F466661

General Info

Members Datasets Scaffolds Average Seq Length
587 252 1174 84

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10208831|Ga0114129_102088312
Length 96
Sequence MVREPGEDTQMGLIGIIGWIVFGLIVGVVAKLLMPGRDPGGWIITILLGIAGALVGGFLGRALGWYEPGHAAGFLMSLVGAVILLGLYRLVIGRAA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
206 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
228 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 1.02
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 1.7
Rhizosphere 91.48
Stem 0
Stem Tuber 0
Unclassified 28.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10208831 3300009147 Bacteria 2641
2 JGI25406J46586_10010210 3300003203 Bacteria 4174
3 Ga0058858_1322717 3300004785 Bacteria 638
4 Ga0058858_1333523 3300004785 Bacteria 764
5 Ga0058860_11686395 3300004801 Bacteria 744
6 Ga0058862_12310380 3300004803 Bacteria 1511
7 Ga0065712_10068037 3300005290 Bacteria 16419
8 Ga0065712_10107907 3300005290 Bacteria 1886
9 Ga0065715_10109994 3300005293 Unclassified 2638
10 Ga0065715_10170245 3300005293 Bacteria 1553
11 Ga0065707_10339828 3300005295 Unclassified 935
12 Ga0070658_10340240 3300005327 Unclassified 1283
13 Ga0070676_10015240 3300005328 Bacteria 4239
14 Ga0070683_100004153 3300005329 Bacteria 11863
15 Ga0070683_100052035 3300005329 Unclassified 3793
16 Ga0070683_100734543 3300005329 Bacteria 946
17 Ga0070690_100029816 3300005330 Bacteria 3387
18 Ga0070690_100093781 3300005330 Unclassified 1981
19 Ga0070670_100012654 3300005331 Bacteria 7222
20 Ga0070670_100836264 3300005331 Bacteria 832
21 Ga0068869_100158052 3300005334 Bacteria 1763
22 Ga0068869_101421963 3300005334 Bacteria 614
23 Ga0070666_10023573 3300005335 Bacteria 4006
24 Ga0070666_10044790 3300005335 Unclassified 2965
25 Ga0070666_10578606 3300005335 Bacteria 818
26 Ga0070680_100021748 3300005336 Bacteria 5101
27 Ga0070680_100197031 3300005336 Unclassified 1698
28 Ga0070682_100445393 3300005337 Bacteria 990
29 Ga0068868_100782539 3300005338 Bacteria 859
30 Ga0068868_101044959 3300005338 Bacteria 749
31 Ga0070660_100082025 3300005339 Bacteria 2532
32 Ga0070689_100043877 3300005340 Unclassified 3439
33 Ga0070689_100356864 3300005340 Bacteria 1227
34 Ga0070689_100579710 3300005340 Unclassified 969
35 Ga0070689_100642407 3300005340 Bacteria 922
36 Ga0070689_100747376 3300005340 Bacteria 857
37 Ga0070689_101012307 3300005340 Bacteria 739
38 Ga0070689_101513487 3300005340 Unclassified 608
39 Ga0070687_100534293 3300005343 Bacteria 795
40 Ga0070687_101024278 3300005343 Bacteria 600
41 Ga0070661_100037874 3300005344 Unclassified 3509
42 Ga0070661_101754099 3300005344 Unclassified 526
43 Ga0070692_10096641 3300005345 Unclassified 1614
44 Ga0070668_100058243 3300005347 Bacteria 2988
45 Ga0070668_100309185 3300005347 Bacteria 1328
46 Ga0070668_100558665 3300005347 Bacteria 997
47 Ga0070668_101245201 3300005347 Bacteria 675
48 Ga0070669_100004518 3300005353 Bacteria 10038
49 Ga0070669_100058511 3300005353 Bacteria 2828
50 Ga0070669_100363383 3300005353 Bacteria 1177
51 Ga0070669_101151950 3300005353 Bacteria 669
52 Ga0070669_101881184 3300005353 Bacteria 522
53 Ga0070675_100007332 3300005354 Bacteria 8512
54 Ga0070675_100047887 3300005354 Unclassified 3504
55 Ga0070675_100114473 3300005354 Bacteria 2285
56 Ga0070675_100737453 3300005354 Bacteria 898
57 Ga0070671_100020647 3300005355 Bacteria 5375
58 Ga0070671_100045220 3300005355 Bacteria 3660
59 Ga0070671_101207006 3300005355 Unclassified 666
60 Ga0070674_100007705 3300005356 Bacteria 6359
61 Ga0070674_100077737 3300005356 Unclassified 2363
62 Ga0070674_100560212 3300005356 Unclassified 960
63 Ga0070674_101935842 3300005356 Bacteria 536
64 Ga0070673_100049172 3300005364 Bacteria 3292
65 Ga0070673_100478648 3300005364 Bacteria 1123
66 Ga0070673_101730158 3300005364 Bacteria 592
67 Ga0070688_100014897 3300005365 Bacteria 4413
68 Ga0070688_100211994 3300005365 Bacteria 1360
69 Ga0070688_100542168 3300005365 Unclassified 883
70 Ga0070688_101103673 3300005365 Unclassified 634
71 Ga0070659_100547441 3300005366 Bacteria 990
72 Ga0070659_100726172 3300005366 Bacteria 860
73 Ga0070667_100492935 3300005367 Bacteria 1123
74 Ga0070709_10000096 3300005434 Bacteria 62193
75 Ga0070710_11523838 3300005437 Bacteria 503
76 Ga0070701_10100251 3300005438 Bacteria 1603
77 Ga0070701_10306210 3300005438 Unclassified 978
78 Ga0070711_100195521 3300005439 Unclassified 1557
79 Ga0070711_101803142 3300005439 Bacteria 537
80 Ga0070705_100020807 3300005440 Bacteria 3480
81 Ga0070705_100258890 3300005440 Unclassified 1226
82 Ga0070705_101501755 3300005440 Bacteria 564
83 Ga0070705_101505306 3300005440 Bacteria 564
84 Ga0070700_100052301 3300005441 Bacteria 2546
85 Ga0070700_100370226 3300005441 Unclassified 1068
86 Ga0070700_100528539 3300005441 Unclassified 912
87 Ga0070700_101197342 3300005441 Bacteria 634
88 Ga0070700_101799418 3300005441 Unclassified 527
89 Ga0070700_101930505 3300005441 Unclassified 511
90 Ga0070694_100199891 3300005444 Bacteria 1489
91 Ga0070694_100499501 3300005444 Bacteria 968
92 Ga0070694_101292634 3300005444 Bacteria 613
93 Ga0070694_101375629 3300005444 Unclassified 595
94 Ga0070708_100266585 3300005445 Unclassified 1610
95 Ga0070708_100582323 3300005445 Bacteria 1055
96 Ga0070663_100044221 3300005455 Bacteria 3138
97 Ga0070663_100543963 3300005455 Bacteria 970
98 Ga0070663_100604913 3300005455 Bacteria 922
99 Ga0070678_100165207 3300005456 Unclassified 1797
100 Ga0070678_100772320 3300005456 Bacteria 870
101 Ga0070678_101883475 3300005456 Unclassified 565
102 Ga0070678_102254832 3300005456 Unclassified 517
103 Ga0070662_100245460 3300005457 Bacteria 1437
104 Ga0068867_100276424 3300005459 Bacteria 1375
105 Ga0068867_100565351 3300005459 Bacteria 987
106 Ga0068867_100780898 3300005459 Unclassified 850
107 Ga0068867_101228135 3300005459 Unclassified 689
108 Ga0068867_101236103 3300005459 Unclassified 687
109 Ga0068867_102184506 3300005459 Bacteria 525
110 Ga0070685_10289697 3300005466 Bacteria 1099
111 Ga0070706_100350915 3300005467 Bacteria 1375
112 Ga0070707_101338316 3300005468 Bacteria 683
113 Ga0070698_101229088 3300005471 Unclassified 699
114 Ga0070699_100011351 3300005518 Bacteria 7691
115 Ga0070679_100022569 3300005530 Bacteria 6152
116 Ga0070679_100240424 3300005530 Bacteria 1768
117 Ga0070684_100005650 3300005535 Bacteria 9608
118 Ga0070684_100031955 3300005535 Bacteria 4483
119 Ga0070697_100388645 3300005536 Unclassified 1209
120 Ga0070697_100686660 3300005536 Bacteria 903
121 Ga0070697_100840417 3300005536 Bacteria 813
122 Ga0068853_100639363 3300005539 Bacteria 1012
123 Ga0068853_102151056 3300005539 Bacteria 541
124 Ga0070672_100030539 3300005543 Unclassified 4049
125 Ga0070672_100082439 3300005543 Bacteria 2580
126 Ga0070672_100087265 3300005543 Unclassified 2510
127 Ga0070672_100169648 3300005543 Bacteria 1814
128 Ga0070686_100214981 3300005544 Bacteria 1386
129 Ga0070686_100589423 3300005544 Unclassified 875
130 Ga0070686_101792878 3300005544 Unclassified 522
131 Ga0070686_101845020 3300005544 Bacteria 515
132 Ga0070695_100463198 3300005545 Bacteria 974
133 Ga0070695_100640563 3300005545 Unclassified 838
134 Ga0070695_100649114 3300005545 Unclassified 833
135 Ga0070695_101546005 3300005545 Unclassified 553
136 Ga0070696_100144627 3300005546 Bacteria 1741
137 Ga0070696_100315482 3300005546 Unclassified 1202
138 Ga0070696_100787233 3300005546 Unclassified 782
139 Ga0070693_100035189 3300005547 Bacteria 2776
140 Ga0070665_100173101 3300005548 Bacteria 2160
141 Ga0070665_100416220 3300005548 Bacteria 1353
142 Ga0070665_101299661 3300005548 Bacteria 737
143 Ga0070665_102010533 3300005548 Bacteria 583
144 Ga0070665_102056300 3300005548 Bacteria 576
145 Ga0070665_102355435 3300005548 Bacteria 535
146 Ga0070704_100086009 3300005549 Unclassified 2328
147 Ga0070704_100105893 3300005549 Bacteria 2130
148 Ga0070704_100270429 3300005549 Bacteria 1404
149 Ga0070704_100954540 3300005549 Unclassified 774
150 Ga0070704_101101866 3300005549 Bacteria 721
151 Ga0068855_100003468 3300005563 Bacteria 19304
152 Ga0070664_100000148 3300005564 Bacteria 48402
153 Ga0070664_100967681 3300005564 Unclassified 799
154 Ga0070664_101403168 3300005564 Unclassified 660
155 Ga0068857_100074390 3300005577 Bacteria 3027
156 Ga0068857_100332319 3300005577 Unclassified 1405
157 Ga0068854_100381364 3300005578 Bacteria 1162
158 Ga0068854_100627816 3300005578 Bacteria 920
159 Ga0068856_100086301 3300005614 Bacteria 3118
160 Ga0068856_100384322 3300005614 Bacteria 1423
161 Ga0068856_101528786 3300005614 Bacteria 681
162 Ga0070702_100291643 3300005615 Bacteria 1125
163 Ga0070702_100906208 3300005615 Unclassified 691
164 Ga0068852_100805777 3300005616 Bacteria 953
165 Ga0068852_102212750 3300005616 Unclassified 571
166 Ga0068859_100049079 3300005617 Bacteria 4239
167 Ga0068859_101121508 3300005617 Unclassified 865
168 Ga0068859_101155290 3300005617 Bacteria 852
169 Ga0068859_101963703 3300005617 Bacteria 646
170 Ga0068859_102411051 3300005617 Bacteria 580
171 Ga0068864_100379809 3300005618 Bacteria 1339
172 Ga0068864_100558441 3300005618 Bacteria 1107
173 Ga0068866_10008564 3300005718 Bacteria 4317
174 Ga0068861_100138781 3300005719 Unclassified 1982
175 Ga0068861_101200216 3300005719 Unclassified 734
176 Ga0068861_101747798 3300005719 Unclassified 616
177 Ga0068861_102097237 3300005719 Bacteria 565
178 Ga0068863_100030240 3300005841 Bacteria 5173
179 Ga0068863_100265223 3300005841 Bacteria 1661
180 Ga0068863_100450256 3300005841 Bacteria 1263
181 Ga0068858_100266466 3300005842 Bacteria 1629
182 Ga0068858_100536720 3300005842 Bacteria 1132
183 Ga0068858_100675158 3300005842 Unclassified 1004
184 Ga0068858_101834036 3300005842 Bacteria 599
185 Ga0068860_100271787 3300005843 Unclassified 1654
186 Ga0068860_101544999 3300005843 Unclassified 685
187 Ga0068860_102574178 3300005843 Unclassified 528
188 Ga0068862_100049117 3300005844 Bacteria 3603
189 Ga0068862_100280501 3300005844 Bacteria 1527
190 Ga0068862_100431527 3300005844 Bacteria 1238
191 Ga0068862_100588906 3300005844 Bacteria 1066
192 Ga0068862_101707216 3300005844 Bacteria 638
193 Ga0068862_101990934 3300005844 Bacteria 591
194 Ga0081539_10000772 3300005985 Bacteria 62952
195 Ga0081539_10131942 3300005985 Bacteria 1225
196 Ga0075365_10028537 3300006038 Bacteria 3560
197 Ga0075368_10007269 3300006042 Bacteria 3905
198 Ga0075368_10521024 3300006042 Bacteria 532
199 Ga0075364_10012471 3300006051 Bacteria 5201
200 Ga0075364_10043466 3300006051 Bacteria 2922
201 Ga0075432_10111007 3300006058 Bacteria 1022
202 Ga0075432_10563326 3300006058 Unclassified 516
203 Ga0070716_100272555 3300006173 Bacteria 1164
204 Ga0075367_10017212 3300006178 Unclassified 3963
205 Ga0075367_10024910 3300006178 Bacteria 3378
206 Ga0075367_10114553 3300006178 Bacteria 1657
207 Ga0075367_10862436 3300006178 Bacteria 577
208 Ga0075366_10053509 3300006195 Unclassified 2398
209 Ga0075366_10137606 3300006195 Bacteria 1475
210 Ga0075366_10281478 3300006195 Bacteria 1016
211 Ga0097621_100203284 3300006237 Bacteria 1721
212 Ga0097621_100488805 3300006237 Bacteria 1114
213 Ga0097621_101773474 3300006237 Bacteria 588
214 Ga0075370_10011933 3300006353 Bacteria 4577
215 Ga0075370_10057393 3300006353 Bacteria 2213
216 Ga0075370_10121440 3300006353 Bacteria 1521
217 Ga0068871_100014627 3300006358 Bacteria 5854
218 Ga0068871_101404825 3300006358 Bacteria 658
219 Ga0068871_101659339 3300006358 Unclassified 606
220 Ga0075428_100003408 3300006844 Bacteria 17390
221 Ga0075428_100354603 3300006844 Bacteria 1574
222 Ga0075428_100974941 3300006844 Unclassified 898
223 Ga0075430_101063436 3300006846 Unclassified 667
224 Ga0075431_100907266 3300006847 Bacteria 850
225 Ga0075433_10004859 3300006852 Bacteria 10513
226 Ga0075433_10112394 3300006852 Unclassified 2416
227 Ga0075433_11893573 3300006852 Bacteria 512
228 Ga0075434_100005095 3300006871 Bacteria 11930
229 Ga0075434_100038127 3300006871 Bacteria 4760
230 Ga0075434_100109931 3300006871 Bacteria 2767
231 Ga0075434_100160106 3300006871 Bacteria 2271
232 Ga0075434_100289543 3300006871 Unclassified 1658
233 Ga0075434_100892365 3300006871 Unclassified 904
234 Ga0075434_101699707 3300006871 Unclassified 639
235 Ga0075434_102604833 3300006871 Unclassified 506
236 Ga0075429_100266131 3300006880 Unclassified 1501
237 Ga0068865_100040286 3300006881 Bacteria 3173
238 Ga0068865_100208877 3300006881 Bacteria 1520
239 Ga0068865_101104162 3300006881 Bacteria 699
240 Ga0068865_101258095 3300006881 Bacteria 657
241 Ga0075436_100036450 3300006914 Bacteria 3394
242 Ga0075436_100090287 3300006914 Bacteria 2129
243 Ga0075436_100095483 3300006914 Bacteria 2068
244 Ga0097620_100049070 3300006931 Bacteria 4239
245 Ga0097620_101121582 3300006931 Unclassified 865
246 Ga0097620_101155287 3300006931 Bacteria 852
247 Ga0097620_101962911 3300006931 Bacteria 646
248 Ga0097620_102410618 3300006931 Bacteria 580
249 Ga0075435_100002959 3300007076 Bacteria 11422
250 Ga0075435_100619558 3300007076 Unclassified 939
251 Ga0075435_101133388 3300007076 Unclassified 684
252 Ga0075435_101368436 3300007076 Unclassified 620
253 Ga0099794_10005657 3300007265 Bacteria 5033
254 Ga0111539_10016193 3300009094 Bacteria 9250
255 Ga0111539_10163761 3300009094 Bacteria 2601
256 Ga0111539_10238962 3300009094 Unclassified 2114
257 Ga0111539_10607195 3300009094 Bacteria 1274
258 Ga0111539_11936065 3300009094 Bacteria 684
259 Ga0105245_10693890 3300009098 Bacteria 1051
260 Ga0105245_11373325 3300009098 Bacteria 756
261 Ga0105247_10217789 3300009101 Bacteria 1291
262 Ga0105247_10724425 3300009101 Bacteria 751
263 Ga0114129_10107595 3300009147 Bacteria 3851
264 Ga0114129_10262352 3300009147 Bacteria 2314
265 Ga0114129_10919639 3300009147 Bacteria 1107
266 Ga0114129_11134836 3300009147 Unclassified 977
267 Ga0114129_12026165 3300009147 Bacteria 696
268 Ga0105243_10006872 3300009148 Bacteria 8771
269 Ga0105243_12070014 3300009148 Unclassified 604
270 Ga0105241_10049258 3300009174 Bacteria 3208
271 Ga0105241_11851304 3300009174 Bacteria 590
272 Ga0105242_11173632 3300009176 Unclassified 786
273 Ga0105242_11390790 3300009176 Bacteria 729
274 Ga0105242_13136380 3300009176 Bacteria 513
275 Ga0105248_10005225 3300009177 Bacteria 14308
276 Ga0105248_10017261 3300009177 Bacteria 7953
277 Ga0105248_10093554 3300009177 Bacteria 3385
278 Ga0105248_11273766 3300009177 Bacteria 831
279 Ga0105248_11519650 3300009177 Unclassified 758
280 Ga0105237_10814026 3300009545 Bacteria 941
281 Ga0105237_11054598 3300009545 Bacteria 820
282 Ga0105238_10303280 3300009551 Bacteria 1581
283 Ga0105238_11015051 3300009551 Bacteria 851
284 Ga0105249_10016527 3300009553 Bacteria 6547
285 Ga0105249_10035139 3300009553 Viruses 4544
286 Ga0105249_10251745 3300009553 Bacteria 1751
287 Ga0105249_10289105 3300009553 Bacteria 1640
288 Ga0105249_10433999 3300009553 Bacteria 1350
289 Ga0105249_10609821 3300009553 Bacteria 1147
290 Ga0105239_10196922 3300010375 Bacteria 2256
291 Ga0105246_10428979 3300011119 Bacteria 1105
292 Ga0105246_10666055 3300011119 Bacteria 908
293 Ga0105246_10783738 3300011119 Unclassified 844
294 Ga0105246_11686777 3300011119 Bacteria 602
295 Ga0157370_10985165 3300013104 Bacteria 763
296 Ga0157369_11940452 3300013105 Bacteria 598
297 Ga0157374_10121133 3300013296 Unclassified 2525
298 Ga0157374_10127643 3300013296 Bacteria 2459
299 Ga0157374_10265025 3300013296 Bacteria 1693
300 Ga0157374_12260571 3300013296 Bacteria 571
301 Ga0157378_10631555 3300013297 Bacteria 1085
302 Ga0157378_11135966 3300013297 Unclassified 819
303 Ga0163162_10527320 3300013306 Bacteria 1310
304 Ga0163162_10665872 3300013306 Unclassified 1164
305 Ga0163162_11286605 3300013306 Bacteria 831
306 Ga0163162_12409297 3300013306 Unclassified 605
307 Ga0163162_12434752 3300013306 Bacteria 602
308 Ga0163162_12543229 3300013306 Bacteria 589
309 Ga0157372_10185855 3300013307 Bacteria 2406
310 Ga0157372_11937967 3300013307 Bacteria 677
311 Ga0157375_10182108 3300013308 Bacteria 2253
312 Ga0157375_11435474 3300013308 Unclassified 813
313 Ga0157375_11568672 3300013308 Bacteria 778
314 Ga0157375_11892086 3300013308 Bacteria 708
315 Ga0157375_12036642 3300013308 Unclassified 683
316 Ga0157375_12698181 3300013308 Bacteria 594
317 Ga0163163_10000120 3300014325 Bacteria 83545
318 Ga0163163_10007802 3300014325 Bacteria 9461
319 Ga0163163_10645507 3300014325 Unclassified 1122
320 Ga0157380_10255284 3300014326 Bacteria 1589
321 Ga0157380_10361933 3300014326 Bacteria 1361
322 Ga0157380_11745106 3300014326 Unclassified 681
323 Ga0157380_11828398 3300014326 Bacteria 667
324 Ga0157379_10017995 3300014968 Bacteria 6228
325 Ga0157379_10092364 3300014968 Bacteria 2715
326 Ga0157379_10137155 3300014968 Bacteria 2204
327 Ga0157379_10184075 3300014968 Bacteria 1887
328 Ga0157379_10292704 3300014968 Unclassified 1483
329 Ga0157376_10817734 3300014969 Bacteria 945
330 Ga0163161_10071665 3300017792 Unclassified 2536
331 Ga0163161_11018590 3300017792 Unclassified 708
332 Ga0206349_1445738 3300020075 Bacteria 729
333 Ga0213876_10281386 3300021384 Unclassified 884
334 Ga0207697_10147329 3300025315 Bacteria 1023
335 Ga0207697_10164556 3300025315 Unclassified 968
336 Ga0207682_10005426 3300025893 Bacteria 5189
337 Ga0207642_10035054 3300025899 Bacteria 2139
338 Ga0207642_10548812 3300025899 Unclassified 713
339 Ga0207710_10539722 3300025900 Bacteria 607
340 Ga0207688_10035642 3300025901 Unclassified 2757
341 Ga0207688_10067327 3300025901 Bacteria 2026
342 Ga0207680_10454213 3300025903 Bacteria 910
343 Ga0207680_10798989 3300025903 Bacteria 676
344 Ga0207699_10000002 3300025906 Bacteria 662194
345 Ga0207699_10886180 3300025906 Unclassified 658
346 Ga0207645_10140132 3300025907 Bacteria 1576
347 Ga0207643_10003368 3300025908 Bacteria 8610
348 Ga0207705_10114883 3300025909 Bacteria 1992
349 Ga0207705_10546919 3300025909 Unclassified 900
350 Ga0207684_10206469 3300025910 Bacteria 1695
351 Ga0207707_11396774 3300025912 Bacteria 559
352 Ga0207671_11183195 3300025914 Bacteria 598
353 Ga0207663_10125370 3300025916 Unclassified 1766
354 Ga0207660_10210801 3300025917 Bacteria 1521
355 Ga0207657_10009026 3300025919 Bacteria 10067
356 Ga0207646_11355901 3300025922 Bacteria 620
357 Ga0207681_10003694 3300025923 Bacteria 9507
358 Ga0207681_10232838 3300025923 Bacteria 1430
359 Ga0207681_10286427 3300025923 Bacteria 1299
360 Ga0207681_10678542 3300025923 Bacteria 855
361 Ga0207650_10004825 3300025925 Bacteria 9211
362 Ga0207650_10047644 3300025925 Unclassified 3159
363 Ga0207650_10663972 3300025925 Bacteria 879
364 Ga0207650_11140904 3300025925 Unclassified 663
365 Ga0207659_10082623 3300025926 Unclassified 2379
366 Ga0207659_10266152 3300025926 Bacteria 1397
367 Ga0207659_10605451 3300025926 Bacteria 934
368 Ga0207659_10804992 3300025926 Bacteria 807
369 Ga0207659_10905552 3300025926 Bacteria 758
370 Ga0207687_10257811 3300025927 Bacteria 1389
371 Ga0207700_10768346 3300025928 Bacteria 861
372 Ga0207644_10125365 3300025931 Unclassified 1960
373 Ga0207644_11527140 3300025931 Unclassified 560
374 Ga0207690_11565553 3300025932 Bacteria 551
375 Ga0207690_11619521 3300025932 Unclassified 541
376 Ga0207706_10169302 3300025933 Unclassified 1920
377 Ga0207706_10402041 3300025933 Bacteria 1187
378 Ga0207686_10883194 3300025934 Bacteria 720
379 Ga0207686_11159525 3300025934 Bacteria 632
380 Ga0207709_10056811 3300025935 Bacteria 2424
381 Ga0207709_11023538 3300025935 Unclassified 676
382 Ga0207670_10098122 3300025936 Unclassified 2087
383 Ga0207670_10132836 3300025936 Bacteria 1826
384 Ga0207670_10487543 3300025936 Bacteria 999
385 Ga0207670_11887201 3300025936 Unclassified 508
386 Ga0207669_10053142 3300025937 Bacteria 2438
387 Ga0207669_11315091 3300025937 Bacteria 614
388 Ga0207704_10872584 3300025938 Unclassified 755
389 Ga0207704_11106551 3300025938 Unclassified 673
390 Ga0207665_10034980 3300025939 Unclassified 3333
391 Ga0207665_11507251 3300025939 Bacteria 534
392 Ga0207691_10009465 3300025940 Bacteria 9356
393 Ga0207691_10059061 3300025940 Unclassified 3488
394 Ga0207691_10238019 3300025940 Bacteria 1574
395 Ga0207691_10329671 3300025940 Bacteria 1308
396 Ga0207711_10043503 3300025941 Bacteria 3831
397 Ga0207711_10049787 3300025941 Unclassified 3587
398 Ga0207711_10151356 3300025941 Bacteria 2094
399 Ga0207711_11371565 3300025941 Bacteria 649
400 Ga0207711_11478741 3300025941 Bacteria 622
401 Ga0207689_10288141 3300025942 Bacteria 1360
402 Ga0207689_10826958 3300025942 Bacteria 782
403 Ga0207661_10009941 3300025944 Bacteria 6833
404 Ga0207661_10254125 3300025944 Bacteria 1563
405 Ga0207679_10076515 3300025945 Bacteria 2543
406 Ga0207679_10263370 3300025945 Bacteria 1471
407 Ga0207679_10535308 3300025945 Bacteria 1049
408 Ga0207679_11668957 3300025945 Bacteria 583
409 Ga0207679_11822757 3300025945 Unclassified 556
410 Ga0207667_10148942 3300025949 Unclassified 2409
411 Ga0207667_10343005 3300025949 Bacteria 1524
412 Ga0207651_10130946 3300025960 Bacteria 1920
413 Ga0207651_12014995 3300025960 Unclassified 519
414 Ga0207712_10003994 3300025961 Bacteria 9310
415 Ga0207712_10018488 3300025961 Viruses 4540
416 Ga0207712_10135960 3300025961 Bacteria 1880
417 Ga0207712_10458284 3300025961 Bacteria 1083
418 Ga0207712_11646061 3300025961 Bacteria 575
419 Ga0207668_10071673 3300025972 Bacteria 2476
420 Ga0207668_11195854 3300025972 Unclassified 683
421 Ga0207668_11589214 3300025972 Bacteria 590
422 Ga0207640_10401260 3300025981 Bacteria 1117
423 Ga0207658_10535984 3300025986 Bacteria 1046
424 Ga0207658_10665290 3300025986 Bacteria 939
425 Ga0207658_11516142 3300025986 Unclassified 613
426 Ga0207677_10505778 3300026023 Unclassified 1045
427 Ga0207703_10344862 3300026035 Bacteria 1370
428 Ga0207703_10703848 3300026035 Bacteria 961
429 Ga0207703_11598190 3300026035 Unclassified 627
430 Ga0207703_12118701 3300026035 Bacteria 538
431 Ga0207639_10733299 3300026041 Bacteria 918
432 Ga0207639_11180121 3300026041 Unclassified 718
433 Ga0207639_12262219 3300026041 Bacteria 505
434 Ga0207678_10994501 3300026067 Bacteria 742
435 Ga0207708_10016129 3300026075 Bacteria 5612
436 Ga0207708_10084929 3300026075 Unclassified 2435
437 Ga0207708_10155283 3300026075 Bacteria 1804
438 Ga0207708_10381250 3300026075 Bacteria 1163
439 Ga0207708_11960786 3300026075 Unclassified 513
440 Ga0207702_10353655 3300026078 Bacteria 1406
441 Ga0207702_12516784 3300026078 Unclassified 501
442 Ga0207641_10036428 3300026088 Unclassified 4107
443 Ga0207641_10283904 3300026088 Bacteria 1558
444 Ga0207641_10302452 3300026088 Bacteria 1511
445 Ga0207641_11708627 3300026088 Bacteria 631
446 Ga0207648_10032707 3300026089 Bacteria 4589
447 Ga0207648_10131585 3300026089 Bacteria 2202
448 Ga0207648_10403588 3300026089 Bacteria 1239
449 Ga0207648_11193043 3300026089 Unclassified 715
450 Ga0207648_11281178 3300026089 Unclassified 689
451 Ga0207648_11627213 3300026089 Bacteria 607
452 Ga0207676_10429405 3300026095 Unclassified 1241
453 Ga0207676_11361825 3300026095 Bacteria 705
454 Ga0207676_12412225 3300026095 Bacteria 523
455 Ga0207676_12481160 3300026095 Bacteria 515
456 Ga0207674_10019846 3300026116 Bacteria 7274
457 Ga0207674_10074124 3300026116 Bacteria 3416
458 Ga0207674_10401620 3300026116 Bacteria 1324
459 Ga0207674_10470014 3300026116 Bacteria 1215
460 Ga0207674_10537460 3300026116 Unclassified 1129
461 Ga0207675_100022197 3300026118 Bacteria 5909
462 Ga0207675_101136599 3300026118 Bacteria 801
463 Ga0207675_101799941 3300026118 Bacteria 632
464 Ga0207675_101901825 3300026118 Unclassified 613
465 Ga0207683_10009670 3300026121 Bacteria 8218
466 Ga0207683_10110066 3300026121 Bacteria 2466
467 Ga0207683_10342863 3300026121 Unclassified 1371
468 Ga0207683_10979517 3300026121 Bacteria 785
469 Ga0207683_11351559 3300026121 Bacteria 659
470 Ga0207698_10759634 3300026142 Bacteria 969
471 Ga0209588_1129285 3300027671 Bacteria 806
472 Ga0209813_10058901 3300027866 Unclassified 1221
473 Ga0209813_10156463 3300027866 Bacteria 820
474 Ga0207428_10009636 3300027907 Bacteria 8648
475 Ga0207428_10099666 3300027907 Bacteria 2246
476 Ga0268266_10080355 3300028379 Bacteria 2841
477 Ga0268266_11391282 3300028379 Bacteria 677
478 Ga0268266_12350377 3300028379 Unclassified 504
479 Ga0268265_10232573 3300028380 Bacteria 1621
480 Ga0268265_10283296 3300028380 Bacteria 1484
481 Ga0268265_10288086 3300028380 Unclassified 1473
482 Ga0268265_10332432 3300028380 Bacteria 1380
483 Ga0268265_10518232 3300028380 Unclassified 1126
484 Ga0268265_10520805 3300028380 Bacteria 1124
485 Ga0268265_10803138 3300028380 Bacteria 917
486 Ga0268264_10594754 3300028381 Unclassified 1090
487 Ga0268264_10638919 3300028381 Bacteria 1052
488 Ga0268264_12483248 3300028381 Bacteria 524
489 Ga0265324_10003035 3300029957 Bacteria 8209
490 Ga0265328_10010647 3300031239 Bacteria 3695
491 Ga0265331_10000093 3300031250 Bacteria 123060
492 Ga0307407_10633377 3300031903 Bacteria 799
493 Ga0307412_10654537 3300031911 Bacteria 896
494 Ga0307409_100334539 3300031995 Bacteria 1422
495 Ga0307416_100109080 3300032002 Unclassified 2434
496 Ga0307416_100378523 3300032002 Unclassified 1445
497 Ga0307416_100854388 3300032002 Bacteria 1008
498 Ga0307411_10069169 3300032005 Unclassified 2383
499 Ga0307415_101802342 3300032126 Bacteria 592
500 Ga0307415_102278635 3300032126 Unclassified 531
501 Ga0373949_0239384 3300035090 Bacteria 558
502 Ga0373932_0113293 3300035112 Bacteria 896
503 Ga0373924_0202116 3300035410 Bacteria 877
504 Ga0395905_0233174 3300037471 Unclassified 1721
505 Ga0436365_0339408 3300039437 Bacteria 1280
506 Ga0436363_0676011 3300039450 Unclassified 504
507 Ga0451789_0745571 3300041443 Unclassified 541
508 Ga0451807_0669836 3300041486 Bacteria 1366
509 Ga0451839_1030754 3300041496 Bacteria 537
510 Ga0439433_0222087 3300041999 Bacteria 504
511 Ga0439449_0238509 3300042007 Unclassified 683
512 Ga0439452_049369 3300042010 Bacteria 968
513 Ga0450923_095566 3300042125 Bacteria 681
514 Ga0439446_0197097 3300042156 Bacteria 679
515 Ga0439434_0304343 3300042435 Unclassified 551
516 Ga0451577_0425263 3300042876 Unclassified 1206
517 Ga0453684_0846190 3300044712 Unclassified 983
518 Ga0495641_0079037 3300046461 Bacteria 1474
519 Ga0495587_0536771 3300046536 Unclassified 646
520 Ga0495646_0241674 3300046680 Unclassified 970
521 Ga0495658_1037725 3300046683 Bacteria 523
522 Ga0495669_0665572 3300046684 Unclassified 506
523 Ga0495676_0156857 3300047321 Bacteria 1614
524 Ga0495680_0586862 3300047322 Bacteria 747
525 Ga0495675_0057270 3300047444 Unclassified 2471
526 Ga0495614_0308217 3300048089 Bacteria 733
527 Ga0496101_0202071 3300048904 Bacteria 1537
528 Ga0496102_0833629 3300048905 Bacteria 844
529 Ga0496104_0696644 3300048907 Bacteria 924
530 Ga0496109_1010216 3300048912 Bacteria 769
531 Ga0496110_0120938 3300048913 Bacteria 2359
532 Ga0496111_0990908 3300048914 Bacteria 602
533 Ga0496112_0592716 3300048915 Bacteria 1041
534 Ga0496112_1514014 3300048915 Unclassified 585
535 Ga0501298_194186 3300049521 Unclassified 513
536 Ga0501315_027130 3300049531 Bacteria 807
537 Ga0501031_0912903 3300049568 Bacteria 562
538 Ga0501034_0185003 3300049571 Bacteria 2047
539 Ga0501036_1435848 3300049572 Bacteria 559
540 Ga0501042_1396057 3300049578 Bacteria 511
541 Ga0501046_0810714 3300049580 Bacteria 656
542 Ga0501225_0172941 3300049705 Bacteria 671
543 Ga0501080_0558781 3300049742 Bacteria 1019
544 Ga0501080_0865137 3300049742 Bacteria 790
545 nmdc:mga03683_175840_c1 3300050489 Bacteria 974
546 nmdc:mga03n38_702713_c1 3300050490 Unclassified 583
547 nmdc:mga00v17_148531_c1 3300050491 Bacteria 1505
548 nmdc:mga00v17_44316_c1 3300050491 Bacteria 2683
549 nmdc:mga0yw44_223332_c1 3300050492 Bacteria 1249
550 nmdc:mga0k408_216822_c1 3300050493 Bacteria 1143
551 nmdc:mga0k408_76013_c1 3300050493 Bacteria 1963
552 nmdc:mga0k408_934209_c1 3300050493 Bacteria 503
553 nmdc:mga06z11_108373_c1 3300050494 Bacteria 1535
554 nmdc:mga06z11_373692_c1 3300050494 Bacteria 856
555 nmdc:mga06z11_693410_c1 3300050494 Bacteria 620
556 nmdc:mga04h51_166200_c1 3300050495 Bacteria 852
557 nmdc:mga04h51_70512_c1 3300050495 Unclassified 1219
558 nmdc:mga07m45_36229_c1 3300050496 Bacteria 2747
559 nmdc:mga07m45_39927_c1 3300050496 Bacteria 2625
560 nmdc:mga05p37_12898_c1 3300050507 Bacteria 9995
561 nmdc:mga05p37_219461_c1 3300050507 Bacteria 2295
562 nmdc:mga05p37_359133_c1 3300050507 Bacteria 1713
563 nmdc:mga0qj67_1162490_c1 3300050509 Bacteria 601
564 nmdc:mga0qj67_485686_c1 3300050509 Unclassified 993
565 nmdc:mga06r32_892211_c1 3300050510 Bacteria 846
566 nmdc:mga08y16_1572659_c1 3300050511 Unclassified 616
567 nmdc:mga08y16_1808978_c1 3300050511 Unclassified 564
568 nmdc:mga08y16_390833_c1 3300050511 Bacteria 1425
569 nmdc:mga08y16_50984_c1 3300050511 Bacteria 4330
570 nmdc:mga0n895_11104_c1 3300050512 Bacteria 8015
571 nmdc:mga0n895_1173510_c1 3300050512 Unclassified 743
572 nmdc:mga0n895_1720137_c1 3300050512 Unclassified 589
573 nmdc:mga0n895_1777550_c1 3300050512 Unclassified 578
574 nmdc:mga0n895_2023229_c1 3300050512 Unclassified 533
575 nmdc:mga0n895_344457_c1 3300050512 Bacteria 1509
576 nmdc:mga0n895_81510_c1 3300050512 Bacteria 3224
577 nmdc:mga0rr50_13816_c1 3300050513 Bacteria 5274
578 nmdc:mga0rr50_1749753_c1 3300050513 Bacteria 523
579 nmdc:mga0rr50_1802175_c1 3300050513 Unclassified 515
580 nmdc:mga0rr50_839544_c1 3300050513 Unclassified 784
581 nmdc:mga08x19_171748_c1 3300050514 Bacteria 1477
582 nmdc:mga08x19_243333_c1 3300050514 Bacteria 1241
583 nmdc:mga08x19_46524_c1 3300050514 Bacteria 2775
584 nmdc:mga08x19_990308_c1 3300050514 Unclassified 597
585 nmdc:mga0a205_100613_c1 3300050515 Bacteria 2789
586 nmdc:mga0a205_68621_c1 3300050515 Bacteria 3424
587 2524610976 2524023250 Bacteria 5457705
588 Ga0114129_10208831
589 JGI25406J46586_10010210
590 Ga0058858_1322717
591 Ga0058858_1333523
592 Ga0058860_11686395
593 Ga0058862_12310380
594 Ga0065712_10068037
595 Ga0065712_10107907
596 Ga0065715_10109994
597 Ga0065715_10170245
598 Ga0065707_10339828
599 Ga0070658_10340240
600 Ga0070676_10015240
601 Ga0070683_100004153
602 Ga0070683_100052035
603 Ga0070683_100734543
604 Ga0070690_100029816
605 Ga0070690_100093781
606 Ga0070670_100012654
607 Ga0070670_100836264
608 Ga0068869_100158052
609 Ga0068869_101421963
610 Ga0070666_10023573
611 Ga0070666_10044790
612 Ga0070666_10578606
613 Ga0070680_100021748
614 Ga0070680_100197031
615 Ga0070682_100445393
616 Ga0068868_100782539
617 Ga0068868_101044959
618 Ga0070660_100082025
619 Ga0070689_100043877
620 Ga0070689_100356864
621 Ga0070689_100579710
622 Ga0070689_100642407
623 Ga0070689_100747376
624 Ga0070689_101012307
625 Ga0070689_101513487
626 Ga0070687_100534293
627 Ga0070687_101024278
628 Ga0070661_100037874
629 Ga0070661_101754099
630 Ga0070692_10096641
631 Ga0070668_100058243
632 Ga0070668_100309185
633 Ga0070668_100558665
634 Ga0070668_101245201
635 Ga0070669_100004518
636 Ga0070669_100058511
637 Ga0070669_100363383
638 Ga0070669_101151950
639 Ga0070669_101881184
640 Ga0070675_100007332
641 Ga0070675_100047887
642 Ga0070675_100114473
643 Ga0070675_100737453
644 Ga0070671_100020647
645 Ga0070671_100045220
646 Ga0070671_101207006
647 Ga0070674_100007705
648 Ga0070674_100077737
649 Ga0070674_100560212
650 Ga0070674_101935842
651 Ga0070673_100049172
652 Ga0070673_100478648
653 Ga0070673_101730158
654 Ga0070688_100014897
655 Ga0070688_100211994
656 Ga0070688_100542168
657 Ga0070688_101103673
658 Ga0070659_100547441
659 Ga0070659_100726172
660 Ga0070667_100492935
661 Ga0070709_10000096
662 Ga0070710_11523838
663 Ga0070701_10100251
664 Ga0070701_10306210
665 Ga0070711_100195521
666 Ga0070711_101803142
667 Ga0070705_100020807
668 Ga0070705_100258890
669 Ga0070705_101501755
670 Ga0070705_101505306
671 Ga0070700_100052301
672 Ga0070700_100370226
673 Ga0070700_100528539
674 Ga0070700_101197342
675 Ga0070700_101799418
676 Ga0070700_101930505
677 Ga0070694_100199891
678 Ga0070694_100499501
679 Ga0070694_101292634
680 Ga0070694_101375629
681 Ga0070708_100266585
682 Ga0070708_100582323
683 Ga0070663_100044221
684 Ga0070663_100543963
685 Ga0070663_100604913
686 Ga0070678_100165207
687 Ga0070678_100772320
688 Ga0070678_101883475
689 Ga0070678_102254832
690 Ga0070662_100245460
691 Ga0068867_100276424
692 Ga0068867_100565351
693 Ga0068867_100780898
694 Ga0068867_101228135
695 Ga0068867_101236103
696 Ga0068867_102184506
697 Ga0070685_10289697
698 Ga0070706_100350915
699 Ga0070707_101338316
700 Ga0070698_101229088
701 Ga0070699_100011351
702 Ga0070679_100022569
703 Ga0070679_100240424
704 Ga0070684_100005650
705 Ga0070684_100031955
706 Ga0070697_100388645
707 Ga0070697_100686660
708 Ga0070697_100840417
709 Ga0068853_100639363
710 Ga0068853_102151056
711 Ga0070672_100030539
712 Ga0070672_100082439
713 Ga0070672_100087265
714 Ga0070672_100169648
715 Ga0070686_100214981
716 Ga0070686_100589423
717 Ga0070686_101792878
718 Ga0070686_101845020
719 Ga0070695_100463198
720 Ga0070695_100640563
721 Ga0070695_100649114
722 Ga0070695_101546005
723 Ga0070696_100144627
724 Ga0070696_100315482
725 Ga0070696_100787233
726 Ga0070693_100035189
727 Ga0070665_100173101
728 Ga0070665_100416220
729 Ga0070665_101299661
730 Ga0070665_102010533
731 Ga0070665_102056300
732 Ga0070665_102355435
733 Ga0070704_100086009
734 Ga0070704_100105893
735 Ga0070704_100270429
736 Ga0070704_100954540
737 Ga0070704_101101866
738 Ga0068855_100003468
739 Ga0070664_100000148
740 Ga0070664_100967681
741 Ga0070664_101403168
742 Ga0068857_100074390
743 Ga0068857_100332319
744 Ga0068854_100381364
745 Ga0068854_100627816
746 Ga0068856_100086301
747 Ga0068856_100384322
748 Ga0068856_101528786
749 Ga0070702_100291643
750 Ga0070702_100906208
751 Ga0068852_100805777
752 Ga0068852_102212750
753 Ga0068859_100049079
754 Ga0068859_101121508
755 Ga0068859_101155290
756 Ga0068859_101963703
757 Ga0068859_102411051
758 Ga0068864_100379809
759 Ga0068864_100558441
760 Ga0068866_10008564
761 Ga0068861_100138781
762 Ga0068861_101200216
763 Ga0068861_101747798
764 Ga0068861_102097237
765 Ga0068863_100030240
766 Ga0068863_100265223
767 Ga0068863_100450256
768 Ga0068858_100266466
769 Ga0068858_100536720
770 Ga0068858_100675158
771 Ga0068858_101834036
772 Ga0068860_100271787
773 Ga0068860_101544999
774 Ga0068860_102574178
775 Ga0068862_100049117
776 Ga0068862_100280501
777 Ga0068862_100431527
778 Ga0068862_100588906
779 Ga0068862_101707216
780 Ga0068862_101990934
781 Ga0081539_10000772
782 Ga0081539_10131942
783 Ga0075365_10028537
784 Ga0075368_10007269
785 Ga0075368_10521024
786 Ga0075364_10012471
787 Ga0075364_10043466
788 Ga0075432_10111007
789 Ga0075432_10563326
790 Ga0070716_100272555
791 Ga0075367_10017212
792 Ga0075367_10024910
793 Ga0075367_10114553
794 Ga0075367_10862436
795 Ga0075366_10053509
796 Ga0075366_10137606
797 Ga0075366_10281478
798 Ga0097621_100203284
799 Ga0097621_100488805
800 Ga0097621_101773474
801 Ga0075370_10011933
802 Ga0075370_10057393
803 Ga0075370_10121440
804 Ga0068871_100014627
805 Ga0068871_101404825
806 Ga0068871_101659339
807 Ga0075428_100003408
808 Ga0075428_100354603
809 Ga0075428_100974941
810 Ga0075430_101063436
811 Ga0075431_100907266
812 Ga0075433_10004859
813 Ga0075433_10112394
814 Ga0075433_11893573
815 Ga0075434_100005095
816 Ga0075434_100038127
817 Ga0075434_100109931
818 Ga0075434_100160106
819 Ga0075434_100289543
820 Ga0075434_100892365
821 Ga0075434_101699707
822 Ga0075434_102604833
823 Ga0075429_100266131
824 Ga0068865_100040286
825 Ga0068865_100208877
826 Ga0068865_101104162
827 Ga0068865_101258095
828 Ga0075436_100036450
829 Ga0075436_100090287
830 Ga0075436_100095483
831 Ga0097620_100049070
832 Ga0097620_101121582
833 Ga0097620_101155287
834 Ga0097620_101962911
835 Ga0097620_102410618
836 Ga0075435_100002959
837 Ga0075435_100619558
838 Ga0075435_101133388
839 Ga0075435_101368436
840 Ga0099794_10005657
841 Ga0111539_10016193
842 Ga0111539_10163761
843 Ga0111539_10238962
844 Ga0111539_10607195
845 Ga0111539_11936065
846 Ga0105245_10693890
847 Ga0105245_11373325
848 Ga0105247_10217789
849 Ga0105247_10724425
850 Ga0114129_10107595
851 Ga0114129_10262352
852 Ga0114129_10919639
853 Ga0114129_11134836
854 Ga0114129_12026165
855 Ga0105243_10006872
856 Ga0105243_12070014
857 Ga0105241_10049258
858 Ga0105241_11851304
859 Ga0105242_11173632
860 Ga0105242_11390790
861 Ga0105242_13136380
862 Ga0105248_10005225
863 Ga0105248_10017261
864 Ga0105248_10093554
865 Ga0105248_11273766
866 Ga0105248_11519650
867 Ga0105237_10814026
868 Ga0105237_11054598
869 Ga0105238_10303280
870 Ga0105238_11015051
871 Ga0105249_10016527
872 Ga0105249_10035139
873 Ga0105249_10251745
874 Ga0105249_10289105
875 Ga0105249_10433999
876 Ga0105249_10609821
877 Ga0105239_10196922
878 Ga0105246_10428979
879 Ga0105246_10666055
880 Ga0105246_10783738
881 Ga0105246_11686777
882 Ga0157370_10985165
883 Ga0157369_11940452
884 Ga0157374_10121133
885 Ga0157374_10127643
886 Ga0157374_10265025
887 Ga0157374_12260571
888 Ga0157378_10631555
889 Ga0157378_11135966
890 Ga0163162_10527320
891 Ga0163162_10665872
892 Ga0163162_11286605
893 Ga0163162_12409297
894 Ga0163162_12434752
895 Ga0163162_12543229
896 Ga0157372_10185855
897 Ga0157372_11937967
898 Ga0157375_10182108
899 Ga0157375_11435474
900 Ga0157375_11568672
901 Ga0157375_11892086
902 Ga0157375_12036642
903 Ga0157375_12698181
904 Ga0163163_10000120
905 Ga0163163_10007802
906 Ga0163163_10645507
907 Ga0157380_10255284
908 Ga0157380_10361933
909 Ga0157380_11745106
910 Ga0157380_11828398
911 Ga0157379_10017995
912 Ga0157379_10092364
913 Ga0157379_10137155
914 Ga0157379_10184075
915 Ga0157379_10292704
916 Ga0157376_10817734
917 Ga0163161_10071665
918 Ga0163161_11018590
919 Ga0206349_1445738
920 Ga0213876_10281386
921 Ga0207697_10147329
922 Ga0207697_10164556
923 Ga0207682_10005426
924 Ga0207642_10035054
925 Ga0207642_10548812
926 Ga0207710_10539722
927 Ga0207688_10035642
928 Ga0207688_10067327
929 Ga0207680_10454213
930 Ga0207680_10798989
931 Ga0207699_10000002
932 Ga0207699_10886180
933 Ga0207645_10140132
934 Ga0207643_10003368
935 Ga0207705_10114883
936 Ga0207705_10546919
937 Ga0207684_10206469
938 Ga0207707_11396774
939 Ga0207671_11183195
940 Ga0207663_10125370
941 Ga0207660_10210801
942 Ga0207657_10009026
943 Ga0207646_11355901
944 Ga0207681_10003694
945 Ga0207681_10232838
946 Ga0207681_10286427
947 Ga0207681_10678542
948 Ga0207650_10004825
949 Ga0207650_10047644
950 Ga0207650_10663972
951 Ga0207650_11140904
952 Ga0207659_10082623
953 Ga0207659_10266152
954 Ga0207659_10605451
955 Ga0207659_10804992
956 Ga0207659_10905552
957 Ga0207687_10257811
958 Ga0207700_10768346
959 Ga0207644_10125365
960 Ga0207644_11527140
961 Ga0207690_11565553
962 Ga0207690_11619521
963 Ga0207706_10169302
964 Ga0207706_10402041
965 Ga0207686_10883194
966 Ga0207686_11159525
967 Ga0207709_10056811
968 Ga0207709_11023538
969 Ga0207670_10098122
970 Ga0207670_10132836
971 Ga0207670_10487543
972 Ga0207670_11887201
973 Ga0207669_10053142
974 Ga0207669_11315091
975 Ga0207704_10872584
976 Ga0207704_11106551
977 Ga0207665_10034980
978 Ga0207665_11507251
979 Ga0207691_10009465
980 Ga0207691_10059061
981 Ga0207691_10238019
982 Ga0207691_10329671
983 Ga0207711_10043503
984 Ga0207711_10049787
985 Ga0207711_10151356
986 Ga0207711_11371565
987 Ga0207711_11478741
988 Ga0207689_10288141
989 Ga0207689_10826958
990 Ga0207661_10009941
991 Ga0207661_10254125
992 Ga0207679_10076515
993 Ga0207679_10263370
994 Ga0207679_10535308
995 Ga0207679_11668957
996 Ga0207679_11822757
997 Ga0207667_10148942
998 Ga0207667_10343005
999 Ga0207651_10130946
1000 Ga0207651_12014995
1001 Ga0207712_10003994
1002 Ga0207712_10018488
1003 Ga0207712_10135960
1004 Ga0207712_10458284
1005 Ga0207712_11646061
1006 Ga0207668_10071673
1007 Ga0207668_11195854
1008 Ga0207668_11589214
1009 Ga0207640_10401260
1010 Ga0207658_10535984
1011 Ga0207658_10665290
1012 Ga0207658_11516142
1013 Ga0207677_10505778
1014 Ga0207703_10344862
1015 Ga0207703_10703848
1016 Ga0207703_11598190
1017 Ga0207703_12118701
1018 Ga0207639_10733299
1019 Ga0207639_11180121
1020 Ga0207639_12262219
1021 Ga0207678_10994501
1022 Ga0207708_10016129
1023 Ga0207708_10084929
1024 Ga0207708_10155283
1025 Ga0207708_10381250
1026 Ga0207708_11960786
1027 Ga0207702_10353655
1028 Ga0207702_12516784
1029 Ga0207641_10036428
1030 Ga0207641_10283904
1031 Ga0207641_10302452
1032 Ga0207641_11708627
1033 Ga0207648_10032707
1034 Ga0207648_10131585
1035 Ga0207648_10403588
1036 Ga0207648_11193043
1037 Ga0207648_11281178
1038 Ga0207648_11627213
1039 Ga0207676_10429405
1040 Ga0207676_11361825
1041 Ga0207676_12412225
1042 Ga0207676_12481160
1043 Ga0207674_10019846
1044 Ga0207674_10074124
1045 Ga0207674_10401620
1046 Ga0207674_10470014
1047 Ga0207674_10537460
1048 Ga0207675_100022197
1049 Ga0207675_101136599
1050 Ga0207675_101799941
1051 Ga0207675_101901825
1052 Ga0207683_10009670
1053 Ga0207683_10110066
1054 Ga0207683_10342863
1055 Ga0207683_10979517
1056 Ga0207683_11351559
1057 Ga0207698_10759634
1058 Ga0209588_1129285
1059 Ga0209813_10058901
1060 Ga0209813_10156463
1061 Ga0207428_10009636
1062 Ga0207428_10099666
1063 Ga0268266_10080355
1064 Ga0268266_11391282
1065 Ga0268266_12350377
1066 Ga0268265_10232573
1067 Ga0268265_10283296
1068 Ga0268265_10288086
1069 Ga0268265_10332432
1070 Ga0268265_10518232
1071 Ga0268265_10520805
1072 Ga0268265_10803138
1073 Ga0268264_10594754
1074 Ga0268264_10638919
1075 Ga0268264_12483248
1076 Ga0265324_10003035
1077 Ga0265328_10010647
1078 Ga0265331_10000093
1079 Ga0307407_10633377
1080 Ga0307412_10654537
1081 Ga0307409_100334539
1082 Ga0307416_100109080
1083 Ga0307416_100378523
1084 Ga0307416_100854388
1085 Ga0307411_10069169
1086 Ga0307415_101802342
1087 Ga0307415_102278635
1088 Ga0373949_0239384
1089 Ga0373932_0113293
1090 Ga0373924_0202116
1091 Ga0395905_0233174
1092 Ga0436365_0339408
1093 Ga0436363_0676011
1094 Ga0451789_0745571
1095 Ga0451807_0669836
1096 Ga0451839_1030754
1097 Ga0439433_0222087
1098 Ga0439449_0238509
1099 Ga0439452_049369
1100 Ga0450923_095566
1101 Ga0439446_0197097
1102 Ga0439434_0304343
1103 Ga0451577_0425263
1104 Ga0453684_0846190
1105 Ga0495641_0079037
1106 Ga0495587_0536771
1107 Ga0495646_0241674
1108 Ga0495658_1037725
1109 Ga0495669_0665572
1110 Ga0495676_0156857
1111 Ga0495680_0586862
1112 Ga0495675_0057270
1113 Ga0495614_0308217
1114 Ga0496101_0202071
1115 Ga0496102_0833629
1116 Ga0496104_0696644
1117 Ga0496109_1010216
1118 Ga0496110_0120938
1119 Ga0496111_0990908
1120 Ga0496112_0592716
1121 Ga0496112_1514014
1122 Ga0501298_194186
1123 Ga0501315_027130
1124 Ga0501031_0912903
1125 Ga0501034_0185003
1126 Ga0501036_1435848
1127 Ga0501042_1396057
1128 Ga0501046_0810714
1129 Ga0501225_0172941
1130 Ga0501080_0558781
1131 Ga0501080_0865137
1132 nmdc:mga03683_175840_c1
1133 nmdc:mga03n38_702713_c1
1134 nmdc:mga00v17_148531_c1
1135 nmdc:mga00v17_44316_c1
1136 nmdc:mga0yw44_223332_c1
1137 nmdc:mga0k408_216822_c1
1138 nmdc:mga0k408_76013_c1
1139 nmdc:mga0k408_934209_c1
1140 nmdc:mga06z11_108373_c1
1141 nmdc:mga06z11_373692_c1
1142 nmdc:mga06z11_693410_c1
1143 nmdc:mga04h51_166200_c1
1144 nmdc:mga04h51_70512_c1
1145 nmdc:mga07m45_36229_c1
1146 nmdc:mga07m45_39927_c1
1147 nmdc:mga05p37_12898_c1
1148 nmdc:mga05p37_219461_c1
1149 nmdc:mga05p37_359133_c1
1150 nmdc:mga0qj67_1162490_c1
1151 nmdc:mga0qj67_485686_c1
1152 nmdc:mga06r32_892211_c1
1153 nmdc:mga08y16_1572659_c1
1154 nmdc:mga08y16_1808978_c1
1155 nmdc:mga08y16_390833_c1
1156 nmdc:mga08y16_50984_c1
1157 nmdc:mga0n895_11104_c1
1158 nmdc:mga0n895_1173510_c1
1159 nmdc:mga0n895_1720137_c1
1160 nmdc:mga0n895_1777550_c1
1161 nmdc:mga0n895_2023229_c1
1162 nmdc:mga0n895_344457_c1
1163 nmdc:mga0n895_81510_c1
1164 nmdc:mga0rr50_13816_c1
1165 nmdc:mga0rr50_1749753_c1
1166 nmdc:mga0rr50_1802175_c1
1167 nmdc:mga0rr50_839544_c1
1168 nmdc:mga08x19_171748_c1
1169 nmdc:mga08x19_243333_c1
1170 nmdc:mga08x19_46524_c1
1171 nmdc:mga08x19_990308_c1
1172 nmdc:mga0a205_100613_c1
1173 nmdc:mga0a205_68621_c1
1174 2524610976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

46

93

0.97

Map