F466526

General Info

Members Datasets Scaffolds Average Seq Length
586 286 1172 220

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100105921|Ga0068867_1001059213
Length 216
Sequence MQQIFGLNVPQTLEDICNRTRLALIVYDMQVGIVSQIKNGRHIVEKVIQVLNAARTAGIRVFFTRHMSLPKELMGVSQLRMAMAWQRAKADEVKPWFLRDTPGFHLVPEIEPLPSEAVFDKLAMSAFEGTPLDFALRDCGIDAFAIMGIALEIGIEPTIRHGSDLGYIPVLVEDACGFGRADAAARTVASLEFAGDALFTNVETITDQFHRLQRQA

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
193 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
213 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
214 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
215 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
216 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.58
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 24.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100105921 3300005459 Unclassified 2153
2 MBSR1b_contig_4113169 2162886012 Bacteria 1127
3 JGI24752J21851_1014974 3300001976 Bacteria 1011
4 JGI24747J21853_1013254 3300001978 Bacteria 849
5 JGI24743J22301_10007804 3300001991 Bacteria 1864
6 JGI24738J21930_10045783 3300002075 Unclassified 890
7 JGI24033J26618_1001242 3300002155 Unclassified 2499
8 JGI25405J52794_10000675 3300003911 Bacteria 5168
9 Ga0065704_10151714 3300005289 Unclassified 1424
10 Ga0065712_10214304 3300005290 Unclassified 1016
11 Ga0065712_10228497 3300005290 Unclassified 1019
12 Ga0065707_10003840 3300005295 Bacteria 5214
13 Ga0065707_10093443 3300005295 Plasmid 3624
14 Ga0070676_10121186 3300005328 Unclassified 1642
15 Ga0070676_10123839 3300005328 Bacteria 1626
16 Ga0070683_100061694 3300005329 Bacteria 3486
17 Ga0070683_100147275 3300005329 Unclassified 2231
18 Ga0070670_100007241 3300005331 Bacteria 9401
19 Ga0070670_100008122 3300005331 Bacteria 8932
20 Ga0070670_100019814 3300005331 Bacteria 5775
21 Ga0070677_10072276 3300005333 Unclassified 1454
22 Ga0068869_100019655 3300005334 Bacteria 4621
23 Ga0068869_100038268 3300005334 Unclassified 3417
24 Ga0070680_100115853 3300005336 Unclassified 2233
25 Ga0068868_100015362 3300005338 Bacteria 5661
26 Ga0068868_100301694 3300005338 Unclassified 1360
27 Ga0070660_100163006 3300005339 Bacteria 1797
28 Ga0070660_100429617 3300005339 Unclassified 1094
29 Ga0070689_100021329 3300005340 Bacteria 4822
30 Ga0070689_100028082 3300005340 Unclassified 4250
31 Ga0070689_100045149 3300005340 Bacteria 3392
32 Ga0070689_100434930 3300005340 Bacteria 1114
33 Ga0070689_100759194 3300005340 Bacteria 850
34 Ga0070687_100210167 3300005343 Bacteria 1185
35 Ga0070661_100030990 3300005344 Bacteria 3865
36 Ga0070661_100170469 3300005344 Bacteria 1652
37 Ga0070661_100221759 3300005344 Bacteria 1451
38 Ga0070692_10070147 3300005345 Unclassified 1865
39 Ga0070668_100141376 3300005347 Bacteria 1940
40 Ga0070668_100282202 3300005347 Unclassified 1387
41 Ga0070669_100359447 3300005353 Bacteria 1184
42 Ga0070675_100147938 3300005354 Bacteria 2012
43 Ga0070675_100505817 3300005354 Unclassified 1089
44 Ga0070675_100663023 3300005354 Bacteria 949
45 Ga0070671_100021588 3300005355 Bacteria 5259
46 Ga0070671_100459656 3300005355 Bacteria 1092
47 Ga0070674_100037598 3300005356 Bacteria 3256
48 Ga0070674_100419559 3300005356 Unclassified 1097
49 Ga0070673_100131046 3300005364 Bacteria 2103
50 Ga0070673_100499137 3300005364 Unclassified 1100
51 Ga0070688_100080031 3300005365 Bacteria 2112
52 Ga0070667_100017198 3300005367 Bacteria 5989
53 Ga0070667_100345971 3300005367 Unclassified 1345
54 Ga0070703_10014279 3300005406 Bacteria 2262
55 Ga0070709_10023350 3300005434 Bacteria 3629
56 Ga0070709_10319485 3300005434 Bacteria 1139
57 Ga0070714_100035238 3300005435 Bacteria 4194
58 Ga0070714_100242007 3300005435 Bacteria 1665
59 Ga0070714_100994913 3300005435 Unclassified 816
60 Ga0070713_100019783 3300005436 Bacteria 5151
61 Ga0070713_100029725 3300005436 Bacteria 4330
62 Ga0070713_100037773 3300005436 Unclassified 3906
63 Ga0070713_100038453 3300005436 Bacteria 3877
64 Ga0070713_100057908 3300005436 Unclassified 3229
65 Ga0070713_100490333 3300005436 Unclassified 1158
66 Ga0070701_10105130 3300005438 Bacteria 1569
67 Ga0070701_10274305 3300005438 Unclassified 1027
68 Ga0070711_100329441 3300005439 Bacteria 1222
69 Ga0070705_100155172 3300005440 Bacteria 1523
70 Ga0070705_100188079 3300005440 Bacteria 1405
71 Ga0070705_100379932 3300005440 Unclassified 1039
72 Ga0070705_100618736 3300005440 Bacteria 840
73 Ga0070700_100005142 3300005441 Bacteria 6908
74 Ga0070694_100032105 3300005444 Bacteria 3447
75 Ga0070694_100644676 3300005444 Bacteria 857
76 Ga0070708_100012901 3300005445 Bacteria 6826
77 Ga0070708_100016780 3300005445 Bacteria 6086
78 Ga0070663_100060972 3300005455 Unclassified 2715
79 Ga0070663_100921302 3300005455 Bacteria 756
80 Ga0070662_100015626 3300005457 Bacteria 5089
81 Ga0070662_100168466 3300005457 Unclassified 1718
82 Ga0070681_10023795 3300005458 Bacteria 6166
83 Ga0070685_10357887 3300005466 Unclassified 1000
84 Ga0070706_100018502 3300005467 Bacteria 6424
85 Ga0070706_100021729 3300005467 Bacteria 5909
86 Ga0070706_100027125 3300005467 Bacteria 5270
87 Ga0070706_100077041 3300005467 Bacteria 3086
88 Ga0070706_100211162 3300005467 Bacteria 1813
89 Ga0070707_100015977 3300005468 Bacteria 7044
90 Ga0070707_100060531 3300005468 Bacteria 3631
91 Ga0070707_100070070 3300005468 Bacteria 3377
92 Ga0070707_100711327 3300005468 Bacteria 967
93 Ga0070698_100170225 3300005471 Bacteria 2119
94 Ga0070698_100367892 3300005471 Bacteria 1370
95 Ga0070698_100443277 3300005471 Bacteria 1234
96 Ga0070698_100575784 3300005471 Unclassified 1066
97 Ga0070699_100208436 3300005518 Unclassified 1739
98 Ga0070684_100001009 3300005535 Bacteria 20079
99 Ga0070684_100191877 3300005535 Bacteria 1859
100 Ga0070684_100202047 3300005535 Unclassified 1810
101 Ga0070697_100048529 3300005536 Bacteria 3443
102 Ga0070697_100095315 3300005536 Bacteria 2467
103 Ga0070697_100101991 3300005536 Bacteria 2384
104 Ga0070697_100102656 3300005536 Bacteria 2376
105 Ga0070697_100382488 3300005536 Bacteria 1219
106 Ga0068853_100005384 3300005539 Bacteria 10019
107 Ga0068853_100069215 3300005539 Bacteria 3070
108 Ga0068853_100209024 3300005539 Unclassified 1778
109 Ga0068853_100319461 3300005539 Bacteria 1439
110 Ga0068853_100593025 3300005539 Bacteria 1052
111 Ga0070672_100006680 3300005543 Bacteria 7772
112 Ga0070672_100058255 3300005543 Bacteria 3035
113 Ga0070672_100077568 3300005543 Bacteria 2657
114 Ga0070686_100363063 3300005544 Bacteria 1091
115 Ga0070686_100372893 3300005544 Bacteria 1078
116 Ga0070696_100008454 3300005546 Bacteria 6889
117 Ga0070665_100171510 3300005548 Unclassified 2170
118 Ga0070704_100028566 3300005549 Bacteria 3712
119 Ga0068855_100061797 3300005563 Bacteria 4376
120 Ga0068855_100295049 3300005563 Bacteria 1796
121 Ga0068855_100438212 3300005563 Unclassified 1427
122 Ga0070664_100001182 3300005564 Bacteria 20767
123 Ga0070664_100008341 3300005564 Bacteria 8377
124 Ga0070664_100053371 3300005564 Bacteria 3426
125 Ga0070664_100179241 3300005564 Bacteria 1882
126 Ga0068857_100076896 3300005577 Bacteria 2977
127 Ga0068857_100077148 3300005577 Bacteria 2972
128 Ga0068857_100174588 3300005577 Bacteria 1954
129 Ga0068857_100355818 3300005577 Unclassified 1357
130 Ga0068854_100688686 3300005578 Bacteria 881
131 Ga0068856_100239265 3300005614 Unclassified 1831
132 Ga0070702_100291121 3300005615 Bacteria 1125
133 Ga0068852_100013938 3300005616 Bacteria 6165
134 Ga0068852_100143935 3300005616 Bacteria 2209
135 Ga0068859_100029419 3300005617 Bacteria 5511
136 Ga0068859_100516432 3300005617 Unclassified 1290
137 Ga0068864_100023851 3300005618 Bacteria 5141
138 Ga0068866_10007062 3300005718 Bacteria 4695
139 Ga0068866_10040583 3300005718 Unclassified 2305
140 Ga0068861_100205793 3300005719 Bacteria 1655
141 Ga0068851_10126105 3300005834 Bacteria 1380
142 Ga0068851_10148113 3300005834 Bacteria 1281
143 Ga0068863_100039578 3300005841 Bacteria 4485
144 Ga0068863_100155722 3300005841 Unclassified 2188
145 Ga0068858_100017141 3300005842 Bacteria 6797
146 Ga0068858_100183102 3300005842 Bacteria 1978
147 Ga0068858_100369996 3300005842 Bacteria 1374
148 Ga0068860_100045356 3300005843 Bacteria 4192
149 Ga0068860_100076387 3300005843 Bacteria 3186
150 Ga0068860_100337832 3300005843 Unclassified 1480
151 Ga0068862_100024051 3300005844 Bacteria 5107
152 Ga0068862_100116705 3300005844 Unclassified 2348
153 Ga0068862_100331718 3300005844 Unclassified 1407
154 Ga0081455_10000821 3300005937 Bacteria 39932
155 Ga0081455_10021810 3300005937 Bacteria 5999
156 Ga0081538_10000802 3300005981 Bacteria 34056
157 Ga0081538_10003629 3300005981 Bacteria 14507
158 Ga0081538_10015996 3300005981 Bacteria 5775
159 Ga0081538_10044377 3300005981 Unclassified 2774
160 Ga0081540_1001600 3300005983 Bacteria 19304
161 Ga0081540_1037595 3300005983 Bacteria 2563
162 Ga0081540_1076037 3300005983 Bacteria 1532
163 Ga0070717_10012636 3300006028 Bacteria 6442
164 Ga0070717_10021797 3300006028 Bacteria 5054
165 Ga0070717_10022168 3300006028 Bacteria 5016
166 Ga0070717_10034178 3300006028 Bacteria 4108
167 Ga0070717_10060595 3300006028 Bacteria 3134
168 Ga0070717_10159616 3300006028 Bacteria 1955
169 Ga0070717_10253457 3300006028 Bacteria 1555
170 Ga0070717_10486339 3300006028 Unclassified 1115
171 Ga0070715_10322983 3300006163 Bacteria 834
172 Ga0070716_100038495 3300006173 Bacteria 2648
173 Ga0070712_100254162 3300006175 Unclassified 1406
174 Ga0070712_100455021 3300006175 Bacteria 1066
175 Ga0097621_100187806 3300006237 Bacteria 1788
176 Ga0097621_100557484 3300006237 Bacteria 1043
177 Ga0097621_100787630 3300006237 Unclassified 880
178 Ga0075428_100021849 3300006844 Bacteria 7085
179 Ga0075428_100060905 3300006844 Bacteria 4133
180 Ga0075428_100123593 3300006844 Bacteria 2817
181 Ga0075430_100032081 3300006846 Bacteria 4459
182 Ga0075430_100069599 3300006846 Bacteria 2952
183 Ga0075430_100101232 3300006846 Bacteria 2406
184 Ga0075430_100154458 3300006846 Unclassified 1911
185 Ga0075430_100449703 3300006846 Unclassified 1063
186 Ga0075431_100013369 3300006847 Bacteria 8294
187 Ga0075431_100016356 3300006847 Bacteria 7526
188 Ga0075431_100024982 3300006847 Bacteria 6124
189 Ga0075431_100033397 3300006847 Bacteria 5303
190 Ga0075431_100121754 3300006847 Bacteria 2692
191 Ga0075431_100145769 3300006847 Bacteria 2440
192 Ga0075431_100222057 3300006847 Bacteria 1927
193 Ga0075431_100251604 3300006847 Bacteria 1795
194 Ga0075433_10003229 3300006852 Bacteria 12584
195 Ga0075433_10021298 3300006852 Bacteria 5436
196 Ga0075433_10026830 3300006852 Bacteria 4881
197 Ga0075433_10136262 3300006852 Unclassified 2182
198 Ga0075433_10211295 3300006852 Unclassified 1724
199 Ga0075433_10289775 3300006852 Unclassified 1450
200 Ga0075433_10301423 3300006852 Bacteria 1419
201 Ga0075433_10348001 3300006852 Bacteria 1310
202 Ga0075433_10440673 3300006852 Bacteria 1148
203 Ga0075433_10555642 3300006852 Bacteria 1009
204 Ga0075434_100018831 3300006871 Bacteria 6673
205 Ga0075434_100019594 3300006871 Bacteria 6549
206 Ga0075434_100050673 3300006871 Bacteria 4124
207 Ga0075434_100064377 3300006871 Unclassified 3650
208 Ga0075434_100118537 3300006871 Bacteria 2661
209 Ga0075434_100232368 3300006871 Unclassified 1864
210 Ga0075434_100566554 3300006871 Unclassified 1155
211 Ga0075434_100794506 3300006871 Bacteria 963
212 Ga0075434_100804684 3300006871 Bacteria 956
213 Ga0075429_100032883 3300006880 Bacteria 4508
214 Ga0075429_100067536 3300006880 Bacteria 3111
215 Ga0075429_100111000 3300006880 Bacteria 2397
216 Ga0075429_100184525 3300006880 Bacteria 1828
217 Ga0075429_100359692 3300006880 Unclassified 1274
218 Ga0075429_100473519 3300006880 Bacteria 1097
219 Ga0068865_100004288 3300006881 Bacteria 8606
220 Ga0068865_100026998 3300006881 Bacteria 3790
221 Ga0068865_100235356 3300006881 Unclassified 1439
222 Ga0068865_100472415 3300006881 Unclassified 1041
223 Ga0068865_100511484 3300006881 Unclassified 1003
224 Ga0075436_100020822 3300006914 Bacteria 4499
225 Ga0075436_100130781 3300006914 Archaea 1760
226 Ga0075436_100394413 3300006914 Bacteria 1002
227 Ga0097620_100029418 3300006931 Bacteria 5511
228 Ga0097620_100516425 3300006931 Unclassified 1290
229 Ga0075435_100045543 3300007076 Bacteria 3517
230 Ga0075435_100046266 3300007076 Bacteria 3490
231 Ga0075435_100082420 3300007076 Bacteria 2644
232 Ga0075435_100084861 3300007076 Bacteria 2606
233 Ga0075435_100295913 3300007076 Unclassified 1384
234 Ga0075435_100366588 3300007076 Bacteria 1236
235 Ga0075435_100394334 3300007076 Archaea 1190
236 Ga0075435_100618930 3300007076 Unclassified 939
237 Ga0075435_100678151 3300007076 Bacteria 895
238 Ga0099794_10004081 3300007265 Bacteria 5684
239 Ga0105251_10257120 3300009011 Bacteria 788
240 Ga0105244_10151503 3300009036 Bacteria 1111
241 Ga0105240_10037278 3300009093 Bacteria 6250
242 Ga0105240_10149505 3300009093 Bacteria 2783
243 Ga0105240_10198500 3300009093 Bacteria 2353
244 Ga0105240_10399696 3300009093 Unclassified 1548
245 Ga0105245_10018914 3300009098 Bacteria 6029
246 Ga0105245_10715053 3300009098 Bacteria 1036
247 Ga0105247_10030007 3300009101 Unclassified 3296
248 Ga0114129_10014697 3300009147 Bacteria 11151
249 Ga0114129_10015104 3300009147 Bacteria 10989
250 Ga0114129_10032635 3300009147 Bacteria 7358
251 Ga0114129_10047955 3300009147 Bacteria 6001
252 Ga0114129_10087331 3300009147 Bacteria 4325
253 Ga0114129_10114795 3300009147 Bacteria 3713
254 Ga0114129_10131744 3300009147 Bacteria 3433
255 Ga0114129_10179442 3300009147 Bacteria 2883
256 Ga0114129_10382893 3300009147 Bacteria 1857
257 Ga0114129_10402168 3300009147 Unclassified 1804
258 Ga0114129_10427117 3300009147 Bacteria 1742
259 Ga0105243_10113929 3300009148 Unclassified 2268
260 Ga0105241_10015213 3300009174 Bacteria 5635
261 Ga0105241_10063916 3300009174 Bacteria 2841
262 Ga0105241_10064150 3300009174 Bacteria 2835
263 Ga0105248_10054944 3300009177 Bacteria 4466
264 Ga0105248_10060734 3300009177 Bacteria 4243
265 Ga0105248_10070218 3300009177 Bacteria 3934
266 Ga0105248_10724779 3300009177 Bacteria 1122
267 Ga0105237_10131309 3300009545 Bacteria 2499
268 Ga0105237_10342855 3300009545 Bacteria 1498
269 Ga0105237_10466037 3300009545 Bacteria 1269
270 Ga0105237_10823714 3300009545 Bacteria 935
271 Ga0105238_10019213 3300009551 Bacteria 6961
272 Ga0105238_10028521 3300009551 Bacteria 5686
273 Ga0105249_10064505 3300009553 Bacteria 3367
274 Ga0105249_10182875 3300009553 Bacteria 2041
275 Ga0105249_10211130 3300009553 Unclassified 1905
276 Ga0105249_10370496 3300009553 Bacteria 1456
277 Ga0105249_10502134 3300009553 Bacteria 1258
278 Ga0105239_10005551 3300010375 Bacteria 14764
279 Ga0105239_10140219 3300010375 Bacteria 2693
280 Ga0105239_10168058 3300010375 Unclassified 2452
281 Ga0105239_10281472 3300010375 Unclassified 1872
282 Ga0105246_10037411 3300011119 Unclassified 3258
283 Ga0157324_1016442 3300012506 Bacteria 704
284 Ga0157373_10042877 3300013100 Bacteria 3232
285 Ga0157373_10061884 3300013100 Bacteria 2651
286 Ga0157373_10119964 3300013100 Bacteria 1848
287 Ga0157371_10061088 3300013102 Bacteria 2672
288 Ga0157370_10032842 3300013104 Bacteria 5065
289 Ga0157370_10550906 3300013104 Bacteria 1057
290 Ga0157369_10062529 3300013105 Bacteria 4011
291 Ga0157369_10120703 3300013105 Bacteria 2782
292 Ga0157369_10513385 3300013105 Bacteria 1240
293 Ga0157369_10792068 3300013105 Unclassified 974
294 Ga0157374_10020012 3300013296 Bacteria 5933
295 Ga0157374_10035611 3300013296 Bacteria 4554
296 Ga0157374_10225047 3300013296 Unclassified 1842
297 Ga0157378_10018740 3300013297 Bacteria 6083
298 Ga0157378_10190341 3300013297 Bacteria 1935
299 Ga0163162_10065783 3300013306 Unclassified 3673
300 Ga0163162_10663061 3300013306 Unclassified 1166
301 Ga0157372_10276183 3300013307 Bacteria 1953
302 Ga0157372_10318479 3300013307 Bacteria 1811
303 Ga0157372_10466633 3300013307 Bacteria 1472
304 Ga0157375_10027784 3300013308 Bacteria 5293
305 Ga0163163_10087279 3300014325 Bacteria 3130
306 Ga0163163_10113754 3300014325 Unclassified 2737
307 Ga0163163_11311079 3300014325 Bacteria 786
308 Ga0157380_10199948 3300014326 Unclassified 1772
309 Ga0157377_10210179 3300014745 Bacteria 1240
310 Ga0157377_10238256 3300014745 Bacteria 1173
311 Ga0157377_10242258 3300014745 Bacteria 1165
312 Ga0157379_10196423 3300014968 Bacteria 1824
313 Ga0157379_10479612 3300014968 Bacteria 1151
314 Ga0157376_10193118 3300014969 Unclassified 1868
315 Ga0157376_10615826 3300014969 Bacteria 1082
316 Ga0163161_10005070 3300017792 Bacteria 9167
317 Ga0224570_101694 3300022730 Bacteria 1582
318 Ga0224572_1007189 3300024225 Bacteria 2033
319 Ga0228598_1000599 3300024227 Bacteria 7584
320 Ga0228598_1001520 3300024227 Bacteria 5087
321 Ga0207697_10063657 3300025315 Unclassified 1537
322 Ga0207682_10058641 3300025893 Bacteria 1607
323 Ga0207642_10028392 3300025899 Unclassified 2303
324 Ga0207642_10043350 3300025899 Bacteria 1984
325 Ga0207710_10148517 3300025900 Bacteria 1136
326 Ga0207647_10011968 3300025904 Bacteria 6056
327 Ga0207647_10025472 3300025904 Bacteria 3885
328 Ga0207685_10120865 3300025905 Bacteria 1149
329 Ga0207685_10199338 3300025905 Bacteria 939
330 Ga0207699_10483433 3300025906 Bacteria 892
331 Ga0207645_10067000 3300025907 Bacteria 2295
332 Ga0207684_10002867 3300025910 Bacteria 17113
333 Ga0207684_10077810 3300025910 Bacteria 2821
334 Ga0207684_10178711 3300025910 Bacteria 1830
335 Ga0207684_10231708 3300025910 Bacteria 1594
336 Ga0207654_10145515 3300025911 Unclassified 1516
337 Ga0207654_10200560 3300025911 Bacteria 1313
338 Ga0207707_10016084 3300025912 Bacteria 6526
339 Ga0207695_10021599 3300025913 Bacteria 7339
340 Ga0207671_10059785 3300025914 Bacteria 2827
341 Ga0207693_10024994 3300025915 Unclassified 4737
342 Ga0207693_10072280 3300025915 Bacteria 2701
343 Ga0207693_10086382 3300025915 Bacteria 2458
344 Ga0207663_10070207 3300025916 Bacteria 2256
345 Ga0207663_10372469 3300025916 Bacteria 1086
346 Ga0207660_10015668 3300025917 Bacteria 5007
347 Ga0207662_10108441 3300025918 Unclassified 1728
348 Ga0207657_10051928 3300025919 Bacteria 3562
349 Ga0207657_10445743 3300025919 Unclassified 1016
350 Ga0207657_10683591 3300025919 Unclassified 798
351 Ga0207649_10257311 3300025920 Bacteria 1260
352 Ga0207646_10048347 3300025922 Bacteria 3813
353 Ga0207646_10086249 3300025922 Bacteria 2808
354 Ga0207646_10211481 3300025922 Bacteria 1751
355 Ga0207681_10163334 3300025923 Unclassified 1681
356 Ga0207681_10322058 3300025923 Unclassified 1230
357 Ga0207694_10045769 3300025924 Bacteria 3380
358 Ga0207650_10025695 3300025925 Bacteria 4196
359 Ga0207650_10048199 3300025925 Unclassified 3141
360 Ga0207659_10431082 3300025926 Bacteria 1107
361 Ga0207687_10011006 3300025927 Bacteria 5912
362 Ga0207700_10022036 3300025928 Bacteria 4364
363 Ga0207700_10038668 3300025928 Unclassified 3465
364 Ga0207700_10045694 3300025928 Bacteria 3233
365 Ga0207664_10153314 3300025929 Bacteria 1959
366 Ga0207664_10154669 3300025929 Bacteria 1951
367 Ga0207664_10346781 3300025929 Bacteria 1314
368 Ga0207644_10068609 3300025931 Unclassified 2587
369 Ga0207690_10230994 3300025932 Unclassified 1420
370 Ga0207706_10017031 3300025933 Bacteria 6556
371 Ga0207706_10028250 3300025933 Bacteria 5010
372 Ga0207706_10205954 3300025933 Unclassified 1725
373 Ga0207686_10395665 3300025934 Bacteria 1051
374 Ga0207709_10253952 3300025935 Unclassified 1286
375 Ga0207670_10153671 3300025936 Bacteria 1710
376 Ga0207669_10027532 3300025937 Unclassified 3114
377 Ga0207704_10096676 3300025938 Bacteria 1956
378 Ga0207704_10592702 3300025938 Unclassified 906
379 Ga0207665_10117045 3300025939 Bacteria 1879
380 Ga0207691_10013521 3300025940 Bacteria 7806
381 Ga0207691_10016109 3300025940 Bacteria 7101
382 Ga0207711_10091400 3300025941 Unclassified 2677
383 Ga0207711_10581004 3300025941 Unclassified 1045
384 Ga0207689_10007662 3300025942 Bacteria 9454
385 Ga0207689_10252265 3300025942 Unclassified 1459
386 Ga0207661_10200574 3300025944 Bacteria 1754
387 Ga0207661_10274493 3300025944 Unclassified 1505
388 Ga0207661_10307410 3300025944 Unclassified 1423
389 Ga0207679_10007225 3300025945 Bacteria 7038
390 Ga0207679_10179505 3300025945 Bacteria 1750
391 Ga0207679_10228407 3300025945 Unclassified 1570
392 Ga0207667_10039322 3300025949 Bacteria 5042
393 Ga0207667_10800691 3300025949 Bacteria 939
394 Ga0207651_10500075 3300025960 Unclassified 1051
395 Ga0207651_10560055 3300025960 Bacteria 995
396 Ga0207668_10127828 3300025972 Bacteria 1936
397 Ga0207640_10223428 3300025981 Bacteria 1443
398 Ga0207658_10457963 3300025986 Unclassified 1130
399 Ga0207677_10068188 3300026023 Unclassified 2495
400 Ga0207677_10355331 3300026023 Bacteria 1229
401 Ga0207703_10030200 3300026035 Bacteria 4281
402 Ga0207703_10083107 3300026035 Unclassified 2675
403 Ga0207703_10112571 3300026035 Unclassified 2325
404 Ga0207703_10872531 3300026035 Bacteria 861
405 Ga0207639_10096364 3300026041 Bacteria 2380
406 Ga0207639_10182061 3300026041 Unclassified 1788
407 Ga0207639_10474377 3300026041 Bacteria 1139
408 Ga0207639_10484901 3300026041 Bacteria 1127
409 Ga0207678_10004108 3300026067 Bacteria 13090
410 Ga0207702_10210328 3300026078 Bacteria 1808
411 Ga0207641_10126921 3300026088 Unclassified 2285
412 Ga0207648_10025881 3300026089 Bacteria 5220
413 Ga0207648_10132257 3300026089 Unclassified 2196
414 Ga0207676_10079444 3300026095 Unclassified 2660
415 Ga0207676_10321592 3300026095 Bacteria 1420
416 Ga0207674_10012697 3300026116 Bacteria 9412
417 Ga0207674_10015212 3300026116 Bacteria 8466
418 Ga0207674_10019220 3300026116 Bacteria 7407
419 Ga0207674_10019254 3300026116 Bacteria 7399
420 Ga0207675_100210140 3300026118 Bacteria 1871
421 Ga0207683_10012015 3300026121 Bacteria 7393
422 Ga0207698_10341047 3300026142 Unclassified 1411
423 Ga0209588_1002147 3300027671 Bacteria 5321
424 Ga0207428_10395980 3300027907 Bacteria 1012
425 Ga0268266_10034432 3300028379 Unclassified 4308
426 Ga0268265_10077502 3300028380 Unclassified 2611
427 Ga0268264_10066154 3300028381 Bacteria 3047
428 Ga0268264_10216285 3300028381 Bacteria 1762
429 Ga0307408_100008985 3300031548 Bacteria 6601
430 Ga0307406_10002143 3300031901 Bacteria 10749
431 Ga0307416_100152155 3300032002 Bacteria 2124
432 Ga0373930_0017699 3300034816 Unclassified 1362
433 Ga0373948_0027251 3300034817 Unclassified 1131
434 Ga0373958_0021557 3300034819 Bacteria 1196
435 Ga0373928_0020595 3300035084 Unclassified 1384
436 Ga0373929_0043696 3300035085 Bacteria 1004
437 Ga0373949_0014621 3300035090 Bacteria 1749
438 Ga0373939_0019332 3300035114 Bacteria 1836
439 Ga0373960_0047353 3300035121 Bacteria 1264
440 Ga0373942_0007332 3300035207 Unclassified 2556
441 Ga0373961_0147799 3300035241 Bacteria 798
442 Ga0373962_0007141 3300035242 Unclassified 2729
443 Ga0373931_0090637 3300035691 Bacteria 1703
444 Ga0373931_0150575 3300035691 Bacteria 1356
445 Ga0373931_0158867 3300035691 Unclassified 1323
446 Ga0373947_0123486 3300035725 Unclassified 1646
447 Ga0373925_0189893 3300037068 Unclassified 1630
448 Ga0395899_0331182 3300037312 Unclassified 1023
449 Ga0395900_0047354 3300037418 Bacteria 4427
450 Ga0395900_0799538 3300037418 Bacteria 871
451 Ga0395898_0005660 3300037466 Bacteria 13476
452 Ga0395898_0038989 3300037466 Bacteria 4705
453 Ga0395905_0040867 3300037471 Bacteria 4351
454 Ga0395905_0085482 3300037471 Bacteria 2956
455 Ga0395905_0394821 3300037471 Bacteria 1278
456 Ga0395901_0033138 3300038443 Bacteria 5331
457 Ga0395901_0059161 3300038443 Bacteria 3987
458 Ga0439448_0084645 3300042005 Bacteria 1067
459 Ga0439448_0095999 3300042005 Unclassified 1004
460 Ga0439450_014169 3300042008 Bacteria 1613
461 Ga0439451_015113 3300042009 Bacteria 1556
462 Ga0439454_027708 3300042011 Unclassified 872
463 Ga0439463_008840 3300042016 Bacteria 2479
464 Ga0439463_010003 3300042016 Bacteria 2330
465 Ga0450912_007536 3300042116 Unclassified 886
466 Ga0439464_0002781 3300042439 Bacteria 4342
467 Ga0439460_0033164 3300042461 Bacteria 1482
468 Ga0439460_0082442 3300042461 Unclassified 1011
469 Ga0453683_0013733 3300044673 Bacteria 5273
470 Ga0466961_0042735 3300044693 Bacteria 2905
471 Ga0466971_0133019 3300044719 Bacteria 1156
472 Ga0466959_0003240 3300045049 Bacteria 10591
473 Ga0466959_0180794 3300045049 Unclassified 1475
474 Ga0466959_0333309 3300045049 Bacteria 1036
475 Ga0451576_0155591 3300045051 Bacteria 2385
476 Ga0451576_0820012 3300045051 Unclassified 977
477 Ga0466958_0013083 3300045836 Bacteria 4716
478 Ga0466958_0148388 3300045836 Bacteria 1479
479 Ga0466967_0032657 3300045976 Bacteria 4398
480 Ga0466967_0124428 3300045976 Bacteria 2387
481 Ga0495629_0143159 3300046459 Bacteria 1663
482 Ga0495580_0057691 3300046472 Bacteria 2732
483 Ga0495582_0082174 3300046473 Bacteria 1790
484 Ga0495582_0103292 3300046473 Unclassified 1597
485 Ga0495594_0042972 3300046499 Bacteria 2476
486 Ga0495586_0030537 3300046535 Bacteria 2883
487 Ga0495647_0199918 3300046681 Bacteria 876
488 Ga0495658_0078970 3300046683 Bacteria 1927
489 Ga0495669_0007619 3300046684 Bacteria 4542
490 Ga0495581_0486191 3300047315 Bacteria 718
491 Ga0495680_0162824 3300047322 Bacteria 1619
492 Ga0495680_0413349 3300047322 Unclassified 929
493 Ga0495614_0032689 3300048089 Unclassified 2239
494 Ga0496100_0380940 3300048903 Bacteria 1071
495 Ga0496101_0051367 3300048904 Unclassified 2970
496 Ga0496101_0319693 3300048904 Bacteria 1218
497 Ga0496102_0113069 3300048905 Unclassified 2533
498 Ga0496104_0012974 3300048907 Bacteria 7502
499 Ga0496105_0481800 3300048908 Bacteria 976
500 Ga0496106_0133395 3300048909 Unclassified 1949
501 Ga0496106_0484677 3300048909 Bacteria 993
502 Ga0496107_0074988 3300048910 Bacteria 2462
503 Ga0496107_0419995 3300048910 Bacteria 994
504 Ga0496109_0067578 3300048912 Bacteria 3275
505 Ga0496109_0964519 3300048912 Bacteria 790
506 Ga0496110_0094181 3300048913 Unclassified 2681
507 Ga0496111_0005486 3300048914 Bacteria 8136
508 Ga0496112_0019255 3300048915 Bacteria 6439
509 Ga0496112_0115473 3300048915 Bacteria 2655
510 Ga0496112_0247935 3300048915 Bacteria 1733
511 Ga0496112_0444200 3300048915 Bacteria 1235
512 Ga0496113_0707717 3300048916 Bacteria 803
513 Ga0496114_0006250 3300048917 Bacteria 9374
514 Ga0496115_0121569 3300048918 Unclassified 2149
515 Ga0501033_0027809 3300049570 Bacteria 4250
516 Ga0501036_0230736 3300049572 Bacteria 1553
517 Ga0501037_0050655 3300049573 Bacteria 3038
518 Ga0501038_0021212 3300049574 Bacteria 5836
519 Ga0501039_0011515 3300049575 Bacteria 6732
520 Ga0501040_0007911 3300049576 Bacteria 6894
521 Ga0501041_0004838 3300049577 Bacteria 7827
522 Ga0501042_0048564 3300049578 Bacteria 3026
523 Ga0501043_0080920 3300049579 Bacteria 2552
524 Ga0501046_0007659 3300049580 Bacteria 9472
525 Ga0501068_0010708 3300049584 Bacteria 5155
526 Ga0501070_0072761 3300049586 Bacteria 2845
527 Ga0501071_0014212 3300049587 Bacteria 5443
528 Ga0501072_0004483 3300049588 Bacteria 10606
529 Ga0501073_0207990 3300049589 Bacteria 1352
530 Ga0501074_0001930 3300049590 Bacteria 14255
531 Ga0501075_0028360 3300049591 Bacteria 4132
532 Ga0501076_0002709 3300049592 Bacteria 12248
533 Ga0501077_0009090 3300049593 Bacteria 6167
534 Ga0501079_0010956 3300049741 Bacteria 6907
535 Ga0501080_0013990 3300049742 Bacteria 7385
536 Ga0501081_0013307 3300049743 Bacteria 5411
537 Ga0501083_0033619 3300049744 Bacteria 3510
538 Ga0501045_0002182 3300049824 Bacteria 13268
539 nmdc:mga05p37_137581_c1 3300050507 Bacteria 2994
540 nmdc:mga05p37_1793_c1 3300050507 Bacteria 25060
541 nmdc:mga05p37_208814_c1 3300050507 Bacteria 2361
542 nmdc:mga05p37_210594_c1 3300050507 Bacteria 2350
543 nmdc:mga05p37_34865_c1 3300050507 Bacteria 6166
544 nmdc:mga05p37_357491_c1 3300050507 Bacteria 1718
545 nmdc:mga05p37_76662_c1 3300050507 Bacteria 4115
546 nmdc:mga05p37_81010_c1 3300050507 Bacteria 3999
547 nmdc:mga09592_173215_c1 3300050508 Bacteria 1866
548 nmdc:mga09592_336536_c1 3300050508 Unclassified 1307
549 nmdc:mga09592_50132_c1 3300050508 Bacteria 3521
550 nmdc:mga09592_654700_c1 3300050508 Bacteria 897
551 nmdc:mga0qj67_13804_c1 3300050509 Bacteria 6096
552 nmdc:mga0qj67_25084_c1 3300050509 Bacteria 4602
553 nmdc:mga0qj67_79794_c1 3300050509 Unclassified 2621
554 nmdc:mga06r32_18299_c1 3300050510 Bacteria 6412
555 nmdc:mga06r32_213005_c1 3300050510 Bacteria 1920
556 nmdc:mga06r32_32409_c1 3300050510 Unclassified 4916
557 nmdc:mga06r32_420588_c1 3300050510 Bacteria 1317
558 nmdc:mga06r32_43062_c1 3300050510 Bacteria 4295
559 nmdc:mga06r32_485230_c1 3300050510 Bacteria 1214
560 nmdc:mga06r32_51795_c1 3300050510 Bacteria 3930
561 nmdc:mga06r32_58333_c1 3300050510 Bacteria 3710
562 nmdc:mga08y16_104003_c1 3300050511 Bacteria 2956
563 nmdc:mga08y16_267753_c1 3300050511 Bacteria 1764
564 nmdc:mga08y16_54622_c1 3300050511 Bacteria 4174
565 nmdc:mga08y16_566026_c1 3300050511 Bacteria 1149
566 nmdc:mga0n895_1366715_c1 3300050512 Unclassified 677
567 nmdc:mga0n895_143885_c1 3300050512 Bacteria 2413
568 nmdc:mga0n895_17719_c1 3300050512 Bacteria 6571
569 nmdc:mga0n895_198413_c1 3300050512 Bacteria 2038
570 nmdc:mga0n895_22792_c1 3300050512 Bacteria 5875
571 nmdc:mga0n895_519592_c1 3300050512 Unclassified 1198
572 nmdc:mga0rr50_130097_c1 3300050513 Bacteria 2014
573 nmdc:mga0rr50_184905_c1 3300050513 Bacteria 1705
574 nmdc:mga0rr50_371241_c1 3300050513 Unclassified 1205
575 nmdc:mga0rr50_87333_c1 3300050513 Bacteria 2421
576 nmdc:mga08x19_677556_c1 3300050514 Archaea 732
577 nmdc:mga0a205_231500_c1 3300050515 Unclassified 1731
578 nmdc:mga0a205_282741_c1 3300050515 Unclassified 1534
579 nmdc:mga0a205_37457_c1 3300050515 Bacteria 4663
580 nmdc:mga0a205_493048_c1 3300050515 Bacteria 1082
581 nmdc:mga0a205_753525_c1 3300050515 Bacteria 822
582 nmdc:mga0a205_78226_c1 3300050515 Bacteria 3195
583 nmdc:mga0a205_8977_c1 3300050515 Bacteria 9112
584 Ga0501084_0266390 3300054114 Bacteria 1446
585 Ga0501082_0028170 3300060353 Bacteria 4840
586 Ga0530510_0001526 3300061734 Bacteria 15595
587 Ga0068867_100105921
588 MBSR1b_contig_4113169
589 JGI24752J21851_1014974
590 JGI24747J21853_1013254
591 JGI24743J22301_10007804
592 JGI24738J21930_10045783
593 JGI24033J26618_1001242
594 JGI25405J52794_10000675
595 Ga0065704_10151714
596 Ga0065712_10214304
597 Ga0065712_10228497
598 Ga0065707_10003840
599 Ga0065707_10093443
600 Ga0070676_10121186
601 Ga0070676_10123839
602 Ga0070683_100061694
603 Ga0070683_100147275
604 Ga0070670_100007241
605 Ga0070670_100008122
606 Ga0070670_100019814
607 Ga0070677_10072276
608 Ga0068869_100019655
609 Ga0068869_100038268
610 Ga0070680_100115853
611 Ga0068868_100015362
612 Ga0068868_100301694
613 Ga0070660_100163006
614 Ga0070660_100429617
615 Ga0070689_100021329
616 Ga0070689_100028082
617 Ga0070689_100045149
618 Ga0070689_100434930
619 Ga0070689_100759194
620 Ga0070687_100210167
621 Ga0070661_100030990
622 Ga0070661_100170469
623 Ga0070661_100221759
624 Ga0070692_10070147
625 Ga0070668_100141376
626 Ga0070668_100282202
627 Ga0070669_100359447
628 Ga0070675_100147938
629 Ga0070675_100505817
630 Ga0070675_100663023
631 Ga0070671_100021588
632 Ga0070671_100459656
633 Ga0070674_100037598
634 Ga0070674_100419559
635 Ga0070673_100131046
636 Ga0070673_100499137
637 Ga0070688_100080031
638 Ga0070667_100017198
639 Ga0070667_100345971
640 Ga0070703_10014279
641 Ga0070709_10023350
642 Ga0070709_10319485
643 Ga0070714_100035238
644 Ga0070714_100242007
645 Ga0070714_100994913
646 Ga0070713_100019783
647 Ga0070713_100029725
648 Ga0070713_100037773
649 Ga0070713_100038453
650 Ga0070713_100057908
651 Ga0070713_100490333
652 Ga0070701_10105130
653 Ga0070701_10274305
654 Ga0070711_100329441
655 Ga0070705_100155172
656 Ga0070705_100188079
657 Ga0070705_100379932
658 Ga0070705_100618736
659 Ga0070700_100005142
660 Ga0070694_100032105
661 Ga0070694_100644676
662 Ga0070708_100012901
663 Ga0070708_100016780
664 Ga0070663_100060972
665 Ga0070663_100921302
666 Ga0070662_100015626
667 Ga0070662_100168466
668 Ga0070681_10023795
669 Ga0070685_10357887
670 Ga0070706_100018502
671 Ga0070706_100021729
672 Ga0070706_100027125
673 Ga0070706_100077041
674 Ga0070706_100211162
675 Ga0070707_100015977
676 Ga0070707_100060531
677 Ga0070707_100070070
678 Ga0070707_100711327
679 Ga0070698_100170225
680 Ga0070698_100367892
681 Ga0070698_100443277
682 Ga0070698_100575784
683 Ga0070699_100208436
684 Ga0070684_100001009
685 Ga0070684_100191877
686 Ga0070684_100202047
687 Ga0070697_100048529
688 Ga0070697_100095315
689 Ga0070697_100101991
690 Ga0070697_100102656
691 Ga0070697_100382488
692 Ga0068853_100005384
693 Ga0068853_100069215
694 Ga0068853_100209024
695 Ga0068853_100319461
696 Ga0068853_100593025
697 Ga0070672_100006680
698 Ga0070672_100058255
699 Ga0070672_100077568
700 Ga0070686_100363063
701 Ga0070686_100372893
702 Ga0070696_100008454
703 Ga0070665_100171510
704 Ga0070704_100028566
705 Ga0068855_100061797
706 Ga0068855_100295049
707 Ga0068855_100438212
708 Ga0070664_100001182
709 Ga0070664_100008341
710 Ga0070664_100053371
711 Ga0070664_100179241
712 Ga0068857_100076896
713 Ga0068857_100077148
714 Ga0068857_100174588
715 Ga0068857_100355818
716 Ga0068854_100688686
717 Ga0068856_100239265
718 Ga0070702_100291121
719 Ga0068852_100013938
720 Ga0068852_100143935
721 Ga0068859_100029419
722 Ga0068859_100516432
723 Ga0068864_100023851
724 Ga0068866_10007062
725 Ga0068866_10040583
726 Ga0068861_100205793
727 Ga0068851_10126105
728 Ga0068851_10148113
729 Ga0068863_100039578
730 Ga0068863_100155722
731 Ga0068858_100017141
732 Ga0068858_100183102
733 Ga0068858_100369996
734 Ga0068860_100045356
735 Ga0068860_100076387
736 Ga0068860_100337832
737 Ga0068862_100024051
738 Ga0068862_100116705
739 Ga0068862_100331718
740 Ga0081455_10000821
741 Ga0081455_10021810
742 Ga0081538_10000802
743 Ga0081538_10003629
744 Ga0081538_10015996
745 Ga0081538_10044377
746 Ga0081540_1001600
747 Ga0081540_1037595
748 Ga0081540_1076037
749 Ga0070717_10012636
750 Ga0070717_10021797
751 Ga0070717_10022168
752 Ga0070717_10034178
753 Ga0070717_10060595
754 Ga0070717_10159616
755 Ga0070717_10253457
756 Ga0070717_10486339
757 Ga0070715_10322983
758 Ga0070716_100038495
759 Ga0070712_100254162
760 Ga0070712_100455021
761 Ga0097621_100187806
762 Ga0097621_100557484
763 Ga0097621_100787630
764 Ga0075428_100021849
765 Ga0075428_100060905
766 Ga0075428_100123593
767 Ga0075430_100032081
768 Ga0075430_100069599
769 Ga0075430_100101232
770 Ga0075430_100154458
771 Ga0075430_100449703
772 Ga0075431_100013369
773 Ga0075431_100016356
774 Ga0075431_100024982
775 Ga0075431_100033397
776 Ga0075431_100121754
777 Ga0075431_100145769
778 Ga0075431_100222057
779 Ga0075431_100251604
780 Ga0075433_10003229
781 Ga0075433_10021298
782 Ga0075433_10026830
783 Ga0075433_10136262
784 Ga0075433_10211295
785 Ga0075433_10289775
786 Ga0075433_10301423
787 Ga0075433_10348001
788 Ga0075433_10440673
789 Ga0075433_10555642
790 Ga0075434_100018831
791 Ga0075434_100019594
792 Ga0075434_100050673
793 Ga0075434_100064377
794 Ga0075434_100118537
795 Ga0075434_100232368
796 Ga0075434_100566554
797 Ga0075434_100794506
798 Ga0075434_100804684
799 Ga0075429_100032883
800 Ga0075429_100067536
801 Ga0075429_100111000
802 Ga0075429_100184525
803 Ga0075429_100359692
804 Ga0075429_100473519
805 Ga0068865_100004288
806 Ga0068865_100026998
807 Ga0068865_100235356
808 Ga0068865_100472415
809 Ga0068865_100511484
810 Ga0075436_100020822
811 Ga0075436_100130781
812 Ga0075436_100394413
813 Ga0097620_100029418
814 Ga0097620_100516425
815 Ga0075435_100045543
816 Ga0075435_100046266
817 Ga0075435_100082420
818 Ga0075435_100084861
819 Ga0075435_100295913
820 Ga0075435_100366588
821 Ga0075435_100394334
822 Ga0075435_100618930
823 Ga0075435_100678151
824 Ga0099794_10004081
825 Ga0105251_10257120
826 Ga0105244_10151503
827 Ga0105240_10037278
828 Ga0105240_10149505
829 Ga0105240_10198500
830 Ga0105240_10399696
831 Ga0105245_10018914
832 Ga0105245_10715053
833 Ga0105247_10030007
834 Ga0114129_10014697
835 Ga0114129_10015104
836 Ga0114129_10032635
837 Ga0114129_10047955
838 Ga0114129_10087331
839 Ga0114129_10114795
840 Ga0114129_10131744
841 Ga0114129_10179442
842 Ga0114129_10382893
843 Ga0114129_10402168
844 Ga0114129_10427117
845 Ga0105243_10113929
846 Ga0105241_10015213
847 Ga0105241_10063916
848 Ga0105241_10064150
849 Ga0105248_10054944
850 Ga0105248_10060734
851 Ga0105248_10070218
852 Ga0105248_10724779
853 Ga0105237_10131309
854 Ga0105237_10342855
855 Ga0105237_10466037
856 Ga0105237_10823714
857 Ga0105238_10019213
858 Ga0105238_10028521
859 Ga0105249_10064505
860 Ga0105249_10182875
861 Ga0105249_10211130
862 Ga0105249_10370496
863 Ga0105249_10502134
864 Ga0105239_10005551
865 Ga0105239_10140219
866 Ga0105239_10168058
867 Ga0105239_10281472
868 Ga0105246_10037411
869 Ga0157324_1016442
870 Ga0157373_10042877
871 Ga0157373_10061884
872 Ga0157373_10119964
873 Ga0157371_10061088
874 Ga0157370_10032842
875 Ga0157370_10550906
876 Ga0157369_10062529
877 Ga0157369_10120703
878 Ga0157369_10513385
879 Ga0157369_10792068
880 Ga0157374_10020012
881 Ga0157374_10035611
882 Ga0157374_10225047
883 Ga0157378_10018740
884 Ga0157378_10190341
885 Ga0163162_10065783
886 Ga0163162_10663061
887 Ga0157372_10276183
888 Ga0157372_10318479
889 Ga0157372_10466633
890 Ga0157375_10027784
891 Ga0163163_10087279
892 Ga0163163_10113754
893 Ga0163163_11311079
894 Ga0157380_10199948
895 Ga0157377_10210179
896 Ga0157377_10238256
897 Ga0157377_10242258
898 Ga0157379_10196423
899 Ga0157379_10479612
900 Ga0157376_10193118
901 Ga0157376_10615826
902 Ga0163161_10005070
903 Ga0224570_101694
904 Ga0224572_1007189
905 Ga0228598_1000599
906 Ga0228598_1001520
907 Ga0207697_10063657
908 Ga0207682_10058641
909 Ga0207642_10028392
910 Ga0207642_10043350
911 Ga0207710_10148517
912 Ga0207647_10011968
913 Ga0207647_10025472
914 Ga0207685_10120865
915 Ga0207685_10199338
916 Ga0207699_10483433
917 Ga0207645_10067000
918 Ga0207684_10002867
919 Ga0207684_10077810
920 Ga0207684_10178711
921 Ga0207684_10231708
922 Ga0207654_10145515
923 Ga0207654_10200560
924 Ga0207707_10016084
925 Ga0207695_10021599
926 Ga0207671_10059785
927 Ga0207693_10024994
928 Ga0207693_10072280
929 Ga0207693_10086382
930 Ga0207663_10070207
931 Ga0207663_10372469
932 Ga0207660_10015668
933 Ga0207662_10108441
934 Ga0207657_10051928
935 Ga0207657_10445743
936 Ga0207657_10683591
937 Ga0207649_10257311
938 Ga0207646_10048347
939 Ga0207646_10086249
940 Ga0207646_10211481
941 Ga0207681_10163334
942 Ga0207681_10322058
943 Ga0207694_10045769
944 Ga0207650_10025695
945 Ga0207650_10048199
946 Ga0207659_10431082
947 Ga0207687_10011006
948 Ga0207700_10022036
949 Ga0207700_10038668
950 Ga0207700_10045694
951 Ga0207664_10153314
952 Ga0207664_10154669
953 Ga0207664_10346781
954 Ga0207644_10068609
955 Ga0207690_10230994
956 Ga0207706_10017031
957 Ga0207706_10028250
958 Ga0207706_10205954
959 Ga0207686_10395665
960 Ga0207709_10253952
961 Ga0207670_10153671
962 Ga0207669_10027532
963 Ga0207704_10096676
964 Ga0207704_10592702
965 Ga0207665_10117045
966 Ga0207691_10013521
967 Ga0207691_10016109
968 Ga0207711_10091400
969 Ga0207711_10581004
970 Ga0207689_10007662
971 Ga0207689_10252265
972 Ga0207661_10200574
973 Ga0207661_10274493
974 Ga0207661_10307410
975 Ga0207679_10007225
976 Ga0207679_10179505
977 Ga0207679_10228407
978 Ga0207667_10039322
979 Ga0207667_10800691
980 Ga0207651_10500075
981 Ga0207651_10560055
982 Ga0207668_10127828
983 Ga0207640_10223428
984 Ga0207658_10457963
985 Ga0207677_10068188
986 Ga0207677_10355331
987 Ga0207703_10030200
988 Ga0207703_10083107
989 Ga0207703_10112571
990 Ga0207703_10872531
991 Ga0207639_10096364
992 Ga0207639_10182061
993 Ga0207639_10474377
994 Ga0207639_10484901
995 Ga0207678_10004108
996 Ga0207702_10210328
997 Ga0207641_10126921
998 Ga0207648_10025881
999 Ga0207648_10132257
1000 Ga0207676_10079444
1001 Ga0207676_10321592
1002 Ga0207674_10012697
1003 Ga0207674_10015212
1004 Ga0207674_10019220
1005 Ga0207674_10019254
1006 Ga0207675_100210140
1007 Ga0207683_10012015
1008 Ga0207698_10341047
1009 Ga0209588_1002147
1010 Ga0207428_10395980
1011 Ga0268266_10034432
1012 Ga0268265_10077502
1013 Ga0268264_10066154
1014 Ga0268264_10216285
1015 Ga0307408_100008985
1016 Ga0307406_10002143
1017 Ga0307416_100152155
1018 Ga0373930_0017699
1019 Ga0373948_0027251
1020 Ga0373958_0021557
1021 Ga0373928_0020595
1022 Ga0373929_0043696
1023 Ga0373949_0014621
1024 Ga0373939_0019332
1025 Ga0373960_0047353
1026 Ga0373942_0007332
1027 Ga0373961_0147799
1028 Ga0373962_0007141
1029 Ga0373931_0090637
1030 Ga0373931_0150575
1031 Ga0373931_0158867
1032 Ga0373947_0123486
1033 Ga0373925_0189893
1034 Ga0395899_0331182
1035 Ga0395900_0047354
1036 Ga0395900_0799538
1037 Ga0395898_0005660
1038 Ga0395898_0038989
1039 Ga0395905_0040867
1040 Ga0395905_0085482
1041 Ga0395905_0394821
1042 Ga0395901_0033138
1043 Ga0395901_0059161
1044 Ga0439448_0084645
1045 Ga0439448_0095999
1046 Ga0439450_014169
1047 Ga0439451_015113
1048 Ga0439454_027708
1049 Ga0439463_008840
1050 Ga0439463_010003
1051 Ga0450912_007536
1052 Ga0439464_0002781
1053 Ga0439460_0033164
1054 Ga0439460_0082442
1055 Ga0453683_0013733
1056 Ga0466961_0042735
1057 Ga0466971_0133019
1058 Ga0466959_0003240
1059 Ga0466959_0180794
1060 Ga0466959_0333309
1061 Ga0451576_0155591
1062 Ga0451576_0820012
1063 Ga0466958_0013083
1064 Ga0466958_0148388
1065 Ga0466967_0032657
1066 Ga0466967_0124428
1067 Ga0495629_0143159
1068 Ga0495580_0057691
1069 Ga0495582_0082174
1070 Ga0495582_0103292
1071 Ga0495594_0042972
1072 Ga0495586_0030537
1073 Ga0495647_0199918
1074 Ga0495658_0078970
1075 Ga0495669_0007619
1076 Ga0495581_0486191
1077 Ga0495680_0162824
1078 Ga0495680_0413349
1079 Ga0495614_0032689
1080 Ga0496100_0380940
1081 Ga0496101_0051367
1082 Ga0496101_0319693
1083 Ga0496102_0113069
1084 Ga0496104_0012974
1085 Ga0496105_0481800
1086 Ga0496106_0133395
1087 Ga0496106_0484677
1088 Ga0496107_0074988
1089 Ga0496107_0419995
1090 Ga0496109_0067578
1091 Ga0496109_0964519
1092 Ga0496110_0094181
1093 Ga0496111_0005486
1094 Ga0496112_0019255
1095 Ga0496112_0115473
1096 Ga0496112_0247935
1097 Ga0496112_0444200
1098 Ga0496113_0707717
1099 Ga0496114_0006250
1100 Ga0496115_0121569
1101 Ga0501033_0027809
1102 Ga0501036_0230736
1103 Ga0501037_0050655
1104 Ga0501038_0021212
1105 Ga0501039_0011515
1106 Ga0501040_0007911
1107 Ga0501041_0004838
1108 Ga0501042_0048564
1109 Ga0501043_0080920
1110 Ga0501046_0007659
1111 Ga0501068_0010708
1112 Ga0501070_0072761
1113 Ga0501071_0014212
1114 Ga0501072_0004483
1115 Ga0501073_0207990
1116 Ga0501074_0001930
1117 Ga0501075_0028360
1118 Ga0501076_0002709
1119 Ga0501077_0009090
1120 Ga0501079_0010956
1121 Ga0501080_0013990
1122 Ga0501081_0013307
1123 Ga0501083_0033619
1124 Ga0501045_0002182
1125 nmdc:mga05p37_137581_c1
1126 nmdc:mga05p37_1793_c1
1127 nmdc:mga05p37_208814_c1
1128 nmdc:mga05p37_210594_c1
1129 nmdc:mga05p37_34865_c1
1130 nmdc:mga05p37_357491_c1
1131 nmdc:mga05p37_76662_c1
1132 nmdc:mga05p37_81010_c1
1133 nmdc:mga09592_173215_c1
1134 nmdc:mga09592_336536_c1
1135 nmdc:mga09592_50132_c1
1136 nmdc:mga09592_654700_c1
1137 nmdc:mga0qj67_13804_c1
1138 nmdc:mga0qj67_25084_c1
1139 nmdc:mga0qj67_79794_c1
1140 nmdc:mga06r32_18299_c1
1141 nmdc:mga06r32_213005_c1
1142 nmdc:mga06r32_32409_c1
1143 nmdc:mga06r32_420588_c1
1144 nmdc:mga06r32_43062_c1
1145 nmdc:mga06r32_485230_c1
1146 nmdc:mga06r32_51795_c1
1147 nmdc:mga06r32_58333_c1
1148 nmdc:mga08y16_104003_c1
1149 nmdc:mga08y16_267753_c1
1150 nmdc:mga08y16_54622_c1
1151 nmdc:mga08y16_566026_c1
1152 nmdc:mga0n895_1366715_c1
1153 nmdc:mga0n895_143885_c1
1154 nmdc:mga0n895_17719_c1
1155 nmdc:mga0n895_198413_c1
1156 nmdc:mga0n895_22792_c1
1157 nmdc:mga0n895_519592_c1
1158 nmdc:mga0rr50_130097_c1
1159 nmdc:mga0rr50_184905_c1
1160 nmdc:mga0rr50_371241_c1
1161 nmdc:mga0rr50_87333_c1
1162 nmdc:mga08x19_677556_c1
1163 nmdc:mga0a205_231500_c1
1164 nmdc:mga0a205_282741_c1
1165 nmdc:mga0a205_37457_c1
1166 nmdc:mga0a205_493048_c1
1167 nmdc:mga0a205_753525_c1
1168 nmdc:mga0a205_78226_c1
1169 nmdc:mga0a205_8977_c1
1170 Ga0501084_0266390
1171 Ga0501082_0028170
1172 Ga0530510_0001526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

22

207

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tg2-assembly1.cif.gz_A-2 crystal structure of the isc domain of vibb in complex with isochorismate 0.8905 18 210
5xo1-assembly3.cif.gz_F crystal structure of the isochorismatase domain of vabb from vibrio anguillarum 775 0.8837 18 210
3tb4-assembly1.cif.gz_A-2 crystal structure of the isc domain of vibb 0.8791 18 210
1xn4-assembly1.cif.gz_A putative mar1 ribonuclease from leishmania major 0.8789 21 206
8bln-assembly3.cif.gz_F structure of rutb 0.8786 18 207
ID Description Score Start End Superfamily
af_I1L789_3_202_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9075 19 213 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8991 18 210 3.40.50.850
3r77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8909 18 206 3.40.50.850
af_Q2G220_1_186_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.887 20 208 3.40.50.850
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8856 19 209 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A370I115-F1-model_v4 Nicotinamidase-related amidase 0.9867 1 211 GO:0016810
AF-A0A6A7L5K2-F1-model_v4 Isochorismatase family protein 0.9817 2 220 GO:0016787
AF-A0A370I115-F1-model_v4 Nicotinamidase-related amidase 0.9775 1 211 GO:0016810
AF-A0A2V6VFT9-F1-model_v4 Isochorismatase-like domain-containing protein 0.9468 99 212 GO:0016787
AF-A0A259IZX7-F1-model_v4 Isochorismatase-like domain-containing protein 0.9424 99 206 GO:0016810

Map