F466537

General Info

Members Datasets Scaffolds Average Seq Length
586 259 1172 104

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10001017|Ga0081539_100010178
Length 107
Sequence MRSPRSCPCVPEEIRRIADLLERRWSLTILYASQTGAVRFNDFLASCGRIPPGTLATRLAELEEAGLLERRVVADSRPPRVEYLLTPRGAELRSVLTALSRFAARSV

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
87 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
185 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
186 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
187 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 5.12
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 8.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10001017 3300005985 Bacteria 51648
2 JGI25406J46586_10011093 3300003203 Bacteria 3963
3 JGI25406J46586_10042629 3300003203 Bacteria 1586
4 Ga0070676_10383789 3300005328 Bacteria 973
5 Ga0070683_100059463 3300005329 Bacteria 3551
6 Ga0070683_100326526 3300005329 Bacteria 1461
7 Ga0070690_100492298 3300005330 Bacteria 916
8 Ga0070670_101276341 3300005331 Bacteria 672
9 Ga0070677_10874232 3300005333 Bacteria 518
10 Ga0070680_100287096 3300005336 Bacteria 1394
11 Ga0070682_100049358 3300005337 Bacteria 2623
12 Ga0070682_101202738 3300005337 Bacteria 640
13 Ga0070682_101627512 3300005337 Bacteria 559
14 Ga0068868_100220995 3300005338 Bacteria 1586
15 Ga0068868_100334605 3300005338 Bacteria 1293
16 Ga0070660_100308239 3300005339 Bacteria 1299
17 Ga0070660_100481162 3300005339 Bacteria 1032
18 Ga0070660_100720729 3300005339 Bacteria 837
19 Ga0070660_100800383 3300005339 Bacteria 793
20 Ga0070689_100222090 3300005340 Bacteria 1550
21 Ga0070691_10482149 3300005341 Bacteria 714
22 Ga0070691_10725305 3300005341 Bacteria 599
23 Ga0070691_10788149 3300005341 Bacteria 578
24 Ga0070661_100236592 3300005344 Bacteria 1405
25 Ga0070661_101057937 3300005344 Bacteria 675
26 Ga0070692_10127002 3300005345 Bacteria 1429
27 Ga0070692_10128016 3300005345 Bacteria 1424
28 Ga0070692_10143624 3300005345 Bacteria 1353
29 Ga0070668_100065977 3300005347 Bacteria 2807
30 Ga0070668_100680706 3300005347 Bacteria 906
31 Ga0070675_100192293 3300005354 Bacteria 1769
32 Ga0070675_100215382 3300005354 Bacteria 1671
33 Ga0070675_100536411 3300005354 Bacteria 1057
34 Ga0070675_101074363 3300005354 Bacteria 740
35 Ga0070671_100438447 3300005355 Bacteria 1120
36 Ga0070671_101482762 3300005355 Unclassified 600
37 Ga0070674_100069453 3300005356 Bacteria 2485
38 Ga0070674_100197626 3300005356 Bacteria 1551
39 Ga0070673_100256927 3300005364 Bacteria 1525
40 Ga0070673_102251304 3300005364 Bacteria 518
41 Ga0070659_100078574 3300005366 Bacteria 2632
42 Ga0070659_100331940 3300005366 Bacteria 1273
43 Ga0070659_100989762 3300005366 Unclassified 738
44 Ga0070659_101431594 3300005366 Bacteria 615
45 Ga0070667_101546948 3300005367 Bacteria 623
46 Ga0070713_100009909 3300005436 Bacteria 6856
47 Ga0070710_10720728 3300005437 Bacteria 706
48 Ga0070710_11383552 3300005437 Bacteria 526
49 Ga0070701_10069500 3300005438 Bacteria 1879
50 Ga0070701_11303707 3300005438 Bacteria 519
51 Ga0070700_100076594 3300005441 Bacteria 2148
52 Ga0070700_100098380 3300005441 Bacteria 1923
53 Ga0070700_100109556 3300005441 Bacteria 1833
54 Ga0070700_101042532 3300005441 Bacteria 675
55 Ga0070700_101236986 3300005441 Unclassified 625
56 Ga0070694_100488492 3300005444 Bacteria 978
57 Ga0070694_100546218 3300005444 Bacteria 927
58 Ga0070663_101696309 3300005455 Unclassified 565
59 Ga0070678_100269994 3300005456 Bacteria 1434
60 Ga0070678_100713233 3300005456 Bacteria 905
61 Ga0070678_101791254 3300005456 Bacteria 579
62 Ga0070662_100034319 3300005457 Bacteria 3576
63 Ga0070662_100175005 3300005457 Bacteria 1688
64 Ga0070662_100890280 3300005457 Unclassified 759
65 Ga0070681_10007637 3300005458 Bacteria 10575
66 Ga0070681_10769085 3300005458 Bacteria 880
67 Ga0068867_100710751 3300005459 Bacteria 888
68 Ga0068867_102301645 3300005459 Unclassified 512
69 Ga0070685_10453512 3300005466 Bacteria 899
70 Ga0070698_100187110 3300005471 Bacteria 2008
71 Ga0070699_100204464 3300005518 Bacteria 1757
72 Ga0070699_101300805 3300005518 Bacteria 667
73 Ga0070679_100005464 3300005530 Bacteria 11782
74 Ga0070679_100031114 3300005530 Bacteria 5271
75 Ga0070679_100276607 3300005530 Bacteria 1632
76 Ga0070679_100460319 3300005530 Bacteria 1217
77 Ga0070684_100039838 3300005535 Bacteria 4043
78 Ga0070684_100064100 3300005535 Bacteria 3223
79 Ga0070684_100072855 3300005535 Bacteria 3025
80 Ga0070684_100088721 3300005535 Bacteria 2748
81 Ga0070684_100165294 3300005535 Bacteria 2008
82 Ga0070684_100707938 3300005535 Bacteria 939
83 Ga0070684_100850845 3300005535 Bacteria 854
84 Ga0070684_101032607 3300005535 Bacteria 772
85 Ga0070697_101708404 3300005536 Bacteria 563
86 Ga0068853_100094144 3300005539 Bacteria 2639
87 Ga0068853_100830772 3300005539 Bacteria 885
88 Ga0068853_100986328 3300005539 Bacteria 811
89 Ga0070672_100016293 3300005543 Bacteria 5319
90 Ga0070672_100120379 3300005543 Bacteria 2148
91 Ga0070672_100121346 3300005543 Bacteria 2139
92 Ga0070672_100409754 3300005543 Bacteria 1163
93 Ga0070672_100673247 3300005543 Bacteria 905
94 Ga0070695_100726962 3300005545 Bacteria 790
95 Ga0070695_101534947 3300005545 Bacteria 555
96 Ga0070696_100462408 3300005546 Bacteria 1003
97 Ga0070696_100696324 3300005546 Bacteria 828
98 Ga0070693_100080056 3300005547 Bacteria 1945
99 Ga0070693_100344035 3300005547 Bacteria 1019
100 Ga0070665_100136175 3300005548 Bacteria 2459
101 Ga0070665_102039098 3300005548 Bacteria 579
102 Ga0070704_100453149 3300005549 Bacteria 1105
103 Ga0070704_101233635 3300005549 Bacteria 683
104 Ga0070704_101642790 3300005549 Unclassified 593
105 Ga0068855_100583166 3300005563 Bacteria 1207
106 Ga0070664_100042644 3300005564 Bacteria 3829
107 Ga0070664_101002228 3300005564 Bacteria 785
108 Ga0070664_101973563 3300005564 Bacteria 554
109 Ga0068857_100115767 3300005577 Bacteria 2411
110 Ga0068857_100368812 3300005577 Bacteria 1332
111 Ga0068854_100403397 3300005578 Unclassified 1132
112 Ga0068854_100902642 3300005578 Bacteria 777
113 Ga0068854_101274243 3300005578 Unclassified 661
114 Ga0068856_100566152 3300005614 Unclassified 1158
115 Ga0070702_100700194 3300005615 Bacteria 772
116 Ga0070702_101879023 3300005615 Unclassified 502
117 Ga0068852_100359027 3300005616 Bacteria 1425
118 Ga0068852_100787332 3300005616 Bacteria 965
119 Ga0068859_101802210 3300005617 Bacteria 676
120 Ga0068864_101334697 3300005618 Bacteria 718
121 Ga0068866_10055092 3300005718 Bacteria 2041
122 Ga0068861_100388735 3300005719 Bacteria 1235
123 Ga0068861_100839820 3300005719 Bacteria 865
124 Ga0068870_10042575 3300005840 Bacteria 2365
125 Ga0068870_10046937 3300005840 Bacteria 2267
126 Ga0068870_10903483 3300005840 Bacteria 624
127 Ga0068863_100283781 3300005841 Bacteria 1605
128 Ga0068858_100252898 3300005842 Bacteria 1674
129 Ga0068860_101167552 3300005843 Bacteria 790
130 Ga0068862_100834738 3300005844 Bacteria 902
131 Ga0081455_10112018 3300005937 Bacteria 2167
132 Ga0081539_10008187 3300005985 Bacteria 9210
133 Ga0075365_10004495 3300006038 Bacteria 7401
134 Ga0075364_10407315 3300006051 Bacteria 928
135 Ga0075432_10008792 3300006058 Bacteria 3446
136 Ga0075432_10091322 3300006058 Bacteria 1115
137 Ga0070716_100012961 3300006173 Bacteria 4237
138 Ga0070712_100066600 3300006175 Bacteria 2561
139 Ga0097621_100222357 3300006237 Bacteria 1646
140 Ga0075428_100095345 3300006844 Bacteria 3243
141 Ga0075434_100117989 3300006871 Bacteria 2667
142 Ga0075434_100954385 3300006871 Bacteria 872
143 Ga0075429_100379485 3300006880 Bacteria 1238
144 Ga0068865_100040862 3300006881 Bacteria 3154
145 Ga0068865_100156496 3300006881 Bacteria 1734
146 Ga0068865_101649092 3300006881 Unclassified 577
147 Ga0068865_101763197 3300006881 Bacteria 559
148 Ga0068865_101880842 3300006881 Bacteria 542
149 Ga0075436_100085700 3300006914 Bacteria 2187
150 Ga0075436_101487649 3300006914 Unclassified 514
151 Ga0097620_101802924 3300006931 Bacteria 676
152 Ga0111539_10011213 3300009094 Bacteria 11263
153 Ga0111539_10283183 3300009094 Bacteria 1929
154 Ga0111539_10524883 3300009094 Bacteria 1379
155 Ga0105245_10473155 3300009098 Bacteria 1265
156 Ga0105245_10757388 3300009098 Unclassified 1007
157 Ga0105245_11023930 3300009098 Bacteria 871
158 Ga0105247_10936644 3300009101 Bacteria 672
159 Ga0114129_10027609 3300009147 Bacteria 8037
160 Ga0114129_10134416 3300009147 Bacteria 3395
161 Ga0114129_10841697 3300009147 Bacteria 1167
162 Ga0114129_11676662 3300009147 Bacteria 776
163 Ga0105243_10051179 3300009148 Bacteria 3266
164 Ga0105243_10452012 3300009148 Bacteria 1206
165 Ga0105243_10522703 3300009148 Unclassified 1129
166 Ga0105243_10661113 3300009148 Bacteria 1014
167 Ga0105243_12584084 3300009148 Bacteria 547
168 Ga0105241_10530962 3300009174 Bacteria 1053
169 Ga0105241_10916688 3300009174 Bacteria 815
170 Ga0105242_10055635 3300009176 Bacteria 3237
171 Ga0105242_10245388 3300009176 Bacteria 1611
172 Ga0105242_10847092 3300009176 Bacteria 909
173 Ga0105242_11090790 3300009176 Bacteria 812
174 Ga0105242_11169269 3300009176 Bacteria 787
175 Ga0105242_11446652 3300009176 Bacteria 716
176 Ga0105248_10063877 3300009177 Bacteria 4133
177 Ga0105248_12322671 3300009177 Unclassified 611
178 Ga0105249_10662831 3300009553 Bacteria 1102
179 Ga0105249_10711357 3300009553 Unclassified 1065
180 Ga0105249_11066686 3300009553 Bacteria 877
181 Ga0105249_11269692 3300009553 Bacteria 808
182 Ga0105239_10118991 3300010375 Bacteria 2931
183 Ga0105239_12123842 3300010375 Unclassified 653
184 Ga0105246_10142261 3300011119 Bacteria 1805
185 Ga0105246_10477844 3300011119 Bacteria 1054
186 Ga0105246_10525042 3300011119 Bacteria 1010
187 Ga0105246_11302638 3300011119 Bacteria 673
188 Ga0157318_1027376 3300012482 Unclassified 544
189 Ga0157314_1022845 3300012500 Bacteria 651
190 Ga0157342_1029737 3300012507 Bacteria 682
191 Ga0157371_10283855 3300013102 Bacteria 1196
192 Ga0157371_10668859 3300013102 Bacteria 776
193 Ga0157370_10323588 3300013104 Unclassified 1422
194 Ga0157370_11563448 3300013104 Unclassified 593
195 Ga0157369_10004549 3300013105 Bacteria 16311
196 Ga0157369_10056069 3300013105 Bacteria 4252
197 Ga0157374_10293962 3300013296 Bacteria 1606
198 Ga0157374_11331583 3300013296 Bacteria 740
199 Ga0157374_11456781 3300013296 Bacteria 708
200 Ga0157378_10683606 3300013297 Bacteria 1044
201 Ga0157378_11987072 3300013297 Archaea 631
202 Ga0163162_10076214 3300013306 Bacteria 3415
203 Ga0163162_10268243 3300013306 Bacteria 1838
204 Ga0157372_10063916 3300013307 Bacteria 4129
205 Ga0157372_10948250 3300013307 Bacteria 997
206 Ga0157372_11139914 3300013307 Bacteria 902
207 Ga0157372_11263990 3300013307 Bacteria 852
208 Ga0157375_10166266 3300013308 Bacteria 2351
209 Ga0157375_10212152 3300013308 Bacteria 2094
210 Ga0163163_11682465 3300014325 Bacteria 695
211 Ga0163163_12593427 3300014325 Unclassified 564
212 Ga0157380_10009357 3300014326 Bacteria 7017
213 Ga0157380_10014384 3300014326 Bacteria 5788
214 Ga0157380_10815392 3300014326 Bacteria 952
215 Ga0157380_11783033 3300014326 Unclassified 674
216 Ga0157380_12864491 3300014326 Archaea 549
217 Ga0182008_10534135 3300014497 Bacteria 649
218 Ga0157377_10036768 3300014745 Bacteria 2695
219 Ga0157377_10065412 3300014745 Bacteria 2089
220 Ga0157377_10225857 3300014745 Bacteria 1201
221 Ga0157377_10416994 3300014745 Bacteria 918
222 Ga0157379_10059249 3300014968 Bacteria 3423
223 Ga0157379_10618135 3300014968 Bacteria 1012
224 Ga0157376_10011069 3300014969 Bacteria 6634
225 Ga0157376_10751668 3300014969 Bacteria 984
226 Ga0206356_10337727 3300020070 Bacteria 1324
227 Ga0206356_10987038 3300020070 Unclassified 518
228 Ga0206354_10925432 3300020081 Bacteria 702
229 Ga0207692_10396434 3300025898 Bacteria 860
230 Ga0207642_10109404 3300025899 Bacteria 1404
231 Ga0207688_10082311 3300025901 Bacteria 1839
232 Ga0207688_10314590 3300025901 Bacteria 959
233 Ga0207645_10106904 3300025907 Bacteria 1809
234 Ga0207643_10048876 3300025908 Bacteria 2397
235 Ga0207643_10099933 3300025908 Bacteria 1701
236 Ga0207643_10315890 3300025908 Bacteria 975
237 Ga0207643_10383955 3300025908 Bacteria 886
238 Ga0207654_10357367 3300025911 Bacteria 1007
239 Ga0207707_10164718 3300025912 Bacteria 1938
240 Ga0207707_10269760 3300025912 Bacteria 1475
241 Ga0207695_11149408 3300025913 Bacteria 656
242 Ga0207693_10116249 3300025915 Bacteria 2100
243 Ga0207663_10565583 3300025916 Bacteria 890
244 Ga0207660_10139519 3300025917 Bacteria 1852
245 Ga0207660_10454504 3300025917 Bacteria 1036
246 Ga0207657_10047738 3300025919 Bacteria 3741
247 Ga0207657_10147329 3300025919 Bacteria 1919
248 Ga0207657_10177108 3300025919 Bacteria 1725
249 Ga0207657_10272334 3300025919 Bacteria 1346
250 Ga0207657_10626949 3300025919 Bacteria 838
251 Ga0207649_11082460 3300025920 Bacteria 632
252 Ga0207652_10089103 3300025921 Bacteria 2708
253 Ga0207652_10406523 3300025921 Bacteria 1228
254 Ga0207652_10409861 3300025921 Bacteria 1223
255 Ga0207646_10456526 3300025922 Bacteria 1153
256 Ga0207681_10755500 3300025923 Bacteria 811
257 Ga0207681_11866587 3300025923 Unclassified 501
258 Ga0207659_10204840 3300025926 Bacteria 1578
259 Ga0207659_10354915 3300025926 Bacteria 1217
260 Ga0207687_10513648 3300025927 Unclassified 1001
261 Ga0207687_10705818 3300025927 Bacteria 856
262 Ga0207700_10000006 3300025928 Bacteria 348187
263 Ga0207644_10206030 3300025931 Bacteria 1553
264 Ga0207644_11517435 3300025931 Unclassified 562
265 Ga0207690_10027695 3300025932 Bacteria 3583
266 Ga0207706_10067204 3300025933 Bacteria 3154
267 Ga0207706_10176428 3300025933 Bacteria 1877
268 Ga0207706_10681610 3300025933 Bacteria 879
269 Ga0207686_10052235 3300025934 Bacteria 2550
270 Ga0207709_10028429 3300025935 Bacteria 3232
271 Ga0207709_10121913 3300025935 Bacteria 1762
272 Ga0207709_10474822 3300025935 Bacteria 971
273 Ga0207709_10597028 3300025935 Bacteria 874
274 Ga0207709_11015213 3300025935 Bacteria 678
275 Ga0207670_10223721 3300025936 Bacteria 1442
276 Ga0207669_10052222 3300025937 Bacteria 2454
277 Ga0207669_10230860 3300025937 Bacteria 1365
278 Ga0207704_10071347 3300025938 Bacteria 2204
279 Ga0207704_10258097 3300025938 Bacteria 1312
280 Ga0207704_10749398 3300025938 Bacteria 812
281 Ga0207704_11553473 3300025938 Bacteria 568
282 Ga0207665_10009408 3300025939 Bacteria 6410
283 Ga0207691_10032006 3300025940 Bacteria 4907
284 Ga0207691_10126179 3300025940 Bacteria 2264
285 Ga0207711_10288652 3300025941 Bacteria 1512
286 Ga0207661_10000195 3300025944 Bacteria 39367
287 Ga0207661_10132376 3300025944 Bacteria 2138
288 Ga0207661_10132391 3300025944 Bacteria 2138
289 Ga0207661_10402788 3300025944 Bacteria 1241
290 Ga0207679_10174086 3300025945 Bacteria 1775
291 Ga0207679_10201910 3300025945 Bacteria 1661
292 Ga0207679_11623411 3300025945 Bacteria 592
293 Ga0207651_10290833 3300025960 Bacteria 1355
294 Ga0207651_11311544 3300025960 Bacteria 651
295 Ga0207712_10100461 3300025961 Bacteria 2149
296 Ga0207668_11116554 3300025972 Bacteria 707
297 Ga0207640_10200612 3300025981 Bacteria 1512
298 Ga0207640_10217462 3300025981 Bacteria 1460
299 Ga0207640_11279155 3300025981 Bacteria 654
300 Ga0207658_10775129 3300025986 Bacteria 870
301 Ga0207658_11415950 3300025986 Unclassified 636
302 Ga0207658_11549549 3300025986 Bacteria 606
303 Ga0207703_10084383 3300026035 Bacteria 2656
304 Ga0207703_11982084 3300026035 Bacteria 558
305 Ga0207639_10199638 3300026041 Bacteria 1714
306 Ga0207639_10626080 3300026041 Bacteria 994
307 Ga0207708_10036807 3300026075 Bacteria 3727
308 Ga0207708_10037363 3300026075 Bacteria 3700
309 Ga0207708_10126477 3300026075 Bacteria 1995
310 Ga0207708_10566230 3300026075 Bacteria 959
311 Ga0207702_10067403 3300026078 Bacteria 3071
312 Ga0207641_10155001 3300026088 Bacteria 2078
313 Ga0207648_10145206 3300026089 Bacteria 2093
314 Ga0207648_10171921 3300026089 Bacteria 1915
315 Ga0207648_10603383 3300026089 Bacteria 1012
316 Ga0207676_11668208 3300026095 Bacteria 636
317 Ga0207674_10050279 3300026116 Bacteria 4260
318 Ga0207675_100182000 3300026118 Bacteria 2013
319 Ga0207675_100497215 3300026118 Bacteria 1213
320 Ga0207683_10111519 3300026121 Bacteria 2449
321 Ga0207683_10131171 3300026121 Bacteria 2254
322 Ga0207683_10569261 3300026121 Bacteria 1048
323 Ga0207683_11152061 3300026121 Unclassified 719
324 Ga0207698_10234177 3300026142 Bacteria 1669
325 Ga0207698_10975135 3300026142 Bacteria 857
326 Ga0207698_11107974 3300026142 Bacteria 804
327 Ga0207428_10000347 3300027907 Bacteria 60088
328 Ga0207428_10018875 3300027907 Bacteria 5883
329 Ga0207428_10197443 3300027907 Bacteria 1514
330 Ga0268266_10232639 3300028379 Bacteria 1698
331 Ga0268266_10920355 3300028379 Bacteria 846
332 Ga0268265_10334927 3300028380 Bacteria 1376
333 Ga0265318_10111308 3300028577 Bacteria 1007
334 Ga0307408_100057459 3300031548 Bacteria 2825
335 Ga0307408_102148514 3300031548 Bacteria 539
336 Ga0307406_10114696 3300031901 Bacteria 1861
337 Ga0307407_10240664 3300031903 Bacteria 1234
338 Ga0307409_100136116 3300031995 Bacteria 2108
339 Ga0307409_100381273 3300031995 Bacteria 1340
340 Ga0307409_100592111 3300031995 Bacteria 1095
341 Ga0307409_100705416 3300031995 Bacteria 1009
342 Ga0307416_100059089 3300032002 Bacteria 3113
343 Ga0307411_11650905 3300032005 Bacteria 592
344 Ga0307415_100040810 3300032126 Bacteria 3077
345 Ga0373930_0022657 3300034816 Bacteria 1244
346 Ga0373951_0088814 3300035091 Bacteria 809
347 Ga0373936_0127498 3300035113 Bacteria 1091
348 Ga0373961_0383482 3300035241 Bacteria 536
349 Ga0373962_0078541 3300035242 Bacteria 998
350 Ga0373935_0547880 3300035692 Bacteria 843
351 Ga0373937_1590578 3300036401 Bacteria 601
352 Ga0395900_0028070 3300037418 Bacteria 5763
353 Ga0395900_0990826 3300037418 Bacteria 761
354 Ga0395900_1307239 3300037418 Bacteria 639
355 Ga0395900_1738453 3300037418 Unclassified 534
356 Ga0395898_0146956 3300037466 Bacteria 2256
357 Ga0395905_0253955 3300037471 Bacteria 1642
358 Ga0395905_1106925 3300037471 Bacteria 695
359 Ga0436364_1388914 3300037853 Bacteria 2069
360 Ga0395901_0008731 3300038443 Bacteria 10243
361 Ga0395901_1301244 3300038443 Unclassified 689
362 Ga0395901_1958092 3300038443 Unclassified 533
363 Ga0451787_836238 3300041441 Bacteria 720
364 Ga0451789_0282479 3300041443 Bacteria 537
365 Ga0451793_1021080 3300041452 Bacteria 876
366 Ga0451795_1297375 3300041456 Bacteria 583
367 Ga0451798_1053374 3300041458 Bacteria 561
368 Ga0451807_0642193 3300041486 Bacteria 1097
369 Ga0451841_0690923 3300041498 Unclassified 605
370 Ga0451853_0331193 3300041512 Bacteria 1167
371 Ga0450920_050255 3300042122 Bacteria 836
372 Ga0450923_141576 3300042125 Unclassified 578
373 Ga0450906_040656 3300042145 Bacteria 821
374 Ga0450916_025829 3300042530 Bacteria 832
375 Ga0466967_0809479 3300045976 Bacteria 930
376 Ga0495603_0748075 3300046455 Unclassified 558
377 Ga0495596_0259894 3300046500 Bacteria 674
378 Ga0495631_0317431 3300046518 Bacteria 663
379 Ga0495644_0097455 3300046523 Unclassified 1112
380 Ga0495645_0075880 3300046543 Bacteria 2420
381 Ga0495656_0369702 3300046615 Unclassified 746
382 Ga0495588_0367586 3300046674 Bacteria 756
383 Ga0495671_0165075 3300046692 Bacteria 1077
384 Ga0495674_0095162 3300047319 Bacteria 2540
385 Ga0495684_0409343 3300047471 Bacteria 950
386 Ga0495602_1012835 3300048088 Unclassified 548
387 Ga0496101_0052675 3300048904 Bacteria 2935
388 Ga0496101_0376920 3300048904 Bacteria 1116
389 Ga0496101_0428588 3300048904 Bacteria 1043
390 Ga0496101_0882620 3300048904 Bacteria 704
391 Ga0496102_1038933 3300048905 Unclassified 740
392 Ga0496102_1463233 3300048905 Bacteria 602
393 Ga0496104_0185346 3300048907 Bacteria 1992
394 Ga0496104_0566451 3300048907 Bacteria 1047
395 Ga0496104_1405469 3300048907 Bacteria 601
396 Ga0496105_0143485 3300048908 Bacteria 1964
397 Ga0496106_0481007 3300048909 Bacteria 998
398 Ga0496107_0133748 3300048910 Bacteria 1832
399 Ga0496109_0084476 3300048912 Bacteria 2929
400 Ga0496109_0222882 3300048912 Bacteria 1773
401 Ga0496109_0412746 3300048912 Bacteria 1276
402 Ga0496109_0740290 3300048912 Bacteria 921
403 Ga0496110_0005043 3300048913 Bacteria 10320
404 Ga0496110_0037271 3300048913 Bacteria 4226
405 Ga0496110_0045937 3300048913 Bacteria 3819
406 Ga0496111_0018768 3300048914 Bacteria 4793
407 Ga0496112_0297820 3300048915 Bacteria 1559
408 Ga0496114_0016056 3300048917 Bacteria 6025
409 Ga0496114_0224700 3300048917 Bacteria 1649
410 Ga0496115_0006661 3300048918 Bacteria 8478
411 Ga0501318_085114 3300049534 Bacteria 517
412 Ga0501031_0006478 3300049568 Bacteria 7635
413 Ga0501031_0296750 3300049568 Bacteria 1047
414 Ga0501033_0026188 3300049570 Bacteria 4390
415 Ga0501033_0128652 3300049570 Bacteria 1835
416 Ga0501033_1065857 3300049570 Bacteria 538
417 Ga0501034_0095405 3300049571 Bacteria 2971
418 Ga0501036_0015228 3300049572 Bacteria 6421
419 Ga0501036_0049818 3300049572 Bacteria 3547
420 Ga0501036_0074289 3300049572 Bacteria 2875
421 Ga0501036_0806143 3300049572 Bacteria 773
422 Ga0501036_1087804 3300049572 Bacteria 653
423 Ga0501036_1191443 3300049572 Bacteria 621
424 Ga0501036_1412940 3300049572 Unclassified 564
425 Ga0501037_0007236 3300049573 Bacteria 8109
426 Ga0501037_0217328 3300049573 Bacteria 1346
427 Ga0501038_0006673 3300049574 Bacteria 10667
428 Ga0501038_0046218 3300049574 Bacteria 3775
429 Ga0501038_0298409 3300049574 Bacteria 1265
430 Ga0501038_1368334 3300049574 Bacteria 509
431 Ga0501039_0012221 3300049575 Bacteria 6544
432 Ga0501039_0024217 3300049575 Bacteria 4661
433 Ga0501039_0024633 3300049575 Bacteria 4622
434 Ga0501039_0459675 3300049575 Bacteria 1000
435 Ga0501039_0816267 3300049575 Unclassified 727
436 Ga0501039_1516895 3300049575 Bacteria 515
437 Ga0501040_0001032 3300049576 Bacteria 17675
438 Ga0501040_0036261 3300049576 Bacteria 3345
439 Ga0501040_0041243 3300049576 Bacteria 3143
440 Ga0501040_0043759 3300049576 Bacteria 3052
441 Ga0501040_0056301 3300049576 Bacteria 2698
442 Ga0501040_0562501 3300049576 Bacteria 823
443 Ga0501040_0966352 3300049576 Archaea 617
444 Ga0501040_1203563 3300049576 Bacteria 550
445 Ga0501041_0006455 3300049577 Bacteria 6864
446 Ga0501041_0012313 3300049577 Bacteria 5067
447 Ga0501041_0013838 3300049577 Bacteria 4783
448 Ga0501041_0075071 3300049577 Bacteria 2078
449 Ga0501042_0030920 3300049578 Bacteria 3786
450 Ga0501042_0146339 3300049578 Bacteria 1703
451 Ga0501042_0493313 3300049578 Bacteria 889
452 Ga0501042_0642142 3300049578 Bacteria 771
453 Ga0501042_0679884 3300049578 Bacteria 748
454 Ga0501042_0691711 3300049578 Unclassified 741
455 Ga0501043_0008677 3300049579 Bacteria 7997
456 Ga0501043_0049789 3300049579 Bacteria 3294
457 Ga0501043_0329433 3300049579 Bacteria 1163
458 Ga0501046_0006951 3300049580 Bacteria 9972
459 Ga0501046_0101600 3300049580 Bacteria 2205
460 Ga0501046_0436780 3300049580 Unclassified 942
461 Ga0501048_0007213 3300049582 Bacteria 8438
462 Ga0501048_0010941 3300049582 Bacteria 6768
463 Ga0501048_0040808 3300049582 Bacteria 3324
464 Ga0501048_0261654 3300049582 Bacteria 1229
465 Ga0501048_0320516 3300049582 Bacteria 1104
466 Ga0501048_0391533 3300049582 Bacteria 993
467 Ga0501048_0805073 3300049582 Bacteria 675
468 Ga0501067_0032195 3300049583 Bacteria 2910
469 Ga0501068_0002153 3300049584 Bacteria 10487
470 Ga0501068_0017310 3300049584 Bacteria 4167
471 Ga0501068_0566274 3300049584 Bacteria 739
472 Ga0501068_0572216 3300049584 Bacteria 735
473 Ga0501069_0003622 3300049585 Bacteria 7958
474 Ga0501069_0010454 3300049585 Bacteria 4912
475 Ga0501069_0196497 3300049585 Bacteria 1168
476 Ga0501069_0303279 3300049585 Unclassified 937
477 Ga0501069_0319122 3300049585 Bacteria 913
478 Ga0501070_0007931 3300049586 Bacteria 8995
479 Ga0501070_0045621 3300049586 Bacteria 3645
480 Ga0501071_0000475 3300049587 Bacteria 20283
481 Ga0501071_0021991 3300049587 Bacteria 4444
482 Ga0501071_0057648 3300049587 Bacteria 2807
483 Ga0501071_0099702 3300049587 Bacteria 2140
484 Ga0501071_0695030 3300049587 Bacteria 783
485 Ga0501071_0827324 3300049587 Bacteria 714
486 Ga0501072_0009901 3300049588 Bacteria 7249
487 Ga0501072_0013812 3300049588 Bacteria 6185
488 Ga0501072_0032596 3300049588 Bacteria 4080
489 Ga0501072_0061978 3300049588 Bacteria 2950
490 Ga0501072_0169983 3300049588 Bacteria 1739
491 Ga0501072_0451138 3300049588 Bacteria 1018
492 Ga0501072_0501193 3300049588 Bacteria 960
493 Ga0501072_0666183 3300049588 Bacteria 819
494 Ga0501073_0003649 3300049589 Bacteria 11577
495 Ga0501073_0073229 3300049589 Bacteria 2385
496 Ga0501074_0009576 3300049590 Bacteria 7032
497 Ga0501074_0201444 3300049590 Bacteria 1419
498 Ga0501074_0543596 3300049590 Bacteria 822
499 Ga0501074_0807588 3300049590 Bacteria 661
500 Ga0501074_1335522 3300049590 Unclassified 502
501 Ga0501075_0014990 3300049591 Bacteria 5560
502 Ga0501075_0015564 3300049591 Bacteria 5459
503 Ga0501075_0026321 3300049591 Bacteria 4281
504 Ga0501075_0045790 3300049591 Bacteria 3284
505 Ga0501075_0097710 3300049591 Bacteria 2228
506 Ga0501075_0434180 3300049591 Bacteria 1001
507 Ga0501075_0666997 3300049591 Bacteria 793
508 Ga0501075_0988158 3300049591 Bacteria 640
509 Ga0501076_0007063 3300049592 Bacteria 8160
510 Ga0501076_0014343 3300049592 Bacteria 5967
511 Ga0501076_0016284 3300049592 Bacteria 5635
512 Ga0501076_0036495 3300049592 Bacteria 3851
513 Ga0501076_0039496 3300049592 Bacteria 3705
514 Ga0501076_0046363 3300049592 Bacteria 3435
515 Ga0501076_0416949 3300049592 Bacteria 1104
516 Ga0501077_0004460 3300049593 Bacteria 8503
517 Ga0501077_0024769 3300049593 Bacteria 3810
518 Ga0501077_0042600 3300049593 Bacteria 2886
519 Ga0501077_0080458 3300049593 Bacteria 2064
520 Ga0501077_0199741 3300049593 Bacteria 1270
521 Ga0501077_0280215 3300049593 Bacteria 1061
522 Ga0501077_0564522 3300049593 Bacteria 730
523 Ga0501079_0001658 3300049741 Bacteria 15848
524 Ga0501079_0013048 3300049741 Bacteria 6337
525 Ga0501079_0183859 3300049741 Bacteria 1631
526 Ga0501079_0289259 3300049741 Bacteria 1281
527 Ga0501079_0324513 3300049741 Bacteria 1205
528 Ga0501079_0473840 3300049741 Bacteria 984
529 Ga0501080_0014524 3300049742 Bacteria 7252
530 Ga0501080_0073657 3300049742 Bacteria 3177
531 Ga0501080_0085789 3300049742 Bacteria 2925
532 Ga0501081_0009173 3300049743 Bacteria 6440
533 Ga0501081_0034794 3300049743 Bacteria 3428
534 Ga0501081_0055124 3300049743 Bacteria 2746
535 Ga0501081_0126084 3300049743 Bacteria 1826
536 Ga0501081_0303779 3300049743 Bacteria 1171
537 Ga0501081_0952877 3300049743 Bacteria 648
538 Ga0501081_1111285 3300049743 Bacteria 598
539 Ga0501081_1431884 3300049743 Bacteria 524
540 Ga0501083_0001456 3300049744 Bacteria 16156
541 Ga0501035_0002844 3300049822 Bacteria 16723
542 Ga0501035_0052294 3300049822 Bacteria 3655
543 Ga0501035_0483018 3300049822 Bacteria 1022
544 Ga0501044_0010334 3300049823 Bacteria 10134
545 Ga0501044_0141848 3300049823 Bacteria 2391
546 Ga0501045_0009374 3300049824 Bacteria 6845
547 Ga0501045_0019818 3300049824 Bacteria 4800
548 Ga0501045_0115667 3300049824 Bacteria 1989
549 Ga0501045_0239830 3300049824 Unclassified 1350
550 Ga0501045_0472610 3300049824 Bacteria 932
551 Ga0501045_1357471 3300049824 Unclassified 517
552 nmdc:mga03n38_748915_c1 3300050490 Bacteria 566
553 nmdc:mga00v17_416613_c1 3300050491 Bacteria 872
554 nmdc:mga0yw44_499485_c1 3300050492 Bacteria 825
555 nmdc:mga05p37_1913531_c1 3300050507 Bacteria 566
556 nmdc:mga05p37_197977_c1 3300050507 Bacteria 2435
557 nmdc:mga09592_384894_c1 3300050508 Bacteria 1213
558 nmdc:mga08y16_104609_c1 3300050511 Bacteria 2947
559 nmdc:mga08y16_150686_c1 3300050511 Unclassified 2418
560 nmdc:mga08y16_276269_c1 3300050511 Bacteria 1733
561 nmdc:mga08y16_9181_c1 3300050511 Bacteria 10379
562 nmdc:mga0n895_103708_c1 3300050512 Bacteria 2855
563 nmdc:mga08x19_297547_c1 3300050514 Bacteria 1120
564 nmdc:mga0a205_512326_c1 3300050515 Bacteria 1056
565 Ga0495601_0278219 3300053077 Unclassified 1091
566 Ga0495612_0050748 3300053078 Bacteria 1704
567 Ga0495595_0040592 3300053084 Bacteria 2127
568 Ga0501084_0003680 3300054114 Bacteria 12444
569 Ga0501084_0034628 3300054114 Bacteria 4221
570 Ga0501084_0041210 3300054114 Bacteria 3862
571 Ga0501084_0049410 3300054114 Bacteria 3521
572 Ga0501084_0070659 3300054114 Bacteria 2922
573 Ga0501084_1618567 3300054114 Bacteria 541
574 Ga0590077_019452 3300059426 Bacteria 1439
575 Ga0501082_0017668 3300060353 Bacteria 6142
576 Ga0501082_0033954 3300060353 Bacteria 4400
577 Ga0501082_0058604 3300060353 Bacteria 3318
578 Ga0501082_0064571 3300060353 Bacteria 3152
579 Ga0501082_0318598 3300060353 Bacteria 1355
580 Ga0501082_0379466 3300060353 Bacteria 1233
581 Ga0501082_1375538 3300060353 Unclassified 617
582 Ga0530510_0034439 3300061734 Bacteria 3648
583 Ga0530510_0125135 3300061734 Bacteria 1889
584 Ga0530510_0201529 3300061734 Bacteria 1478
585 Ga0530510_0285862 3300061734 Bacteria 1232
586 Ga0530510_0669655 3300061734 Bacteria 790
587 Ga0081539_10001017
588 JGI25406J46586_10011093
589 JGI25406J46586_10042629
590 Ga0070676_10383789
591 Ga0070683_100059463
592 Ga0070683_100326526
593 Ga0070690_100492298
594 Ga0070670_101276341
595 Ga0070677_10874232
596 Ga0070680_100287096
597 Ga0070682_100049358
598 Ga0070682_101202738
599 Ga0070682_101627512
600 Ga0068868_100220995
601 Ga0068868_100334605
602 Ga0070660_100308239
603 Ga0070660_100481162
604 Ga0070660_100720729
605 Ga0070660_100800383
606 Ga0070689_100222090
607 Ga0070691_10482149
608 Ga0070691_10725305
609 Ga0070691_10788149
610 Ga0070661_100236592
611 Ga0070661_101057937
612 Ga0070692_10127002
613 Ga0070692_10128016
614 Ga0070692_10143624
615 Ga0070668_100065977
616 Ga0070668_100680706
617 Ga0070675_100192293
618 Ga0070675_100215382
619 Ga0070675_100536411
620 Ga0070675_101074363
621 Ga0070671_100438447
622 Ga0070671_101482762
623 Ga0070674_100069453
624 Ga0070674_100197626
625 Ga0070673_100256927
626 Ga0070673_102251304
627 Ga0070659_100078574
628 Ga0070659_100331940
629 Ga0070659_100989762
630 Ga0070659_101431594
631 Ga0070667_101546948
632 Ga0070713_100009909
633 Ga0070710_10720728
634 Ga0070710_11383552
635 Ga0070701_10069500
636 Ga0070701_11303707
637 Ga0070700_100076594
638 Ga0070700_100098380
639 Ga0070700_100109556
640 Ga0070700_101042532
641 Ga0070700_101236986
642 Ga0070694_100488492
643 Ga0070694_100546218
644 Ga0070663_101696309
645 Ga0070678_100269994
646 Ga0070678_100713233
647 Ga0070678_101791254
648 Ga0070662_100034319
649 Ga0070662_100175005
650 Ga0070662_100890280
651 Ga0070681_10007637
652 Ga0070681_10769085
653 Ga0068867_100710751
654 Ga0068867_102301645
655 Ga0070685_10453512
656 Ga0070698_100187110
657 Ga0070699_100204464
658 Ga0070699_101300805
659 Ga0070679_100005464
660 Ga0070679_100031114
661 Ga0070679_100276607
662 Ga0070679_100460319
663 Ga0070684_100039838
664 Ga0070684_100064100
665 Ga0070684_100072855
666 Ga0070684_100088721
667 Ga0070684_100165294
668 Ga0070684_100707938
669 Ga0070684_100850845
670 Ga0070684_101032607
671 Ga0070697_101708404
672 Ga0068853_100094144
673 Ga0068853_100830772
674 Ga0068853_100986328
675 Ga0070672_100016293
676 Ga0070672_100120379
677 Ga0070672_100121346
678 Ga0070672_100409754
679 Ga0070672_100673247
680 Ga0070695_100726962
681 Ga0070695_101534947
682 Ga0070696_100462408
683 Ga0070696_100696324
684 Ga0070693_100080056
685 Ga0070693_100344035
686 Ga0070665_100136175
687 Ga0070665_102039098
688 Ga0070704_100453149
689 Ga0070704_101233635
690 Ga0070704_101642790
691 Ga0068855_100583166
692 Ga0070664_100042644
693 Ga0070664_101002228
694 Ga0070664_101973563
695 Ga0068857_100115767
696 Ga0068857_100368812
697 Ga0068854_100403397
698 Ga0068854_100902642
699 Ga0068854_101274243
700 Ga0068856_100566152
701 Ga0070702_100700194
702 Ga0070702_101879023
703 Ga0068852_100359027
704 Ga0068852_100787332
705 Ga0068859_101802210
706 Ga0068864_101334697
707 Ga0068866_10055092
708 Ga0068861_100388735
709 Ga0068861_100839820
710 Ga0068870_10042575
711 Ga0068870_10046937
712 Ga0068870_10903483
713 Ga0068863_100283781
714 Ga0068858_100252898
715 Ga0068860_101167552
716 Ga0068862_100834738
717 Ga0081455_10112018
718 Ga0081539_10008187
719 Ga0075365_10004495
720 Ga0075364_10407315
721 Ga0075432_10008792
722 Ga0075432_10091322
723 Ga0070716_100012961
724 Ga0070712_100066600
725 Ga0097621_100222357
726 Ga0075428_100095345
727 Ga0075434_100117989
728 Ga0075434_100954385
729 Ga0075429_100379485
730 Ga0068865_100040862
731 Ga0068865_100156496
732 Ga0068865_101649092
733 Ga0068865_101763197
734 Ga0068865_101880842
735 Ga0075436_100085700
736 Ga0075436_101487649
737 Ga0097620_101802924
738 Ga0111539_10011213
739 Ga0111539_10283183
740 Ga0111539_10524883
741 Ga0105245_10473155
742 Ga0105245_10757388
743 Ga0105245_11023930
744 Ga0105247_10936644
745 Ga0114129_10027609
746 Ga0114129_10134416
747 Ga0114129_10841697
748 Ga0114129_11676662
749 Ga0105243_10051179
750 Ga0105243_10452012
751 Ga0105243_10522703
752 Ga0105243_10661113
753 Ga0105243_12584084
754 Ga0105241_10530962
755 Ga0105241_10916688
756 Ga0105242_10055635
757 Ga0105242_10245388
758 Ga0105242_10847092
759 Ga0105242_11090790
760 Ga0105242_11169269
761 Ga0105242_11446652
762 Ga0105248_10063877
763 Ga0105248_12322671
764 Ga0105249_10662831
765 Ga0105249_10711357
766 Ga0105249_11066686
767 Ga0105249_11269692
768 Ga0105239_10118991
769 Ga0105239_12123842
770 Ga0105246_10142261
771 Ga0105246_10477844
772 Ga0105246_10525042
773 Ga0105246_11302638
774 Ga0157318_1027376
775 Ga0157314_1022845
776 Ga0157342_1029737
777 Ga0157371_10283855
778 Ga0157371_10668859
779 Ga0157370_10323588
780 Ga0157370_11563448
781 Ga0157369_10004549
782 Ga0157369_10056069
783 Ga0157374_10293962
784 Ga0157374_11331583
785 Ga0157374_11456781
786 Ga0157378_10683606
787 Ga0157378_11987072
788 Ga0163162_10076214
789 Ga0163162_10268243
790 Ga0157372_10063916
791 Ga0157372_10948250
792 Ga0157372_11139914
793 Ga0157372_11263990
794 Ga0157375_10166266
795 Ga0157375_10212152
796 Ga0163163_11682465
797 Ga0163163_12593427
798 Ga0157380_10009357
799 Ga0157380_10014384
800 Ga0157380_10815392
801 Ga0157380_11783033
802 Ga0157380_12864491
803 Ga0182008_10534135
804 Ga0157377_10036768
805 Ga0157377_10065412
806 Ga0157377_10225857
807 Ga0157377_10416994
808 Ga0157379_10059249
809 Ga0157379_10618135
810 Ga0157376_10011069
811 Ga0157376_10751668
812 Ga0206356_10337727
813 Ga0206356_10987038
814 Ga0206354_10925432
815 Ga0207692_10396434
816 Ga0207642_10109404
817 Ga0207688_10082311
818 Ga0207688_10314590
819 Ga0207645_10106904
820 Ga0207643_10048876
821 Ga0207643_10099933
822 Ga0207643_10315890
823 Ga0207643_10383955
824 Ga0207654_10357367
825 Ga0207707_10164718
826 Ga0207707_10269760
827 Ga0207695_11149408
828 Ga0207693_10116249
829 Ga0207663_10565583
830 Ga0207660_10139519
831 Ga0207660_10454504
832 Ga0207657_10047738
833 Ga0207657_10147329
834 Ga0207657_10177108
835 Ga0207657_10272334
836 Ga0207657_10626949
837 Ga0207649_11082460
838 Ga0207652_10089103
839 Ga0207652_10406523
840 Ga0207652_10409861
841 Ga0207646_10456526
842 Ga0207681_10755500
843 Ga0207681_11866587
844 Ga0207659_10204840
845 Ga0207659_10354915
846 Ga0207687_10513648
847 Ga0207687_10705818
848 Ga0207700_10000006
849 Ga0207644_10206030
850 Ga0207644_11517435
851 Ga0207690_10027695
852 Ga0207706_10067204
853 Ga0207706_10176428
854 Ga0207706_10681610
855 Ga0207686_10052235
856 Ga0207709_10028429
857 Ga0207709_10121913
858 Ga0207709_10474822
859 Ga0207709_10597028
860 Ga0207709_11015213
861 Ga0207670_10223721
862 Ga0207669_10052222
863 Ga0207669_10230860
864 Ga0207704_10071347
865 Ga0207704_10258097
866 Ga0207704_10749398
867 Ga0207704_11553473
868 Ga0207665_10009408
869 Ga0207691_10032006
870 Ga0207691_10126179
871 Ga0207711_10288652
872 Ga0207661_10000195
873 Ga0207661_10132376
874 Ga0207661_10132391
875 Ga0207661_10402788
876 Ga0207679_10174086
877 Ga0207679_10201910
878 Ga0207679_11623411
879 Ga0207651_10290833
880 Ga0207651_11311544
881 Ga0207712_10100461
882 Ga0207668_11116554
883 Ga0207640_10200612
884 Ga0207640_10217462
885 Ga0207640_11279155
886 Ga0207658_10775129
887 Ga0207658_11415950
888 Ga0207658_11549549
889 Ga0207703_10084383
890 Ga0207703_11982084
891 Ga0207639_10199638
892 Ga0207639_10626080
893 Ga0207708_10036807
894 Ga0207708_10037363
895 Ga0207708_10126477
896 Ga0207708_10566230
897 Ga0207702_10067403
898 Ga0207641_10155001
899 Ga0207648_10145206
900 Ga0207648_10171921
901 Ga0207648_10603383
902 Ga0207676_11668208
903 Ga0207674_10050279
904 Ga0207675_100182000
905 Ga0207675_100497215
906 Ga0207683_10111519
907 Ga0207683_10131171
908 Ga0207683_10569261
909 Ga0207683_11152061
910 Ga0207698_10234177
911 Ga0207698_10975135
912 Ga0207698_11107974
913 Ga0207428_10000347
914 Ga0207428_10018875
915 Ga0207428_10197443
916 Ga0268266_10232639
917 Ga0268266_10920355
918 Ga0268265_10334927
919 Ga0265318_10111308
920 Ga0307408_100057459
921 Ga0307408_102148514
922 Ga0307406_10114696
923 Ga0307407_10240664
924 Ga0307409_100136116
925 Ga0307409_100381273
926 Ga0307409_100592111
927 Ga0307409_100705416
928 Ga0307416_100059089
929 Ga0307411_11650905
930 Ga0307415_100040810
931 Ga0373930_0022657
932 Ga0373951_0088814
933 Ga0373936_0127498
934 Ga0373961_0383482
935 Ga0373962_0078541
936 Ga0373935_0547880
937 Ga0373937_1590578
938 Ga0395900_0028070
939 Ga0395900_0990826
940 Ga0395900_1307239
941 Ga0395900_1738453
942 Ga0395898_0146956
943 Ga0395905_0253955
944 Ga0395905_1106925
945 Ga0436364_1388914
946 Ga0395901_0008731
947 Ga0395901_1301244
948 Ga0395901_1958092
949 Ga0451787_836238
950 Ga0451789_0282479
951 Ga0451793_1021080
952 Ga0451795_1297375
953 Ga0451798_1053374
954 Ga0451807_0642193
955 Ga0451841_0690923
956 Ga0451853_0331193
957 Ga0450920_050255
958 Ga0450923_141576
959 Ga0450906_040656
960 Ga0450916_025829
961 Ga0466967_0809479
962 Ga0495603_0748075
963 Ga0495596_0259894
964 Ga0495631_0317431
965 Ga0495644_0097455
966 Ga0495645_0075880
967 Ga0495656_0369702
968 Ga0495588_0367586
969 Ga0495671_0165075
970 Ga0495674_0095162
971 Ga0495684_0409343
972 Ga0495602_1012835
973 Ga0496101_0052675
974 Ga0496101_0376920
975 Ga0496101_0428588
976 Ga0496101_0882620
977 Ga0496102_1038933
978 Ga0496102_1463233
979 Ga0496104_0185346
980 Ga0496104_0566451
981 Ga0496104_1405469
982 Ga0496105_0143485
983 Ga0496106_0481007
984 Ga0496107_0133748
985 Ga0496109_0084476
986 Ga0496109_0222882
987 Ga0496109_0412746
988 Ga0496109_0740290
989 Ga0496110_0005043
990 Ga0496110_0037271
991 Ga0496110_0045937
992 Ga0496111_0018768
993 Ga0496112_0297820
994 Ga0496114_0016056
995 Ga0496114_0224700
996 Ga0496115_0006661
997 Ga0501318_085114
998 Ga0501031_0006478
999 Ga0501031_0296750
1000 Ga0501033_0026188
1001 Ga0501033_0128652
1002 Ga0501033_1065857
1003 Ga0501034_0095405
1004 Ga0501036_0015228
1005 Ga0501036_0049818
1006 Ga0501036_0074289
1007 Ga0501036_0806143
1008 Ga0501036_1087804
1009 Ga0501036_1191443
1010 Ga0501036_1412940
1011 Ga0501037_0007236
1012 Ga0501037_0217328
1013 Ga0501038_0006673
1014 Ga0501038_0046218
1015 Ga0501038_0298409
1016 Ga0501038_1368334
1017 Ga0501039_0012221
1018 Ga0501039_0024217
1019 Ga0501039_0024633
1020 Ga0501039_0459675
1021 Ga0501039_0816267
1022 Ga0501039_1516895
1023 Ga0501040_0001032
1024 Ga0501040_0036261
1025 Ga0501040_0041243
1026 Ga0501040_0043759
1027 Ga0501040_0056301
1028 Ga0501040_0562501
1029 Ga0501040_0966352
1030 Ga0501040_1203563
1031 Ga0501041_0006455
1032 Ga0501041_0012313
1033 Ga0501041_0013838
1034 Ga0501041_0075071
1035 Ga0501042_0030920
1036 Ga0501042_0146339
1037 Ga0501042_0493313
1038 Ga0501042_0642142
1039 Ga0501042_0679884
1040 Ga0501042_0691711
1041 Ga0501043_0008677
1042 Ga0501043_0049789
1043 Ga0501043_0329433
1044 Ga0501046_0006951
1045 Ga0501046_0101600
1046 Ga0501046_0436780
1047 Ga0501048_0007213
1048 Ga0501048_0010941
1049 Ga0501048_0040808
1050 Ga0501048_0261654
1051 Ga0501048_0320516
1052 Ga0501048_0391533
1053 Ga0501048_0805073
1054 Ga0501067_0032195
1055 Ga0501068_0002153
1056 Ga0501068_0017310
1057 Ga0501068_0566274
1058 Ga0501068_0572216
1059 Ga0501069_0003622
1060 Ga0501069_0010454
1061 Ga0501069_0196497
1062 Ga0501069_0303279
1063 Ga0501069_0319122
1064 Ga0501070_0007931
1065 Ga0501070_0045621
1066 Ga0501071_0000475
1067 Ga0501071_0021991
1068 Ga0501071_0057648
1069 Ga0501071_0099702
1070 Ga0501071_0695030
1071 Ga0501071_0827324
1072 Ga0501072_0009901
1073 Ga0501072_0013812
1074 Ga0501072_0032596
1075 Ga0501072_0061978
1076 Ga0501072_0169983
1077 Ga0501072_0451138
1078 Ga0501072_0501193
1079 Ga0501072_0666183
1080 Ga0501073_0003649
1081 Ga0501073_0073229
1082 Ga0501074_0009576
1083 Ga0501074_0201444
1084 Ga0501074_0543596
1085 Ga0501074_0807588
1086 Ga0501074_1335522
1087 Ga0501075_0014990
1088 Ga0501075_0015564
1089 Ga0501075_0026321
1090 Ga0501075_0045790
1091 Ga0501075_0097710
1092 Ga0501075_0434180
1093 Ga0501075_0666997
1094 Ga0501075_0988158
1095 Ga0501076_0007063
1096 Ga0501076_0014343
1097 Ga0501076_0016284
1098 Ga0501076_0036495
1099 Ga0501076_0039496
1100 Ga0501076_0046363
1101 Ga0501076_0416949
1102 Ga0501077_0004460
1103 Ga0501077_0024769
1104 Ga0501077_0042600
1105 Ga0501077_0080458
1106 Ga0501077_0199741
1107 Ga0501077_0280215
1108 Ga0501077_0564522
1109 Ga0501079_0001658
1110 Ga0501079_0013048
1111 Ga0501079_0183859
1112 Ga0501079_0289259
1113 Ga0501079_0324513
1114 Ga0501079_0473840
1115 Ga0501080_0014524
1116 Ga0501080_0073657
1117 Ga0501080_0085789
1118 Ga0501081_0009173
1119 Ga0501081_0034794
1120 Ga0501081_0055124
1121 Ga0501081_0126084
1122 Ga0501081_0303779
1123 Ga0501081_0952877
1124 Ga0501081_1111285
1125 Ga0501081_1431884
1126 Ga0501083_0001456
1127 Ga0501035_0002844
1128 Ga0501035_0052294
1129 Ga0501035_0483018
1130 Ga0501044_0010334
1131 Ga0501044_0141848
1132 Ga0501045_0009374
1133 Ga0501045_0019818
1134 Ga0501045_0115667
1135 Ga0501045_0239830
1136 Ga0501045_0472610
1137 Ga0501045_1357471
1138 nmdc:mga03n38_748915_c1
1139 nmdc:mga00v17_416613_c1
1140 nmdc:mga0yw44_499485_c1
1141 nmdc:mga05p37_1913531_c1
1142 nmdc:mga05p37_197977_c1
1143 nmdc:mga09592_384894_c1
1144 nmdc:mga08y16_104609_c1
1145 nmdc:mga08y16_150686_c1
1146 nmdc:mga08y16_276269_c1
1147 nmdc:mga08y16_9181_c1
1148 nmdc:mga0n895_103708_c1
1149 nmdc:mga08x19_297547_c1
1150 nmdc:mga0a205_512326_c1
1151 Ga0495601_0278219
1152 Ga0495612_0050748
1153 Ga0495595_0040592
1154 Ga0501084_0003680
1155 Ga0501084_0034628
1156 Ga0501084_0041210
1157 Ga0501084_0049410
1158 Ga0501084_0070659
1159 Ga0501084_1618567
1160 Ga0590077_019452
1161 Ga0501082_0017668
1162 Ga0501082_0033954
1163 Ga0501082_0058604
1164 Ga0501082_0064571
1165 Ga0501082_0318598
1166 Ga0501082_0379466
1167 Ga0501082_1375538
1168 Ga0530510_0034439
1169 Ga0530510_0125135
1170 Ga0530510_0201529
1171 Ga0530510_0285862
1172 Ga0530510_0669655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

20

107

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kd3-assembly1.cif.gz_B structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9343 12 100
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.9287 10 101
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.9261 12 100
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9242 12 100
7bzd-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, wild type 0.9179 12 100
ID Description Score Start End Superfamily
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9472 13 100 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9287 10 101 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9171 10 101 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8976 20 83 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.889 10 101 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1LI86-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9894 7 103 GO:0003677
AF-A0A4V3D825-F1-model_v4 HxlR family transcriptional regulator 0.9745 3 99 GO:0003677
AF-A0A7W0PX62-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9736 17 103 GO:0003677
AF-A0A538A986-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9714 2 97 GO:0003677
AF-A0A538DDA3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9705 1 100 GO:0003677

Map