bacteria 3320
198 Ga0307412_10003582 3300031911 Bacteria 8625
199 Ga0373924_0291006 3300035410 Bacteria 725
200 Ga0436364_0566421 3300037853 Bacteria 6378
201 Ga0439438_064358 3300041405 Bacteria 914
202 Ga0439465_0015434 3300041413 Bacteria 2383
203 Ga0439445_0066731 3300042004 Bacteria 991
204 Ga0439449_0095057 3300042007 Bacteria 1101
205 Ga0439457_065527 3300042014 Bacteria 825
206 Ga0466966_0503215 3300044684 Bacteria 729
207 Ga0466963_0077794 3300044694 Bacteria 2242
208 Ga0466970_0015232 3300044765 Bacteria 3954
209 Ga0451576_0360539 3300045051 Bacteria 1522
210 Ga0466967_0358596 3300045976 Bacteria 1412
211 Ga0466967_0472198 3300045976 Bacteria 1228
212 Ga0495617_054403 3300046452 Bacteria 1329
213 Ga0495590_0037000 3300046457 Bacteria 1702
214 Ga0495590_0049337 3300046457 Bacteria 1469
215 Ga0495638_0000546 3300046460 Bacteria 42990
216 Ga0495650_0031141 3300046471 Bacteria 2405
217 Ga0495650_0132834 3300046471 Bacteria 906
218 Ga0495605_0004579 3300046474 Bacteria 8095
219 Ga0495605_0159098 3300046474 Bacteria 1003
220 Ga0495605_0288348 3300046474 Bacteria 696
221 Ga0495584_0100628 3300046491 Bacteria 1461
222 Ga0495585_0045991 3300046492 Bacteria 2435
223 Ga0495607_0141343 3300046501 Bacteria 1241
224 Ga0495583_0010327 3300046506 Bacteria 5455
225 Ga0495583_0048254 3300046506 Bacteria 1955
226 Ga0495606_0004551 3300046507 Bacteria 13782
227 Ga0495606_0025802 3300046507 Bacteria 4200
228 Ga0495606_0079582 3300046507 Bacteria 2041
229 Ga0495610_0001900 3300046512 Bacteria 18031
230 Ga0495610_0010290 3300046512 Bacteria 5825
231 Ga0495616_0043842 3300046513 Bacteria 2271
232 Ga0495620_0018667 3300046515 Bacteria 3431
233 Ga0495631_0004372 3300046518 Bacteria 7528
234 Ga0495632_0041896 3300046519 Bacteria 2298
235 Ga0495643_0035823 3300046522 Bacteria 2730
236 Ga0495643_0036501 3300046522 Bacteria 2699
237 Ga0495654_0028560 3300046530 Bacteria 2852
238 Ga0495621_0015558 3300046539 Unclassified 2428
239 Ga0495633_0105083 3300046558 Bacteria 1310
240 Ga0495668_0005766 3300046616 Bacteria 8278
241 Ga0495611_0011389 3300046648 Bacteria 3770
242 Ga0495625_0004012 3300046660 Bacteria 14085
243 Ga0495659_0014231 3300046664 Unclassified 2602
244 Ga0495659_0031027 3300046664 Unclassified 1863
245 Ga0495659_0064830 3300046664 Bacteria 1357
246 Ga0495670_0062245 3300046691 Bacteria 1877
247 Ga0495671_0151962 3300046692 Bacteria 1127
248 Ga0495671_0180186 3300046692 Bacteria 1026
249 Ga0495649_0054471 3300046694 Bacteria 2163
250 Ga0495636_0034253 3300047318 Bacteria 2090
251 Ga0495636_0176210 3300047318 Unclassified 969
252 Ga0495687_110831 3300047443 Bacteria 1009
253 Ga0495685_016907 3300047447 Unclassified 2494
254 Ga0495673_0029044 3300047469 Bacteria 2613
255 Ga0495673_0118577 3300047469 Bacteria 1050
256 Ga0495681_0004119 3300047470 Bacteria 9993
257 Ga0495686_0040582 3300047472 Bacteria 2967
258 Ga0495686_0239158 3300047472 Bacteria 1025
259 Ga0495686_0563532 3300047472 Bacteria 593
260 Ga0495615_0005775 3300048090 Bacteria 2250
261 Ga0495626_0291108 3300048091 Bacteria 647
262 Ga0496100_0245329 3300048903 Bacteria 1323
263 Ga0496101_0138243 3300048904 Bacteria 1855
264 Ga0496101_0345714 3300048904 Bacteria 1168
265 Ga0496102_0390245 3300048905 Bacteria 1309
266 Ga0496103_0152335 3300048906 Bacteria 1481
267 Ga0496104_0065694 3300048907 Bacteria 3443
268 Ga0496105_0182798 3300048908 Bacteria 1716
269 Ga0496106_0504680 3300048909 Bacteria 971
270 Ga0496107_0160549 3300048910 Bacteria 1666
271 Ga0496108_0265486 3300048911 Bacteria 1494
272 Ga0496110_0179467 3300048913 Bacteria 1922
273 Ga0496110_0194099 3300048913 Bacteria 1844
274 Ga0496111_0261002 3300048914 Bacteria 1285
275 Ga0496112_0490287 3300048915 Bacteria 1165
276 Ga0496113_0120064 3300048916 Bacteria 2054
277 Ga0496113_0209237 3300048916 Bacteria 1552
278 Ga0496114_0282557 3300048917 Bacteria 1463
279 Ga0496116_0008582 3300048919 Bacteria 8841
280 Ga0496116_0019332 3300048919 Bacteria 5217
281 Ga0496116_0038069 3300048919 Bacteria 3345
282 Ga0496116_0041834 3300048919 Bacteria 3139
283 Ga0496116_0068596 3300048919 Bacteria 2258
284 Ga0496116_0083811 3300048919 Bacteria 1966
285 Ga0496116_0154552 3300048919 Bacteria 1268
286 Ga0496116_0270563 3300048919 Unclassified 830
287 Ga0496117_0000002 3300048920 Bacteria 2483758
288 Ga0496117_0016354 3300048920 Bacteria 6263
289 Ga0496117_0026399 3300048920 Bacteria 4545
290 Ga0496117_0101874 3300048920 Bacteria 1813
291 Ga0496117_0136402 3300048920 Bacteria 1477
292 Ga0496117_0184302 3300048920 Bacteria 1196
293 Ga0496117_0190820 3300048920 Bacteria 1167
294 Ga0496117_0260028 3300048920 Bacteria 942
295 Ga0496118_0002844 3300048921 Bacteria 22597
296 Ga0496118_0014526 3300048921 Bacteria 7364
297 Ga0496118_0015718 3300048921 Bacteria 6987
298 Ga0496118_0041063 3300048921 Bacteria 3669
299 Ga0496118_0067102 3300048921 Bacteria 2615
300 Ga0496118_0074170 3300048921 Bacteria 2433
301 Ga0496118_0146216 3300048921 Bacteria 1488
302 Ga0496119_0010067 3300048922 Bacteria 7995
303 Ga0496119_0038516 3300048922 Bacteria 3087
304 Ga0496119_0063667 3300048922 Bacteria 2192
305 Ga0496119_0093038 3300048922 Bacteria 1709
306 Ga0496119_0117466 3300048922 Bacteria 1466
307 Ga0496119_0179094 3300048922 Bacteria 1113
308 Ga0496120_0000034 3300048923 Bacteria 215228
309 Ga0496120_0006317 3300048923 Bacteria 9122
310 Ga0496120_0087288 3300048923 Bacteria 1675
311 Ga0496120_0123794 3300048923 Bacteria 1333
312 Ga0496121_0000220 3300048924 Bacteria 123930
313 Ga0496121_0053756 3300048924 Bacteria 3371
314 Ga0496121_0071978 3300048924 Bacteria 2777
315 Ga0496121_0072486 3300048924 Bacteria 2764
316 Ga0496121_0118970 3300048924 Bacteria 1999
317 Ga0496121_0120693 3300048924 Bacteria 1980
318 Ga0496121_0182974 3300048924 Bacteria 1510
319 Ga0496121_0251094 3300048924 Bacteria 1227
320 Ga0496121_0351009 3300048924 Bacteria 982
321 Ga0496121_0364907 3300048924 Bacteria 957
322 Ga0496121_0370855 3300048924 Bacteria 947
323 Ga0496121_0410945 3300048924 Bacteria 883
324 Ga0496121_0430098 3300048924 Unclassified 856
325 Ga0496122_0000001 3300048925 Bacteria 1827766
326 Ga0496122_0024928 3300048925 Bacteria 5219
327 Ga0496122_0050049 3300048925 Bacteria 3190
328 Ga0496122_0054274 3300048925 Bacteria 3011
329 Ga0496122_0070088 3300048925 Bacteria 2507
330 Ga0496122_0073377 3300048925 Bacteria 2426
331 Ga0496122_0089080 3300048925 Bacteria 2111
332 Ga0496122_0174181 3300048925 Bacteria 1292
333 Ga0496123_0000001 3300048926 Bacteria 1831497
334 Ga0496123_0014463 3300048926 Bacteria 6539
335 Ga0496123_0028781 3300048926 Bacteria 4106
336 Ga0496123_0042719 3300048926 Bacteria 3124
337 Ga0496123_0055753 3300048926 Bacteria 2589
338 Ga0496123_0056483 3300048926 Bacteria 2565
339 Ga0496123_0089649 3300048926 Bacteria 1831
340 Ga0496123_0119384 3300048926 Bacteria 1487
341 Ga0496123_0299844 3300048926 Bacteria 768
342 Ga0496124_0000083 3300048927 Bacteria 207798
343 Ga0496124_0009881 3300048927 Bacteria 9758
344 Ga0496124_0013228 3300048927 Bacteria 8070
345 Ga0496124_0024872 3300048927 Bacteria 5435
346 Ga0496124_0040728 3300048927 Bacteria 4016
347 Ga0496124_0201421 3300048927 Bacteria 1513
348 Ga0496124_0241316 3300048927 Bacteria 1343
349 Ga0496124_0270861 3300048927 Bacteria 1243
350 Ga0496124_0435239 3300048927 Bacteria 899
351 Ga0496125_0000001 3300048928 Bacteria 1766138
352 Ga0496125_0009589 3300048928 Bacteria 9907
353 Ga0496125_0042743 3300048928 Bacteria 3855
354 Ga0496125_0051427 3300048928 Bacteria 3398
355 Ga0496125_0079327 3300048928 Bacteria 2519
356 Ga0496125_0092521 3300048928 Bacteria 2260
357 Ga0496125_0193040 3300048928 Bacteria 1342
358 Ga0496126_0044582 3300048929 Bacteria 4083
359 Ga0496126_0079848 3300048929 Bacteria 2895
360 Ga0496126_0090833 3300048929 Bacteria 2686
361 Ga0496126_0255272 3300048929 Bacteria 1459
362 Ga0496126_0267542 3300048929 Bacteria 1419
363 Ga0496126_0428218 3300048929 Unclassified 1068
364 Ga0496126_0567715 3300048929 Bacteria 898
365 Ga0495678_019517 3300049459 Bacteria 3022
366 Ga0495678_021952 3300049459 Bacteria 2800
367 Ga0501034_0343767 3300049571 Bacteria 1421
368 Ga0501038_0951434 3300049574 Bacteria 632
369 Ga0501039_0307372 3300049575 Bacteria 1246
370 Ga0501043_0158265 3300049579 Bacteria 1771
371 Ga0501073_0066144 3300049589 Bacteria 2520
372 Ga0501079_0255049 3300049741 Unclassified 1371
373 Ga0501083_0065263 3300049744 Bacteria 2425
374 Ga0501083_0425341 3300049744 Bacteria 864
375 Ga0501035_0171023 3300049822 Bacteria 1877
376 Ga0501044_0218906 3300049823 Bacteria 1855
377 nmdc:mga03683_54446_c1 3300050489 Bacteria 1678
378 nmdc:mga03n38_140663_c1 3300050490 Bacteria 1205
379 nmdc:mga03n38_170027_c1 3300050490 Bacteria 1110
380 nmdc:mga00v17_47_c1 3300050491 Bacteria 77934
381 nmdc:mga0yw44_168421_c1 3300050492 Bacteria 1437
382 nmdc:mga0yw44_214052_c1 3300050492 Bacteria 1275
383 nmdc:mga0yw44_80885_c1 3300050492 Bacteria 2036
384 nmdc:mga0k408_11099_c1 3300050493 Bacteria 4896
385 nmdc:mga0k408_155580_c1 3300050493 Bacteria 1362
386 nmdc:mga06z11_11940_c1 3300050494 Bacteria 3763
387 nmdc:mga06z11_13084_c1 3300050494 Bacteria 3631
388 nmdc:mga06z11_24210_c1 3300050494 Bacteria 2861
389 nmdc:mga04h51_26709_c1 3300050495 Bacteria 1788
390 nmdc:mga04h51_51991_c1 3300050495 Bacteria 1378
391 nmdc:mga07m45_15662_c1 3300050496 Bacteria 4050
392 nmdc:mga07m45_7067_c1 3300050496 Bacteria 5713
393 nmdc:mga05p37_282_c1 3300050507 Bacteria 53179
394 nmdc:mga09592_35007_c1 3300050508 Bacteria 4200
395 nmdc:mga06r32_1411436_c1 3300050510 Unclassified 638
396 nmdc:mga08y16_53647_c1 3300050511 Bacteria 4214
397 nmdc:mga0n895_248408_c1 3300050512 Bacteria 1806
398 nmdc:mga0n895_33015_c1 3300050512 Bacteria 4972
399 nmdc:mga0n895_331959_c1 3300050512 Bacteria 1541
400 nmdc:mga0n895_517785_c1 3300050512 Bacteria 1201
401 nmdc:mga0rr50_5381_c1 3300050513 Bacteria 7631
402 nmdc:mga08x19_36957_c1 3300050514 Bacteria 3096
403 nmdc:mga0a205_140778_c1 3300050515 Bacteria 2313
404 nmdc:mga0a205_30829_c1 3300050515 Bacteria 5136
405 nmdc:mga0a205_31254_c1 3300050515 Bacteria 5101
406 nmdc:mga0a205_336125_c1 3300050515 Bacteria 1379
407 nmdc:mga0sz30_116093_c1 3300050516 Bacteria 1175
408 nmdc:mga0sz30_32376_c1 3300050516 Bacteria 2169
409 nmdc:mga0sz30_92055_c1 3300050516 Bacteria 1320
410 nmdc:mga0sz30_95333_c1 3300050516 Bacteria 785
411 Ga0500578_0205249 3300053086 Bacteria 1204
412 Ga0500556_0086244 3300053104 Bacteria 1194
413 Ga0500557_036964 3300053105 Bacteria 1512
414 Ga0500562_037363 3300053108 Bacteria 1289
415 Ga0500562_113288 3300053108 Bacteria 739
416 Ga0500572_013882 3300053111 Bacteria 2002
417 Ga0500594_0005164 3300053118 Bacteria 2890
418 Ga0500642_0067389 3300053130 Bacteria 1622
419 Ga0500561_0001080 3300053137 Bacteria 4387
420 Ga0500568_0002799 3300053139 Bacteria 10093
421 Ga0500577_0075290 3300053142 Bacteria 1334
422 Ga0500616_0002668 3300053153 Bacteria 14514
423 Ga0500622_0003111 3300053156 Bacteria 11419
424 Ga0500634_0004710 3300053161 Bacteria 6365
425 Ga0500636_0000036 3300053177 Bacteria 71714
426 Ga0500636_0094358 3300053177 Bacteria 1709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005615 Ga0070702_100128525 Ga0070702_1001285252 152
2 3300005719 Ga0068861_100434465 Ga0068861_1004344652 152
3 3300025923 Ga0207681_10392872 Ga0207681_103928722 152
4 3300025935 Ga0207709_10528132 Ga0207709_105281321 152
5 3300026118 Ga0207675_100221926 Ga0207675_1002219262 152
6 3300046539 Ga0495621_0015558 Ga0495621_0015558_1496_2041 156
7 3300026088 Ga0207641_11385903 Ga0207641_113859032 159
8 3300005439 Ga0070711_100163193 Ga0070711_1001631933 165
9 3300025916 Ga0207663_10060316 Ga0207663_100603164 165
10 iso_pu_bacteria 2758568016 2758642436 165
11 3300048924 Ga0496121_0251094 Ga0496121_0251094_458_976 166
12 iso_pu_bacteria 2718217997 2719667763 167
13 iso_pu_bacteria 2718218199 2720494183 167
14 iso_pu_bacteria 2718218232 2720615647 167
15 iso_pu_bacteria 2718218233 2720622430 167
16 iso_pu_bacteria 2718218235 2720633784 167
17 iso_pu_bacteria 2718218269 2720777484 167
18 iso_pu_bacteria 2721755556 2723029081 167
19 iso_pu_bacteria 2721755685 2723569391 167
20 iso_pu_bacteria 2721755819 2724092091 167
21 iso_pu_bacteria 2721755822 2724106656 167
22 iso_pu_bacteria 2721755823 2724112464 167
23 iso_pu_bacteria 2728369352 2730110017 167
24 iso_pu_bacteria 2838016132 2838020755 167
25 iso_pu_bacteria 2838048938 2838053258 167
26 iso_pu_bacteria 2838061910 2838064653 167
27 iso_pu_bacteria 2838068647 2838070571 167
28 iso_pu_bacteria 2842264693 2842268217 167
29 iso_pu_bacteria 2842311132 2842312272 167
30 iso_pu_bacteria 2842422224 2842424185 167
31 iso_pu_bacteria 2842428310 2842432189 167
32 iso_pu_bacteria 2842434925 2842438493 167
33 iso_pu_bacteria 2842441272 2842445123 167
34 iso_pu_bacteria 2842447887 2842451321 167
35 iso_pu_bacteria 2842462802 2842466476 167
36 iso_pu_bacteria 2842469257 2842473296 167
37 iso_pu_bacteria 2933599457 2933601375 167
38 iso_pu_bacteria 8005282627 8005285423 167
39 iso_pu_bacteria 8005430974 8005433340 167
40 iso_pu_bacteria 8005497431 8005498161 167
41 iso_pu_bacteria 8005619151 8005619369 167
42 iso_pu_bacteria 8005626139 8005627936 167
43 iso_pu_bacteria 8005668836 8005669570 167
44 3300005438 Ga0070701_10014015 Ga0070701_100140152 168
45 3300005440 Ga0070705_100233628 Ga0070705_1002336282 168
46 3300005440 Ga0070705_101113288 Ga0070705_1011132881 168
47 3300005444 Ga0070694_100428801 Ga0070694_1004288012 168
48 3300005468 Ga0070707_101345325 Ga0070707_1013453251 168
49 3300005471 Ga0070698_100010742 Ga0070698_10001074212 168
50 3300005518 Ga0070699_100006269 Ga0070699_10000626911 168
51 3300005518 Ga0070699_101713126 Ga0070699_1017131261 168
52 3300005536 Ga0070697_100059408 Ga0070697_1000594082 168
53 3300005536 Ga0070697_100329102 Ga0070697_1003291022 168
54 3300005546 Ga0070696_100004082 Ga0070696_10000408212 168
55 3300005546 Ga0070696_100033773 Ga0070696_1000337733 168
56 3300005564 Ga0070664_100132215 Ga0070664_1001322152 168
57 3300006844 Ga0075428_100000601 Ga0075428_10000060114 168
58 3300006847 Ga0075431_100292640 Ga0075431_1002926404 168
59 3300006852 Ga0075433_10072977 Ga0075433_100729774 168
60 3300006852 Ga0075433_10126162 Ga0075433_101261622 168
61 3300006852 Ga0075433_10163629 Ga0075433_101636292 168
62 3300006871 Ga0075434_100012223 Ga0075434_1000122232 168
63 3300006871 Ga0075434_100012374 Ga0075434_1000123744 168
64 3300006871 Ga0075434_100545453 Ga0075434_1005454532 168
65 3300006880 Ga0075429_100037275 Ga0075429_1000372756 168
66 3300006914 Ga0075436_100021863 Ga0075436_1000218634 168
67 3300007076 Ga0075435_100015084 Ga0075435_1000150844 168
68 3300007076 Ga0075435_100149377 Ga0075435_1001493772 168
69 3300009147 Ga0114129_10002054 Ga0114129_100020549 168
70 3300009147 Ga0114129_10006329 Ga0114129_1000632912 168
71 3300009147 Ga0114129_10163947 Ga0114129_101639472 168
72 3300009148 Ga0105243_10458479 Ga0105243_104584792 168
73 3300045051 Ga0451576_0360539 Ga0451576_0360539_93_599 168
74 3300046664 Ga0495659_0031027 Ga0495659_0031027_1142_1648 168
75 3300046664 Ga0495659_0064830 Ga0495659_0064830_701_1207 168
76 3300050507 nmdc:mga05p37_282_c1 nmdc:mga05p37_282_c1_18802_19308 168
77 3300050508 nmdc:mga09592_35007_c1 nmdc:mga09592_35007_c1_459_965 168
78 3300050510 nmdc:mga06r32_1411436_c1 nmdc:mga06r32_1411436_c1_78_617 168
79 3300050511 nmdc:mga08y16_53647_c1 nmdc:mga08y16_53647_c1_280_786 168
80 3300050512 nmdc:mga0n895_248408_c1 nmdc:mga0n895_248408_c1_137_649 168
81 3300050512 nmdc:mga0n895_33015_c1 nmdc:mga0n895_33015_c1_2132_2647 168
82 3300050512 nmdc:mga0n895_331959_c1 nmdc:mga0n895_331959_c1_993_1499 168
83 3300050512 nmdc:mga0n895_517785_c1 nmdc:mga0n895_517785_c1_217_723 168
84 3300050513 nmdc:mga0rr50_5381_c1 nmdc:mga0rr50_5381_c1_6318_6824 168
85 3300050514 nmdc:mga08x19_36957_c1 nmdc:mga08x19_36957_c1_1446_1952 168
86 3300050515 nmdc:mga0a205_140778_c1 nmdc:mga0a205_140778_c1_1491_2003 168
87 3300050515 nmdc:mga0a205_30829_c1 nmdc:mga0a205_30829_c1_3366_3872 168
88 3300050515 nmdc:mga0a205_31254_c1 nmdc:mga0a205_31254_c1_1056_1571 168
89 3300050515 nmdc:mga0a205_336125_c1 nmdc:mga0a205_336125_c1_93_599 168
90 iso_pu_bacteria 2509276021 2509388943 168
91 iso_pu_bacteria 2510461076 2510897200 168
92 iso_pu_bacteria 2515154116 2515659255 168
93 iso_pu_bacteria 2537561587 2537877382 168
94 iso_pu_bacteria 2554235003 2554246278 168
95 iso_pu_bacteria 2558860242 2559293500 168
96 iso_pu_bacteria 2582581298 2585223316 168
97 iso_pu_bacteria 2582581299 2585232315 168
98 iso_pu_bacteria 2585427528 2585543323 168
99 iso_pu_bacteria 2585427529 2585546088 168
100 iso_pu_bacteria 2585427593 2585840741 168
101 iso_pu_bacteria 2599185210 2599604382 168
102 iso_pu_bacteria 2600255279 2601609481 168
103 iso_pu_bacteria 2600255308 2601746256 168
104 iso_pu_bacteria 2643221582 2643920659 168
105 iso_pu_bacteria 2643221634 2644195671 168
106 iso_pu_bacteria 2643221693 2644519533 168
107 iso_pu_bacteria 2718217882 2719183395 168
108 iso_pu_bacteria 2718217927 2719388140 168
109 iso_pu_bacteria 2718218009 2719734112 168
110 iso_pu_bacteria 2718218363 2721149507 168
111 iso_pu_bacteria 2718218365 2721160910 168
112 iso_pu_bacteria 2718218366 2721166344 168
113 iso_pu_bacteria 2718218423 2721401773 168
114 iso_pu_bacteria 2721755514 2722842514 168
115 iso_pu_bacteria 2721755809 2724040587 168
116 iso_pu_bacteria 2721755810 2724046868 168
117 iso_pu_bacteria 2728369365 2730166630 168
118 iso_pu_bacteria 2728369397 2730300542 168
119 iso_pu_bacteria 2738541293 2738805889 168
120 iso_pu_bacteria 2738541333 2739038160 168
121 iso_pu_bacteria 2791355256 2793299788 168
122 iso_pu_bacteria 2791355260 2793322443 168
123 iso_pu_bacteria 2791355262 2793337932 168
124 iso_pu_bacteria 2791355264 2793349618 168
125 iso_pu_bacteria 2791355265 2793352534 168
126 iso_pu_bacteria 2791355267 2793365385 168
127 iso_pu_bacteria 2802429606 2805936635 168
128 iso_pu_bacteria 2802429633 2806046526 168
129 iso_pu_bacteria 2802429634 2806051276 168
130 iso_pu_bacteria 2802429635 2806059265 168
131 iso_pu_bacteria 2802429636 2806066830 168
132 iso_pu_bacteria 2802429637 2806073819 168
133 iso_pu_bacteria 2808606387 2808986729 168
134 iso_pu_bacteria 2818991439 2819556803 168
135 iso_pu_bacteria 2838042994 2838044805 168
136 iso_pu_bacteria 2838668709 2838674111 168
137 iso_pu_bacteria 2838675328 2838677538 168
138 iso_pu_bacteria 2838701080 2838706449 168
139 iso_pu_bacteria 2838714209 2838716427 168
140 iso_pu_bacteria 2838719591 2838719773 168
141 iso_pu_bacteria 2838724970 2838727178 168
142 iso_pu_bacteria 2841846520 2841846704 168
143 iso_pu_bacteria 2841859092 2841860767 168
144 iso_pu_bacteria 2841864319 2841869060 168
145 iso_pu_bacteria 2842124991 2842127267 168
146 iso_pu_bacteria 2842130223 2842132431 168
147 iso_pu_bacteria 2842146304 2842151107 168
148 iso_pu_bacteria 2842152218 2842152400 168
149 iso_pu_bacteria 2842170452 2842172672 168
150 iso_pu_bacteria 2842175837 2842176019 168
151 iso_pu_bacteria 2842187318 2842189534 168
152 iso_pu_bacteria 2842192696 2842196316 168
153 iso_pu_bacteria 2842205361 2842208972 168
154 iso_pu_bacteria 2842211629 2842213848 168
155 iso_pu_bacteria 2842224351 2842224534 168
156 iso_pu_bacteria 2842250916 2842256163 168
157 iso_pu_bacteria 2842278818 2842282338 168
158 iso_pu_bacteria 2842317721 2842321868 168
159 iso_pu_bacteria 2842341865 2842344589 168
160 iso_pu_bacteria 2842363717 2842367833 168
161 iso_pu_bacteria 2842489311 2842494156 168
162 iso_pu_bacteria 2842495871 2842499767 168
163 iso_pu_bacteria 2842515876 2842517552 168
164 iso_pu_bacteria 2891048133 2891050689 168
165 iso_pu_bacteria 2899792073 2899794406 168
166 iso_pu_bacteria 2899845264 2899845789 168
167 iso_pu_bacteria 2919100787 2919101803 168
168 iso_pu_bacteria 2919114240 2919116644 168
169 iso_pu_bacteria 2926754445 2926754653 168
170 iso_pu_bacteria 2926760298 2926761821 168
171 iso_pu_bacteria 2929138655 2929142120 168
172 iso_pu_bacteria 2933006813 2933007047 168
173 iso_pu_bacteria 2933011516 2933015363 168
174 iso_pu_bacteria 2933594066 2933594249 168
175 iso_pu_bacteria 2979089926 2979092913 168
176 iso_pu_bacteria 2979095461 2979099698 168
177 iso_pu_bacteria 2979100975 2979104882 168
178 iso_pu_bacteria 2984509177 2984513317 168
179 iso_pu_bacteria 2984518228 2984520314 168
180 iso_pu_bacteria 2984537506 2984539612 168
181 iso_pu_bacteria 2984601300 2984601838 168
182 iso_pu_bacteria 650716007 650738737 168
183 iso_pu_bacteria 8003570095 8003572284 168
184 iso_pu_bacteria 8005275841 8005278342 168
185 iso_pu_bacteria 8005289223 8005291586 168
186 iso_pu_bacteria 8005563573 8005564470 168
187 iso_pu_bacteria 8005570704 8005574022 168
188 iso_pu_bacteria 8018163183 8018167538 168
189 iso_pu_bacteria 8018176218 8018182018 168
190 iso_pu_bacteria 8024501048 8024506385 168
191 iso_pu_bacteria 8056375014 8056381122 168
192 iso_pu_bacteria 8056382006 8056382630 168
193 3300048924 Ga0496121_0118970 Ga0496121_0118970_422_931 169
194 3300048926 Ga0496123_0089649 Ga0496123_0089649_772_1281 169
195 3300048928 Ga0496125_0193040 Ga0496125_0193040_338_847 169
196 3300048929 Ga0496126_0567715 Ga0496126_0567715_101_610 169
197 iso_pu_bacteria 2510917022 2511133297 169
198 iso_pu_bacteria 2524023209 2524457953 169
199 iso_pu_bacteria 2582581307 2585273524 169
200 iso_pu_bacteria 2585427531 2585559697 169
201 iso_pu_bacteria 2585427609 2585906124 169
202 iso_pu_bacteria 2585428125 2587978761 169
203 iso_pu_bacteria 2615840698 2616556143 169
204 iso_pu_bacteria 2617270742 2617380655 169
205 iso_pu_bacteria 2667528174 2671114063 169
206 iso_pu_bacteria 2775507266 2778173770 169
207 iso_pu_bacteria 2818991448 2819608812 169
208 iso_pu_bacteria 2838029111 2838029696 169
209 iso_pu_bacteria 2842298080 2842299865 169
210 iso_pu_bacteria 2842357229 2842359613 169
211 iso_pu_bacteria 2842475841 2842475874 169
212 iso_pu_bacteria 2842482326 2842488692 169
213 iso_pu_bacteria 2842502639 2842503224 169
214 iso_pu_bacteria 2842509118 2842513104 169
215 iso_pu_bacteria 2919408235 2919408394 169
216 iso_pu_bacteria 2995392953 2995394797 169
217 iso_pu_bacteria 3003930520 3003931480 169
218 iso_pu_bacteria 3005416602 3005423230 169
219 iso_pu_bacteria 8005314921 8005315557 169
220 iso_pu_bacteria 8005484373 8005484536 169
221 iso_pu_bacteria 8005645114 8005649231 169
222 iso_pu_bacteria 8005682033 8005685534 169
223 iso_pu_bacteria 8054558443 8054561090 169
224 3300005345 Ga0070692_10289200 Ga0070692_102892002 170
225 3300005440 Ga0070705_100000075 Ga0070705_10000007540 170
226 3300005444 Ga0070694_100000624 Ga0070694_10000062415 170
227 3300005518 Ga0070699_100880935 Ga0070699_1008809351 170
228 3300005545 Ga0070695_100000372 Ga0070695_10000037218 170
229 3300005546 Ga0070696_100001322 Ga0070696_10000132212 170
230 3300005549 Ga0070704_100077962 Ga0070704_1000779624 170
231 3300005615 Ga0070702_100014011 Ga0070702_1000140114 170
232 3300009148 Ga0105243_10044822 Ga0105243_100448222 170
233 3300025885 Ga0207653_10047979 Ga0207653_100479792 170
234 3300035410 Ga0373924_0291006 Ga0373924_0291006_183_707 170
235 3300047447 Ga0495685_016907 Ga0495685_016907_76_645 170
236 3300002774 JGI25150J39212_1000203 JGI25150J39212_100020319 172
237 3300003187 JGI25151J46595_10000278 JGI25151J46595_1000027810 172
238 3300003187 JGI25151J46595_10000439 JGI25151J46595_1000043917 172
239 3300003187 JGI25151J46595_10025464 JGI25151J46595_100254642 172
240 3300003215 JGI25153J46596_10009890 JGI25153J46596_100098904 172
241 3300003374 JGI25161J50226_1005391 JGI25161J50226_10053913 172
242 3300003771 Ga0055526_1003108 Ga0055526_100310811 172
243 3300003771 Ga0055526_1008483 Ga0055526_10084835 172
244 3300003771 Ga0055526_1009488 Ga0055526_10094884 172
245 3300003775 Ga0055524_1002915 Ga0055524_10029153 172
246 3300003790 Ga0055528_1002379 Ga0055528_100237910 172
247 3300003790 Ga0055528_1002548 Ga0055528_10025484 172
248 3300003790 Ga0055528_1022196 Ga0055528_10221962 172
249 3300003790 Ga0055528_1023949 Ga0055528_10239493 172
250 3300003792 Ga0055540_1002511 Ga0055540_100251110 172
251 3300003856 Ga0058692_1000689 Ga0058692_10006898 172
252 3300003856 Ga0058692_1005646 Ga0058692_10056463 172
253 3300004625 Ga0055543_1000963 Ga0055543_10009632 172
254 3300005262 Ga0065165_1003744 Ga0065165_10037444 172
255 3300005347 Ga0070668_100051170 Ga0070668_1000511704 172
256 3300005347 Ga0070668_100123966 Ga0070668_1001239662 172
257 3300005353 Ga0070669_100180936 Ga0070669_1001809363 172
258 3300005355 Ga0070671_100008057 Ga0070671_1000080579 172
259 3300005367 Ga0070667_100476304 Ga0070667_1004763042 172
260 3300005436 Ga0070713_100433435 Ga0070713_1004334352 172
261 3300005455 Ga0070663_100202778 Ga0070663_1002027782 172
262 3300005548 Ga0070665_100003012 Ga0070665_10000301213 172
263 3300005548 Ga0070665_100787846 Ga0070665_1007878462 172
264 3300005564 Ga0070664_100425773 Ga0070664_1004257732 172
265 3300006038 Ga0075365_10001132 Ga0075365_1000113214 172
266 3300006038 Ga0075365_10279871 Ga0075365_102798712 172
267 3300006042 Ga0075368_10000391 Ga0075368_100003916 172
268 3300006042 Ga0075368_10058098 Ga0075368_100580982 172
269 3300006042 Ga0075368_10074020 Ga0075368_100740202 172
270 3300006051 Ga0075364_10091333 Ga0075364_100913333 172
271 3300006175 Ga0070712_100005457 Ga0070712_1000054578 172
272 3300006177 Ga0075362_10162655 Ga0075362_101626552 172
273 3300006178 Ga0075367_10002704 Ga0075367_100027048 172
274 3300006178 Ga0075367_10026689 Ga0075367_100266892 172
275 3300006178 Ga0075367_10071640 Ga0075367_100716403 172
276 3300006178 Ga0075367_10075331 Ga0075367_100753312 172
277 3300006186 Ga0075369_10106870 Ga0075369_101068702 172
278 3300006186 Ga0075369_10349512 Ga0075369_103495121 172
279 3300006195 Ga0075366_10004917 Ga0075366_100049172 172
280 3300006195 Ga0075366_10136653 Ga0075366_101366532 172
281 3300006353 Ga0075370_10019344 Ga0075370_100193443 172
282 3300006948 Ga0099826_10001162 Ga0099826_100011629 172
283 3300009092 Ga0105250_10015632 Ga0105250_100156322 172
284 3300009092 Ga0105250_10233830 Ga0105250_102338301 172
285 3300009101 Ga0105247_10133399 Ga0105247_101333992 172
286 3300009148 Ga0105243_10087173 Ga0105243_100871733 172
287 3300009177 Ga0105248_10006268 Ga0105248_100062683 172
288 3300009553 Ga0105249_10026805 Ga0105249_100268053 172
289 3300011119 Ga0105246_10027302 Ga0105246_100273025 172
290 3300011119 Ga0105246_10216373 Ga0105246_102163732 172
291 3300013100 Ga0157373_10009759 Ga0157373_100097592 172
292 3300013102 Ga0157371_10000004 Ga0157371_10000004180 172
293 3300013104 Ga0157370_10002827 Ga0157370_1000282727 172
294 3300025245 Ga0207425_1000052 Ga0207425_100005220 172
295 3300025245 Ga0207425_1006026 Ga0207425_10060262 172
296 3300025258 Ga0209129_1000446 Ga0209129_100044617 172
297 3300025258 Ga0209129_1000511 Ga0209129_100051128 172
298 3300025258 Ga0209129_1002569 Ga0209129_10025699 172
299 3300025258 Ga0209129_1002598 Ga0209129_10025984 172
300 3300025273 Ga0209673_1000135 Ga0209673_100013533 172
301 3300025273 Ga0209673_1000378 Ga0209673_100037873 172
302 3300025273 Ga0209673_1012682 Ga0209673_10126824 172
303 3300025273 Ga0209673_1019956 Ga0209673_10199562 172
304 3300025273 Ga0209673_1056152 Ga0209673_10561522 172
305 3300025284 Ga0209130_1038379 Ga0209130_10383792 172
306 3300025291 Ga0209675_1029429 Ga0209675_10294292 172
307 3300025291 Ga0209675_1084714 Ga0209675_10847141 172
308 3300025294 Ga0209025_1000060 Ga0209025_100006067 172
309 3300025294 Ga0209025_1000144 Ga0209025_1000144176 172
310 3300025294 Ga0209025_1000921 Ga0209025_100092135 172
311 3300025294 Ga0209025_1033493 Ga0209025_10334933 172
312 3300025294 Ga0209025_1055066 Ga0209025_10550661 172
313 3300025295 Ga0209564_1000138 Ga0209564_100013815 172
314 3300025295 Ga0209564_1000917 Ga0209564_10009176 172
315 3300025295 Ga0209564_1042467 Ga0209564_10424671 172
316 3300025297 Ga0209758_1000519 Ga0209758_100051918 172
317 3300025297 Ga0209758_1003402 Ga0209758_100340212 172
318 3300025297 Ga0209758_1003665 Ga0209758_10036657 172
319 3300025297 Ga0209758_1004523 Ga0209758_10045239 172
320 3300025299 Ga0209256_1001375 Ga0209256_100137523 172
321 3300025299 Ga0209256_1003005 Ga0209256_100300512 172
322 3300025299 Ga0209256_1011535 Ga0209256_10115354 172
323 3300025302 Ga0207426_1000142 Ga0207426_100014258 172
324 3300025302 Ga0207426_1000608 Ga0207426_100060826 172
325 3300025303 Ga0209051_1001981 Ga0209051_100198112 172
326 3300025303 Ga0209051_1003694 Ga0209051_10036949 172
327 3300025304 Ga0209257_1004390 Ga0209257_10043904 172
328 3300025711 Ga0207696_1086664 Ga0207696_10866642 172
329 3300025906 Ga0207699_10109083 Ga0207699_101090832 172
330 3300025915 Ga0207693_10000079 Ga0207693_1000007965 172
331 3300025923 Ga0207681_10253886 Ga0207681_102538862 172
332 3300025928 Ga0207700_10307973 Ga0207700_103079732 172
333 3300025928 Ga0207700_10407157 Ga0207700_104071572 172
334 3300025935 Ga0207709_11183710 Ga0207709_111837101 172
335 3300025941 Ga0207711_11136361 Ga0207711_111363612 172
336 3300025972 Ga0207668_10182818 Ga0207668_101828182 172
337 3300025972 Ga0207668_10736785 Ga0207668_107367852 172
338 3300025986 Ga0207658_10387149 Ga0207658_103871492 172
339 3300026067 Ga0207678_10070371 Ga0207678_100703712 172
340 3300027312 Ga0209371_1000009 Ga0209371_1000009818 172
341 3300027312 Ga0209371_1000732 Ga0209371_100073210 172
342 3300027312 Ga0209371_1002043 Ga0209371_10020436 172
343 3300027666 Ga0209282_1000179 Ga0209282_100017919 172
344 3300027866 Ga0209813_10020985 Ga0209813_100209852 172
345 3300027866 Ga0209813_10059388 Ga0209813_100593882 172
346 3300028379 Ga0268266_10005424 Ga0268266_100054247 172
347 3300028380 Ga0268265_10921516 Ga0268265_109215162 172
348 3300030500 Ga0268256_1000010 Ga0268256_1000010817 172
349 3300030500 Ga0268256_1007368 Ga0268256_10073683 172
350 3300030744 Ga0316181_1290736 Ga0316181_12907362 172
351 3300030745 Ga0316182_1001511 Ga0316182_10015112 172
352 3300031731 Ga0307405_10000276 Ga0307405_1000027610 172
353 3300031901 Ga0307406_10029557 Ga0307406_100295572 172
354 3300031911 Ga0307412_10003582 Ga0307412_100035826 172
355 3300037853 Ga0436364_0566421 Ga0436364_0566421_194_712 172
356 3300041405 Ga0439438_064358 Ga0439438_064358_207_725 172
357 3300041413 Ga0439465_0015434 Ga0439465_0015434_66_584 172
358 3300042004 Ga0439445_0066731 Ga0439445_0066731_416_934 172
359 3300042007 Ga0439449_0095057 Ga0439449_0095057_101_619 172
360 3300042014 Ga0439457_065527 Ga0439457_065527_158_676 172
361 3300046452 Ga0495617_054403 Ga0495617_054403_664_1182 172
362 3300046457 Ga0495590_0037000 Ga0495590_0037000_312_830 172
363 3300046457 Ga0495590_0049337 Ga0495590_0049337_249_767 172
364 3300046460 Ga0495638_0000546 Ga0495638_0000546_19321_19839 172
365 3300046471 Ga0495650_0031141 Ga0495650_0031141_858_1376 172
366 3300046471 Ga0495650_0132834 Ga0495650_0132834_128_646 172
367 3300046474 Ga0495605_0004579 Ga0495605_0004579_330_848 172
368 3300046474 Ga0495605_0159098 Ga0495605_0159098_214_732 172
369 3300046474 Ga0495605_0288348 Ga0495605_0288348_134_652 172
370 3300046491 Ga0495584_0100628 Ga0495584_0100628_193_711 172
371 3300046492 Ga0495585_0045991 Ga0495585_0045991_54_572 172
372 3300046501 Ga0495607_0141343 Ga0495607_0141343_468_986 172
373 3300046506 Ga0495583_0010327 Ga0495583_0010327_1015_1533 172
374 3300046506 Ga0495583_0048254 Ga0495583_0048254_352_870 172
375 3300046507 Ga0495606_0004551 Ga0495606_0004551_1948_2466 172
376 3300046507 Ga0495606_0079582 Ga0495606_0079582_154_672 172
377 3300046512 Ga0495610_0001900 Ga0495610_0001900_11574_12092 172
378 3300046512 Ga0495610_0010290 Ga0495610_0010290_801_1319 172
379 3300046513 Ga0495616_0043842 Ga0495616_0043842_725_1243 172
380 3300046515 Ga0495620_0018667 Ga0495620_0018667_1404_1922 172
381 3300046518 Ga0495631_0004372 Ga0495631_0004372_1131_1649 172
382 3300046519 Ga0495632_0041896 Ga0495632_0041896_945_1463 172
383 3300046522 Ga0495643_0035823 Ga0495643_0035823_836_1354 172
384 3300046522 Ga0495643_0036501 Ga0495643_0036501_808_1326 172
385 3300046530 Ga0495654_0028560 Ga0495654_0028560_1645_2163 172
386 3300046558 Ga0495633_0105083 Ga0495633_0105083_315_833 172
387 3300046616 Ga0495668_0005766 Ga0495668_0005766_1838_2356 172
388 3300046648 Ga0495611_0011389 Ga0495611_0011389_1911_2429 172
389 3300046660 Ga0495625_0004012 Ga0495625_0004012_816_1334 172
390 3300046664 Ga0495659_0014231 Ga0495659_0014231_1902_2447 172
391 3300046691 Ga0495670_0062245 Ga0495670_0062245_1035_1553 172
392 3300046692 Ga0495671_0151962 Ga0495671_0151962_367_885 172
393 3300046692 Ga0495671_0180186 Ga0495671_0180186_430_948 172
394 3300046694 Ga0495649_0054471 Ga0495649_0054471_247_765 172
395 3300047318 Ga0495636_0034253 Ga0495636_0034253_763_1281 172
396 3300047318 Ga0495636_0176210 Ga0495636_0176210_336_881 172
397 3300047469 Ga0495673_0029044 Ga0495673_0029044_1028_1546 172
398 3300047469 Ga0495673_0118577 Ga0495673_0118577_154_672 172
399 3300047470 Ga0495681_0004119 Ga0495681_0004119_1401_1919 172
400 3300047472 Ga0495686_0040582 Ga0495686_0040582_1370_1888 172
401 3300047472 Ga0495686_0563532 Ga0495686_0563532_40_558 172
402 3300048090 Ga0495615_0005775 Ga0495615_0005775_248_766 172
403 3300048091 Ga0495626_0291108 Ga0495626_0291108_54_572 172
404 3300048903 Ga0496100_0245329 Ga0496100_0245329_368_889 172
405 3300048904 Ga0496101_0138243 Ga0496101_0138243_266_784 172
406 3300048904 Ga0496101_0345714 Ga0496101_0345714_418_939 172
407 3300048905 Ga0496102_0390245 Ga0496102_0390245_614_1135 172
408 3300048906 Ga0496103_0152335 Ga0496103_0152335_260_781 172
409 3300048907 Ga0496104_0065694 Ga0496104_0065694_2122_2643 172
410 3300048908 Ga0496105_0182798 Ga0496105_0182798_731_1252 172
411 3300048909 Ga0496106_0504680 Ga0496106_0504680_163_684 172
412 3300048910 Ga0496107_0160549 Ga0496107_0160549_412_933 172
413 3300048911 Ga0496108_0265486 Ga0496108_0265486_550_1071 172
414 3300048913 Ga0496110_0179467 Ga0496110_0179467_684_1205 172
415 3300048913 Ga0496110_0194099 Ga0496110_0194099_150_668 172
416 3300048914 Ga0496111_0261002 Ga0496111_0261002_720_1241 172
417 3300048915 Ga0496112_0490287 Ga0496112_0490287_164_685 172
418 3300048916 Ga0496113_0120064 Ga0496113_0120064_730_1251 172
419 3300048916 Ga0496113_0209237 Ga0496113_0209237_347_919 172
420 3300048917 Ga0496114_0282557 Ga0496114_0282557_303_824 172
421 3300048919 Ga0496116_0008582 Ga0496116_0008582_996_1514 172
422 3300048919 Ga0496116_0019332 Ga0496116_0019332_3769_4287 172
423 3300048919 Ga0496116_0038069 Ga0496116_0038069_1177_1695 172
424 3300048919 Ga0496116_0041834 Ga0496116_0041834_1096_1614 172
425 3300048919 Ga0496116_0068596 Ga0496116_0068596_960_1478 172
426 3300048919 Ga0496116_0083811 Ga0496116_0083811_17_547 172
427 3300048919 Ga0496116_0154552 Ga0496116_0154552_607_1128 172
428 3300048919 Ga0496116_0270563 Ga0496116_0270563_50_568 172
429 3300048920 Ga0496117_0000002 Ga0496117_0000002_2304597_2305169 172
430 3300048920 Ga0496117_0016354 Ga0496117_0016354_4836_5354 172
431 3300048920 Ga0496117_0026399 Ga0496117_0026399_2571_3089 172
432 3300048920 Ga0496117_0101874 Ga0496117_0101874_125_643 172
433 3300048920 Ga0496117_0136402 Ga0496117_0136402_61_579 172
434 3300048920 Ga0496117_0190820 Ga0496117_0190820_528_1046 172
435 3300048920 Ga0496117_0260028 Ga0496117_0260028_321_842 172
436 3300048921 Ga0496118_0002844 Ga0496118_0002844_3477_4085 172
437 3300048921 Ga0496118_0014526 Ga0496118_0014526_3011_3529 172
438 3300048921 Ga0496118_0015718 Ga0496118_0015718_1625_2143 172
439 3300048921 Ga0496118_0041063 Ga0496118_0041063_1191_1709 172
440 3300048921 Ga0496118_0067102 Ga0496118_0067102_671_1189 172
441 3300048921 Ga0496118_0074170 Ga0496118_0074170_847_1365 172
442 3300048921 Ga0496118_0146216 Ga0496118_0146216_301_822 172
443 3300048922 Ga0496119_0010067 Ga0496119_0010067_6270_6788 172
444 3300048922 Ga0496119_0038516 Ga0496119_0038516_1225_1833 172
445 3300048922 Ga0496119_0093038 Ga0496119_0093038_208_726 172
446 3300048922 Ga0496119_0117466 Ga0496119_0117466_300_821 172
447 3300048923 Ga0496120_0000034 Ga0496120_0000034_211115_211687 172
448 3300048923 Ga0496120_0006317 Ga0496120_0006317_6975_7493 172
449 3300048923 Ga0496120_0123794 Ga0496120_0123794_593_1114 172
450 3300048924 Ga0496121_0000220 Ga0496121_0000220_41299_41817 172
451 3300048924 Ga0496121_0053756 Ga0496121_0053756_1057_1575 172
452 3300048924 Ga0496121_0071978 Ga0496121_0071978_488_1006 172
453 3300048924 Ga0496121_0072486 Ga0496121_0072486_1178_1696 172
454 3300048924 Ga0496121_0120693 Ga0496121_0120693_487_1005 172
455 3300048924 Ga0496121_0182974 Ga0496121_0182974_39_557 172
456 3300048924 Ga0496121_0351009 Ga0496121_0351009_144_662 172
457 3300048924 Ga0496121_0364907 Ga0496121_0364907_282_803 172
458 3300048924 Ga0496121_0370855 Ga0496121_0370855_313_831 172
459 3300048924 Ga0496121_0430098 Ga0496121_0430098_283_801 172
460 3300048925 Ga0496122_0000001 Ga0496122_0000001_1648604_1649176 172
461 3300048925 Ga0496122_0024928 Ga0496122_0024928_93_611 172
462 3300048925 Ga0496122_0054274 Ga0496122_0054274_968_1486 172
463 3300048925 Ga0496122_0070088 Ga0496122_0070088_1021_1539 172
464 3300048925 Ga0496122_0073377 Ga0496122_0073377_1008_1526 172
465 3300048925 Ga0496122_0089080 Ga0496122_0089080_422_940 172
466 3300048925 Ga0496122_0174181 Ga0496122_0174181_472_993 172
467 3300048926 Ga0496123_0000001 Ga0496123_0000001_1652335_1652907 172
468 3300048926 Ga0496123_0014463 Ga0496123_0014463_416_934 172
469 3300048926 Ga0496123_0028781 Ga0496123_0028781_2696_3214 172
470 3300048926 Ga0496123_0042719 Ga0496123_0042719_298_819 172
471 3300048926 Ga0496123_0055753 Ga0496123_0055753_916_1434 172
472 3300048926 Ga0496123_0119384 Ga0496123_0119384_348_866 172
473 3300048926 Ga0496123_0299844 Ga0496123_0299844_72_590 172
474 3300048927 Ga0496124_0009881 Ga0496124_0009881_8348_8866 172
475 3300048927 Ga0496124_0013228 Ga0496124_0013228_3727_4299 172
476 3300048927 Ga0496124_0024872 Ga0496124_0024872_966_1484 172
477 3300048927 Ga0496124_0040728 Ga0496124_0040728_205_723 172
478 3300048927 Ga0496124_0201421 Ga0496124_0201421_100_618 172
479 3300048927 Ga0496124_0241316 Ga0496124_0241316_607_1128 172
480 3300048927 Ga0496124_0270861 Ga0496124_0270861_521_1039 172
481 3300048927 Ga0496124_0435239 Ga0496124_0435239_21_539 172
482 3300048928 Ga0496125_0000001 Ga0496125_0000001_41451_41969 172
483 3300048928 Ga0496125_0009589 Ga0496125_0009589_2536_3054 172
484 3300048928 Ga0496125_0042743 Ga0496125_0042743_1186_1704 172
485 3300048928 Ga0496125_0051427 Ga0496125_0051427_2048_2566 172
486 3300048928 Ga0496125_0079327 Ga0496125_0079327_1737_2255 172
487 3300048928 Ga0496125_0092521 Ga0496125_0092521_1123_1731 172
488 3300048929 Ga0496126_0044582 Ga0496126_0044582_3321_3842 172
489 3300048929 Ga0496126_0079848 Ga0496126_0079848_267_785 172
490 3300048929 Ga0496126_0090833 Ga0496126_0090833_1183_1701 172
491 3300048929 Ga0496126_0255272 Ga0496126_0255272_23_631 172
492 3300048929 Ga0496126_0267542 Ga0496126_0267542_423_941 172
493 3300048929 Ga0496126_0428218 Ga0496126_0428218_422_940 172
494 3300049459 Ga0495678_019517 Ga0495678_019517_105_623 172
495 3300049459 Ga0495678_021952 Ga0495678_021952_1053_1571 172
496 3300049571 Ga0501034_0343767 Ga0501034_0343767_404_922 172
497 3300049574 Ga0501038_0951434 Ga0501038_0951434_38_556 172
498 3300049575 Ga0501039_0307372 Ga0501039_0307372_693_1211 172
499 3300049579 Ga0501043_0158265 Ga0501043_0158265_148_666 172
500 3300049589 Ga0501073_0066144 Ga0501073_0066144_1124_1642 172
501 3300049744 Ga0501083_0065263 Ga0501083_0065263_1566_2084 172
502 3300049744 Ga0501083_0425341 Ga0501083_0425341_176_697 172
503 3300049822 Ga0501035_0171023 Ga0501035_0171023_235_753 172
504 3300049823 Ga0501044_0218906 Ga0501044_0218906_424_942 172
505 3300050489 nmdc:mga03683_54446_c1 nmdc:mga03683_54446_c1_909_1427 172
506 3300050490 nmdc:mga03n38_140663_c1 nmdc:mga03n38_140663_c1_672_1190 172
507 3300050490 nmdc:mga03n38_170027_c1 nmdc:mga03n38_170027_c1_545_1063 172
508 3300050491 nmdc:mga00v17_47_c1 nmdc:mga00v17_47_c1_24684_25256 172
509 3300050492 nmdc:mga0yw44_168421_c1 nmdc:mga0yw44_168421_c1_444_965 172
510 3300050492 nmdc:mga0yw44_214052_c1 nmdc:mga0yw44_214052_c1_381_899 172
511 3300050492 nmdc:mga0yw44_80885_c1 nmdc:mga0yw44_80885_c1_847_1365 172
512 3300050493 nmdc:mga0k408_11099_c1 nmdc:mga0k408_11099_c1_1022_1540 172
513 3300050493 nmdc:mga0k408_155580_c1 nmdc:mga0k408_155580_c1_307_879 172
514 3300050494 nmdc:mga06z11_11940_c1 nmdc:mga06z11_11940_c1_2776_3348 172
515 3300050494 nmdc:mga06z11_13084_c1 nmdc:mga06z11_13084_c1_2379_2903 172
516 3300050494 nmdc:mga06z11_24210_c1 nmdc:mga06z11_24210_c1_1424_1942 172
517 3300050495 nmdc:mga04h51_26709_c1 nmdc:mga04h51_26709_c1_753_1325 172
518 3300050495 nmdc:mga04h51_51991_c1 nmdc:mga04h51_51991_c1_583_1101 172
519 3300050496 nmdc:mga07m45_15662_c1 nmdc:mga07m45_15662_c1_1790_2308 172
520 3300050496 nmdc:mga07m45_7067_c1 nmdc:mga07m45_7067_c1_960_1478 172
521 3300050516 nmdc:mga0sz30_116093_c1 nmdc:mga0sz30_116093_c1_336_854 172
522 3300050516 nmdc:mga0sz30_32376_c1 nmdc:mga0sz30_32376_c1_62_670 172
523 3300050516 nmdc:mga0sz30_92055_c1 nmdc:mga0sz30_92055_c1_717_1235 172
524 3300050516 nmdc:mga0sz30_95333_c1 nmdc:mga0sz30_95333_c1_40_558 172
525 3300053086 Ga0500578_0205249 Ga0500578_0205249_138_656 172
526 3300053104 Ga0500556_0086244 Ga0500556_0086244_433_951 172
527 3300053105 Ga0500557_036964 Ga0500557_036964_936_1454 172
528 3300053108 Ga0500562_037363 Ga0500562_037363_123_641 172
529 3300053108 Ga0500562_113288 Ga0500562_113288_167_685 172
530 3300053111 Ga0500572_013882 Ga0500572_013882_701_1219 172
531 3300053118 Ga0500594_0005164 Ga0500594_0005164_1478_1996 172
532 3300053130 Ga0500642_0067389 Ga0500642_0067389_64_582 172
533 3300053137 Ga0500561_0001080 Ga0500561_0001080_3025_3597 172
534 3300053139 Ga0500568_0002799 Ga0500568_0002799_1019_1537 172
535 3300053142 Ga0500577_0075290 Ga0500577_0075290_250_768 172
536 3300053153 Ga0500616_0002668 Ga0500616_0002668_11843_12361 172
537 3300053156 Ga0500622_0003111 Ga0500622_0003111_9086_9604 172
538 3300053161 Ga0500634_0004710 Ga0500634_0004710_4425_4943 172
539 3300053177 Ga0500636_0000036 Ga0500636_0000036_53247_53765 172
540 3300053177 Ga0500636_0094358 Ga0500636_0094358_516_1034 172
541 3300001979 JGI24740J21852_10000053 JGI24740J21852_1000005322 173
542 3300002704 JGI25155J39150_1000050 JGI25155J39150_100005032 173
543 3300002705 JGI25156J39149_1000074 JGI25156J39149_100007448 173
544 3300002737 JGI25162J39368_1001736 JGI25162J39368_10017363 173
545 3300002737 JGI25162J39368_1001902 JGI25162J39368_100190210 173
546 3300002738 JGI25154J39366_1000099 JGI25154J39366_100009948 173
547 3300002741 JGI25157J39369_1000090 JGI25157J39369_100009032 173
548 3300003214 JGI25165J46597_1001637 JGI25165J46597_10016373 173
549 3300003316 rootH1_10031817 rootH1_100318172 173
550 3300003322 rootL2_10004234 rootL2_100042344 173
551 3300003323 rootH1_10092702 rootH1_100927022 173
552 3300005614 Ga0068856_100043723 Ga0068856_1000437234 173
553 3300006048 Ga0075363_100258873 Ga0075363_1002588732 173
554 3300006178 Ga0075367_10273499 Ga0075367_102734992 173
555 3300006353 Ga0075370_10011402 Ga0075370_100114022 173
556 3300025206 Ga0209435_100063 Ga0209435_10006332 173
557 3300025228 Ga0209672_104087 Ga0209672_1040871 173
558 3300025233 Ga0209437_100050 Ga0209437_100050143 173
559 3300025233 Ga0209437_100412 Ga0209437_10041211 173
560 3300025246 Ga0209646_1000187 Ga0209646_100018732 173
561 3300025246 Ga0209646_1003218 Ga0209646_10032183 173
562 3300025250 Ga0209026_1000227 Ga0209026_100022732 173
563 3300025254 Ga0209148_1017747 Ga0209148_10177472 173
564 3300025256 Ga0209759_1000258 Ga0209759_100025832 173
565 3300025261 Ga0209233_1000037 Ga0209233_1000037185 173
566 3300025261 Ga0209233_1000374 Ga0209233_100037411 173
567 3300025272 Ga0209455_1027798 Ga0209455_10277982 173
568 3300025292 Ga0209676_1022760 Ga0209676_10227602 173
569 3300026078 Ga0207702_10068536 Ga0207702_100685362 173
570 3300027312 Ga0209371_1006919 Ga0209371_10069193 173
571 3300030500 Ga0268256_1006562 Ga0268256_10065624 173
572 3300044684 Ga0466966_0503215 Ga0466966_0503215_38_568 173
573 3300044694 Ga0466963_0077794 Ga0466963_0077794_1017_1538 173
574 3300044765 Ga0466970_0015232 Ga0466970_0015232_2414_2935 173
575 3300045976 Ga0466967_0358596 Ga0466967_0358596_135_656 173
576 3300045976 Ga0466967_0472198 Ga0466967_0472198_22_543 173
577 3300046507 Ga0495606_0025802 Ga0495606_0025802_807_1328 173
578 3300047443 Ga0495687_110831 Ga0495687_110831_263_784 173
579 3300047472 Ga0495686_0239158 Ga0495686_0239158_226_753 173
580 3300048920 Ga0496117_0184302 Ga0496117_0184302_635_1156 173
581 3300048922 Ga0496119_0063667 Ga0496119_0063667_1017_1538 173
582 3300048922 Ga0496119_0179094 Ga0496119_0179094_509_1060 173
583 3300048923 Ga0496120_0087288 Ga0496120_0087288_587_1108 173
584 3300048924 Ga0496121_0410945 Ga0496121_0410945_273_800 173
585 3300048925 Ga0496122_0050049 Ga0496122_0050049_766_1287 173
586 3300048926 Ga0496123_0056483 Ga0496123_0056483_785_1306 173
587 3300048927 Ga0496124_0000083 Ga0496124_0000083_8933_9484 173
588 3300049741 Ga0501079_0255049 Ga0501079_0255049_435_1016 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

101

179

0.92

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

69

181

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

88

176

0.78

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

61

174

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9644 3 169
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9424 3 169
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8625 62 126
1y9w-assembly1.cif.gz_B structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579 0.862 60 170
2jlm-assembly1.cif.gz_C structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 0.859 1 169
ID Description Score Start End Superfamily
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9476 3 169 3.40.630.30
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9256 3 169 3.40.630.30
af_Q54KJ7_19_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9119 16 172 3.40.630.30
3f8kA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8926 60 170 3.40.630.30
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8848 5 172 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1M7ZGT3-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9783 2 173 GO:0005840
GO:0016747
AF-A0A519IRA9-F1-model_v4 GNAT family N-acetyltransferase 0.9731 1 170 GO:0016747
AF-A0A2G8MCS2-F1-model_v4 deleted 0.9727 1 170
AF-A0A4Q3S6A9-F1-model_v4 GNAT family N-acetyltransferase 0.9725 1 172 GO:0016747
AF-A0A4R0H455-F1-model_v4 N-acetyltransferase 0.9722 1 169 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map