F466404

General Info

Members Datasets Scaffolds Average Seq Length
584 283 1168 259

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0398220|Ga0501045_0398220_121_1014
Length 297
Sequence VRRTAAASCPAYNLLDPPRRERGKDEAKEACMQATATPVAERILTRTDAGGVATLTMNRPAQYNALSEELLAEMTGALEAIGSDSSVRVVVVAGAGPAFCAGHDLKQMRANPSQNSYRRLFAECSRMMMAVTRIPQPVIARVHGIATAAGCQLVAQCDLAVASDQARFAVSGINVGLFCSTPSVPLGRNVLRKQAMEMLLTGDFIDAATARDYGLVNRVVPADRLDAEVAVLAQRIVDKSAVAVATGKRMFYKQLEMGLEGAYQYAAETMACNVMTEDAGQGIDAFVAKRKPEWKHR

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
283 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 5.14
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0398220 3300049824 Bacteria 1025
2 MRS1b_contig_1910819 2162886011 Unclassified 1327
3 JGI25407J50210_10002560 3300003373 Bacteria 4298
4 JGI25404J52841_10044109 3300003659 Bacteria 942
5 Ga0070676_10224384 3300005328 Bacteria 1242
6 Ga0070683_100000896 3300005329 Bacteria 22153
7 Ga0070690_100003496 3300005330 Bacteria 8596
8 Ga0070690_100047126 3300005330 Bacteria 2741
9 Ga0070690_100078619 3300005330 Bacteria 2155
10 Ga0070670_100012138 3300005331 Bacteria 7369
11 Ga0070670_100146426 3300005331 Bacteria 2043
12 Ga0070677_10005783 3300005333 Bacteria 4090
13 Ga0070677_10010682 3300005333 Bacteria 3146
14 Ga0068869_100001092 3300005334 Bacteria 15805
15 Ga0068869_100019711 3300005334 Bacteria 4614
16 Ga0070666_10028864 3300005335 Bacteria 3644
17 Ga0070680_100017701 3300005336 Bacteria 5620
18 Ga0070680_100122266 3300005336 Bacteria 2173
19 Ga0068868_100007891 3300005338 Bacteria 7603
20 Ga0068868_100019915 3300005338 Bacteria 5032
21 Ga0068868_100092562 3300005338 Bacteria 2437
22 Ga0068868_100206612 3300005338 Bacteria 1639
23 Ga0068868_100479377 3300005338 Bacteria 1086
24 Ga0070660_100126830 3300005339 Bacteria 2039
25 Ga0070689_100001270 3300005340 Bacteria 16046
26 Ga0070691_10013858 3300005341 Bacteria 3700
27 Ga0070687_100065952 3300005343 Bacteria 1927
28 Ga0070687_100192612 3300005343 Bacteria 1230
29 Ga0070661_100009455 3300005344 Bacteria 6748
30 Ga0070692_10017031 3300005345 Bacteria 3467
31 Ga0070692_10079354 3300005345 Bacteria 1764
32 Ga0070669_100047530 3300005353 Bacteria 3130
33 Ga0070669_100104440 3300005353 Bacteria 2142
34 Ga0070669_100109986 3300005353 Bacteria 2090
35 Ga0070675_100002728 3300005354 Bacteria 13275
36 Ga0070675_100030142 3300005354 Bacteria 4378
37 Ga0070675_100112288 3300005354 Bacteria 2307
38 Ga0070675_100201654 3300005354 Bacteria 1727
39 Ga0070675_100285329 3300005354 Bacteria 1452
40 Ga0070671_100002418 3300005355 Bacteria 14425
41 Ga0070671_100208974 3300005355 Bacteria 1655
42 Ga0070674_100369402 3300005356 Bacteria 1164
43 Ga0070673_100004156 3300005364 Bacteria 9122
44 Ga0070673_100074502 3300005364 Bacteria 2736
45 Ga0070673_100495160 3300005364 Bacteria 1105
46 Ga0070659_100141108 3300005366 Bacteria 1962
47 Ga0070667_100002650 3300005367 Bacteria 15501
48 Ga0070667_100041161 3300005367 Bacteria 3876
49 Ga0070667_100076134 3300005367 Unclassified 2865
50 Ga0070714_100216335 3300005435 Bacteria 1759
51 Ga0070701_10208700 3300005438 Bacteria 1159
52 Ga0070705_100088781 3300005440 Bacteria 1920
53 Ga0070705_100257698 3300005440 Bacteria 1228
54 Ga0070705_100484648 3300005440 Bacteria 935
55 Ga0070700_100000365 3300005441 Bacteria 23171
56 Ga0070700_100114414 3300005441 Bacteria 1799
57 Ga0070700_100202825 3300005441 Bacteria 1394
58 Ga0070700_100295743 3300005441 Bacteria 1180
59 Ga0070700_100537039 3300005441 Bacteria 906
60 Ga0070708_100002228 3300005445 Bacteria 14985
61 Ga0070708_100038971 3300005445 Bacteria 4155
62 Ga0070708_100067529 3300005445 Bacteria 3211
63 Ga0070708_100214013 3300005445 Bacteria 1806
64 Ga0070708_100322964 3300005445 Bacteria 1454
65 Ga0070678_100000305 3300005456 Bacteria 22821
66 Ga0070678_100090279 3300005456 Bacteria 2348
67 Ga0070678_100120114 3300005456 Bacteria 2071
68 Ga0070662_100070315 3300005457 Bacteria 2579
69 Ga0070681_10049304 3300005458 Bacteria 4206
70 Ga0068867_100000569 3300005459 Bacteria 24440
71 Ga0068867_100012497 3300005459 Bacteria 6010
72 Ga0068867_100016876 3300005459 Bacteria 5189
73 Ga0068867_100099637 3300005459 Bacteria 2217
74 Ga0070706_100006981 3300005467 Bacteria 10652
75 Ga0070706_100039917 3300005467 Bacteria 4333
76 Ga0070707_100123445 3300005468 Bacteria 2515
77 Ga0070707_100249913 3300005468 Bacteria 1726
78 Ga0070699_100011333 3300005518 Bacteria 7699
79 Ga0070699_100286665 3300005518 Bacteria 1476
80 Ga0070679_100365972 3300005530 Bacteria 1389
81 Ga0070684_100030403 3300005535 Unclassified 4588
82 Ga0070697_100084681 3300005536 Bacteria 2615
83 Ga0070697_100107305 3300005536 Bacteria 2323
84 Ga0070672_100003001 3300005543 Bacteria 10877
85 Ga0070672_100003967 3300005543 Bacteria 9647
86 Ga0070672_100136821 3300005543 Bacteria 2018
87 Ga0070672_100213447 3300005543 Bacteria 1617
88 Ga0070686_100001320 3300005544 Bacteria 14033
89 Ga0070695_100054498 3300005545 Bacteria 2574
90 Ga0070695_100057585 3300005545 Bacteria 2511
91 Ga0070695_100076657 3300005545 Bacteria 2202
92 Ga0070696_100014293 3300005546 Bacteria 5325
93 Ga0070696_100123944 3300005546 Bacteria 1873
94 Ga0070696_100387732 3300005546 Bacteria 1090
95 Ga0070696_100426938 3300005546 Bacteria 1042
96 Ga0070693_100030214 3300005547 Bacteria 2961
97 Ga0070665_100090845 3300005548 Bacteria 3059
98 Ga0070665_100834863 3300005548 Bacteria 934
99 Ga0070704_100011594 3300005549 Bacteria 5410
100 Ga0070704_100210277 3300005549 Bacteria 1576
101 Ga0068855_100076101 3300005563 Bacteria 3896
102 Ga0070664_100005309 3300005564 Bacteria 10334
103 Ga0068857_100148339 3300005577 Bacteria 2123
104 Ga0068854_100004873 3300005578 Bacteria 8467
105 Ga0068854_100006626 3300005578 Bacteria 7378
106 Ga0070702_100000173 3300005615 Bacteria 20607
107 Ga0070702_100049496 3300005615 Bacteria 2397
108 Ga0070702_100304605 3300005615 Unclassified 1104
109 Ga0068852_100035301 3300005616 Bacteria 4169
110 Ga0068852_100044663 3300005616 Unclassified 3765
111 Ga0068859_100031746 3300005617 Bacteria 5305
112 Ga0068859_100109299 3300005617 Bacteria 2826
113 Ga0068864_100038763 3300005618 Bacteria 4070
114 Ga0068864_100067878 3300005618 Unclassified 3097
115 Ga0068864_100069725 3300005618 Bacteria 3057
116 Ga0068864_100073263 3300005618 Bacteria 2986
117 Ga0068864_100278550 3300005618 Bacteria 1560
118 Ga0068866_10018635 3300005718 Bacteria 3143
119 Ga0068861_100008434 3300005719 Bacteria 7096
120 Ga0068861_100248090 3300005719 Bacteria 1518
121 Ga0068851_10025766 3300005834 Unclassified 2886
122 Ga0068870_10004607 3300005840 Bacteria 5947
123 Ga0068870_10024054 3300005840 Bacteria 3012
124 Ga0068863_100029961 3300005841 Bacteria 5198
125 Ga0068863_100048364 3300005841 Bacteria 4033
126 Ga0068863_100048431 3300005841 Bacteria 4031
127 Ga0068863_100083206 3300005841 Bacteria 3032
128 Ga0068858_100002333 3300005842 Bacteria 19189
129 Ga0068858_100022944 3300005842 Bacteria 5820
130 Ga0068858_100029690 3300005842 Bacteria 5078
131 Ga0068858_100698482 3300005842 Bacteria 987
132 Ga0068860_100233732 3300005843 Bacteria 1787
133 Ga0068860_100366736 3300005843 Bacteria 1420
134 Ga0068860_100475018 3300005843 Bacteria 1245
135 Ga0081538_10000130 3300005981 Bacteria 77384
136 Ga0081538_10004564 3300005981 Bacteria 12747
137 Ga0081538_10012955 3300005981 Bacteria 6640
138 Ga0081538_10019315 3300005981 Bacteria 5070
139 Ga0081538_10045799 3300005981 Bacteria 2707
140 Ga0081540_1000151 3300005983 Bacteria 71183
141 Ga0081539_10096208 3300005985 Bacteria 1519
142 Ga0075365_10131076 3300006038 Bacteria 1735
143 Ga0070715_10016705 3300006163 Bacteria 2764
144 Ga0097621_100010735 3300006237 Bacteria 6717
145 Ga0097621_100015865 3300006237 Bacteria 5681
146 Ga0097621_100223463 3300006237 Bacteria 1642
147 Ga0097621_100267481 3300006237 Bacteria 1501
148 Ga0068871_100000683 3300006358 Bacteria 23106
149 Ga0068871_100002963 3300006358 Bacteria 11651
150 Ga0068871_100044364 3300006358 Bacteria 3576
151 Ga0068871_100073456 3300006358 Bacteria 2820
152 Ga0068871_100147466 3300006358 Bacteria 2005
153 Ga0075428_100240966 3300006844 Bacteria 1951
154 Ga0075430_100364732 3300006846 Bacteria 1193
155 Ga0075431_100587018 3300006847 Bacteria 1099
156 Ga0075434_100277035 3300006871 Bacteria 1697
157 Ga0075434_100645777 3300006871 Bacteria 1076
158 Ga0068865_100001084 3300006881 Bacteria 15710
159 Ga0068865_100013535 3300006881 Bacteria 5158
160 Ga0068865_100014353 3300006881 Bacteria 5033
161 Ga0068865_100050519 3300006881 Unclassified 2873
162 Ga0068865_100452322 3300006881 Bacteria 1062
163 Ga0075436_100092959 3300006914 Bacteria 2097
164 Ga0097620_100031746 3300006931 Bacteria 5305
165 Ga0097620_100109293 3300006931 Bacteria 2826
166 Ga0099794_10180249 3300007265 Bacteria 1078
167 Ga0105240_10089296 3300009093 Bacteria 3770
168 Ga0105240_10271249 3300009093 Bacteria 1953
169 Ga0111539_10742778 3300009094 Bacteria 1142
170 Ga0105245_10000207 3300009098 Bacteria 55562
171 Ga0105245_10016791 3300009098 Bacteria 6391
172 Ga0105245_10032182 3300009098 Bacteria 4643
173 Ga0105245_10073799 3300009098 Bacteria 3103
174 Ga0105247_10085242 3300009101 Bacteria 1997
175 Ga0114129_10056474 3300009147 Bacteria 5498
176 Ga0114129_10208986 3300009147 Bacteria 2640
177 Ga0114129_10255258 3300009147 Bacteria 2352
178 Ga0114129_10263937 3300009147 Bacteria 2306
179 Ga0105243_10003259 3300009148 Bacteria 13212
180 Ga0105243_10019038 3300009148 Bacteria 5204
181 Ga0105243_10044739 3300009148 Bacteria 3475
182 Ga0105243_10047232 3300009148 Bacteria 3388
183 Ga0105243_10208595 3300009148 Bacteria 1719
184 Ga0105243_10319043 3300009148 Bacteria 1415
185 Ga0105241_10451649 3300009174 Bacteria 1137
186 Ga0105242_10004469 3300009176 Bacteria 10872
187 Ga0105242_10007047 3300009176 Bacteria 8682
188 Ga0105242_10034157 3300009176 Bacteria 4076
189 Ga0105242_10144493 3300009176 Bacteria 2068
190 Ga0105242_10206366 3300009176 Bacteria 1748
191 Ga0105248_10002280 3300009177 Bacteria 21247
192 Ga0105248_10821679 3300009177 Bacteria 1049
193 Ga0105237_10003826 3300009545 Bacteria 17689
194 Ga0105237_10016726 3300009545 Bacteria 7615
195 Ga0105237_10039973 3300009545 Bacteria 4732
196 Ga0105238_10000006 3300009551 Bacteria 346249
197 Ga0105238_10075390 3300009551 Bacteria 3365
198 Ga0105238_10144179 3300009551 Bacteria 2358
199 Ga0105249_10053384 3300009553 Bacteria 3695
200 Ga0105249_10053523 3300009553 Bacteria 3689
201 Ga0105249_10357643 3300009553 Bacteria 1481
202 Ga0105239_10003842 3300010375 Bacteria 18243
203 Ga0105239_10009973 3300010375 Bacteria 10663
204 Ga0105239_10158035 3300010375 Bacteria 2532
205 Ga0105246_10111687 3300011119 Bacteria 2009
206 Ga0157338_1003100 3300012515 Bacteria 1353
207 Ga0157374_10031314 3300013296 Bacteria 4834
208 Ga0157374_10663774 3300013296 Bacteria 1055
209 Ga0157378_10003992 3300013297 Bacteria 13035
210 Ga0157378_10423790 3300013297 Bacteria 1316
211 Ga0157378_10682426 3300013297 Bacteria 1045
212 Ga0157378_10718818 3300013297 Bacteria 1019
213 Ga0163162_10008381 3300013306 Bacteria 10080
214 Ga0163162_10049920 3300013306 Bacteria 4195
215 Ga0163162_10108999 3300013306 Bacteria 2866
216 Ga0163162_10935103 3300013306 Bacteria 979
217 Ga0157375_10023365 3300013308 Bacteria 5705
218 Ga0157375_10100974 3300013308 Bacteria 2967
219 Ga0157375_10301631 3300013308 Bacteria 1765
220 Ga0163163_10150726 3300014325 Bacteria 2369
221 Ga0163163_10195612 3300014325 Unclassified 2070
222 Ga0163163_10286897 3300014325 Bacteria 1698
223 Ga0163163_10565547 3300014325 Bacteria 1200
224 Ga0163163_10703258 3300014325 Bacteria 1074
225 Ga0157380_10005823 3300014326 Bacteria 8629
226 Ga0157380_10006249 3300014326 Bacteria 8364
227 Ga0157380_10314707 3300014326 Bacteria 1448
228 Ga0157380_10531335 3300014326 Bacteria 1149
229 Ga0157377_10046398 3300014745 Bacteria 2430
230 Ga0157377_10085793 3300014745 Bacteria 1849
231 Ga0157377_10149977 3300014745 Bacteria 1440
232 Ga0157379_10516200 3300014968 Bacteria 1109
233 Ga0157376_10007523 3300014969 Bacteria 7783
234 Ga0157376_10066974 3300014969 Bacteria 3036
235 Ga0182006_1000177 3300015261 Bacteria 67337
236 Ga0182007_10004055 3300015262 Bacteria 6743
237 Ga0163161_10100118 3300017792 Bacteria 2156
238 Ga0163161_10379343 3300017792 Bacteria 1130
239 Ga0207697_10005297 3300025315 Bacteria 6007
240 Ga0207682_10002721 3300025893 Bacteria 7847
241 Ga0207682_10016190 3300025893 Bacteria 2906
242 Ga0207682_10035547 3300025893 Bacteria 2013
243 Ga0207642_10005217 3300025899 Bacteria 4232
244 Ga0207642_10066684 3300025899 Bacteria 1696
245 Ga0207688_10327716 3300025901 Bacteria 940
246 Ga0207680_10021258 3300025903 Bacteria 3509
247 Ga0207680_10147636 3300025903 Bacteria 1565
248 Ga0207685_10002775 3300025905 Bacteria 4097
249 Ga0207645_10000973 3300025907 Bacteria 23672
250 Ga0207645_10021969 3300025907 Bacteria 4156
251 Ga0207645_10101173 3300025907 Bacteria 1859
252 Ga0207643_10033492 3300025908 Bacteria 2874
253 Ga0207643_10043788 3300025908 Bacteria 2527
254 Ga0207684_10018151 3300025910 Bacteria 6029
255 Ga0207684_10025804 3300025910 Bacteria 5008
256 Ga0207684_10033585 3300025910 Bacteria 4363
257 Ga0207684_10453726 3300025910 Bacteria 1100
258 Ga0207695_10000827 3300025913 Bacteria 57325
259 Ga0207695_10056846 3300025913 Bacteria 4069
260 Ga0207695_10137688 3300025913 Bacteria 2393
261 Ga0207671_10004302 3300025914 Bacteria 13686
262 Ga0207671_10014843 3300025914 Bacteria 6133
263 Ga0207660_10182190 3300025917 Bacteria 1632
264 Ga0207660_10532480 3300025917 Unclassified 955
265 Ga0207662_10071819 3300025918 Bacteria 2096
266 Ga0207649_10009481 3300025920 Bacteria 5327
267 Ga0207646_10034659 3300025922 Bacteria 4562
268 Ga0207646_10115931 3300025922 Bacteria 2406
269 Ga0207646_10147997 3300025922 Bacteria 2117
270 Ga0207646_10279375 3300025922 Bacteria 1509
271 Ga0207681_10018468 3300025923 Bacteria 4393
272 Ga0207681_10238594 3300025923 Bacteria 1414
273 Ga0207694_10000110 3300025924 Bacteria 85854
274 Ga0207694_10282147 3300025924 Bacteria 1365
275 Ga0207650_10006921 3300025925 Bacteria 7731
276 Ga0207650_10128102 3300025925 Bacteria 1983
277 Ga0207650_10378748 3300025925 Bacteria 1168
278 Ga0207659_10000576 3300025926 Bacteria 22103
279 Ga0207659_10013870 3300025926 Bacteria 5180
280 Ga0207659_10015152 3300025926 Bacteria 4988
281 Ga0207659_10024943 3300025926 Bacteria 4013
282 Ga0207659_10220043 3300025926 Bacteria 1526
283 Ga0207659_10338269 3300025926 Bacteria 1246
284 Ga0207687_10008155 3300025927 Bacteria 6857
285 Ga0207687_10158577 3300025927 Bacteria 1734
286 Ga0207687_10208402 3300025927 Bacteria 1532
287 Ga0207700_10346120 3300025928 Bacteria 1293
288 Ga0207664_10048926 3300025929 Bacteria 3327
289 Ga0207644_10008876 3300025931 Bacteria 6585
290 Ga0207644_10011863 3300025931 Bacteria 5774
291 Ga0207644_10058308 3300025931 Bacteria 2790
292 Ga0207690_10042730 3300025932 Bacteria 2979
293 Ga0207690_10338023 3300025932 Bacteria 1188
294 Ga0207706_10019231 3300025933 Bacteria 6141
295 Ga0207706_10033950 3300025933 Bacteria 4541
296 Ga0207706_10179313 3300025933 Bacteria 1861
297 Ga0207686_10000586 3300025934 Bacteria 22804
298 Ga0207686_10002506 3300025934 Bacteria 9977
299 Ga0207686_10063697 3300025934 Bacteria 2345
300 Ga0207686_10464181 3300025934 Bacteria 976
301 Ga0207709_10027818 3300025935 Bacteria 3263
302 Ga0207709_10091173 3300025935 Bacteria 1992
303 Ga0207670_10195522 3300025936 Bacteria 1533
304 Ga0207670_10488279 3300025936 Bacteria 998
305 Ga0207669_10159364 3300025937 Bacteria 1592
306 Ga0207669_10578027 3300025937 Bacteria 910
307 Ga0207704_10000475 3300025938 Bacteria 17855
308 Ga0207704_10039738 3300025938 Bacteria 2743
309 Ga0207704_10130578 3300025938 Bacteria 1739
310 Ga0207691_10007242 3300025940 Bacteria 10702
311 Ga0207691_10007489 3300025940 Bacteria 10509
312 Ga0207691_10030642 3300025940 Bacteria 5025
313 Ga0207691_10044802 3300025940 Bacteria 4070
314 Ga0207691_10151962 3300025940 Bacteria 2035
315 Ga0207711_10061793 3300025941 Unclassified 3230
316 Ga0207711_10194367 3300025941 Bacteria 1850
317 Ga0207689_10000384 3300025942 Bacteria 41557
318 Ga0207689_10000988 3300025942 Bacteria 27253
319 Ga0207689_10013046 3300025942 Bacteria 7096
320 Ga0207661_10010871 3300025944 Bacteria 6569
321 Ga0207679_10267736 3300025945 Bacteria 1460
322 Ga0207679_10494279 3300025945 Bacteria 1091
323 Ga0207667_10050147 3300025949 Bacteria 4405
324 Ga0207651_10063359 3300025960 Bacteria 2581
325 Ga0207712_10142581 3300025961 Bacteria 1841
326 Ga0207712_10234922 3300025961 Bacteria 1474
327 Ga0207668_10528790 3300025972 Bacteria 1019
328 Ga0207640_10014189 3300025981 Bacteria 4580
329 Ga0207640_10047305 3300025981 Unclassified 2774
330 Ga0207658_10000919 3300025986 Bacteria 24357
331 Ga0207658_10095047 3300025986 Bacteria 2321
332 Ga0207677_10007547 3300026023 Bacteria 6030
333 Ga0207677_10060153 3300026023 Bacteria 2624
334 Ga0207677_10082412 3300026023 Bacteria 2311
335 Ga0207677_10212227 3300026023 Bacteria 1547
336 Ga0207703_10001476 3300026035 Bacteria 21438
337 Ga0207703_10097658 3300026035 Bacteria 2482
338 Ga0207639_10020895 3300026041 Bacteria 4696
339 Ga0207708_10000156 3300026075 Bacteria 54425
340 Ga0207708_10008417 3300026075 Bacteria 7632
341 Ga0207708_10018414 3300026075 Bacteria 5260
342 Ga0207708_10133069 3300026075 Bacteria 1946
343 Ga0207641_10031298 3300026088 Bacteria 4413
344 Ga0207641_10220275 3300026088 Unclassified 1759
345 Ga0207641_10221077 3300026088 Bacteria 1756
346 Ga0207641_10619996 3300026088 Bacteria 1060
347 Ga0207648_10000128 3300026089 Bacteria 75279
348 Ga0207648_10005567 3300026089 Bacteria 12673
349 Ga0207648_10010265 3300026089 Bacteria 8892
350 Ga0207676_10053023 3300026095 Unclassified 3173
351 Ga0207676_10074481 3300026095 Bacteria 2735
352 Ga0207676_10534940 3300026095 Bacteria 1117
353 Ga0207674_10016785 3300026116 Bacteria 8003
354 Ga0207674_10029700 3300026116 Bacteria 5754
355 Ga0207675_100000408 3300026118 Bacteria 41228
356 Ga0207675_100011231 3300026118 Bacteria 8388
357 Ga0207675_100025327 3300026118 Bacteria 5520
358 Ga0207675_100079871 3300026118 Bacteria 3066
359 Ga0207675_100472263 3300026118 Bacteria 1245
360 Ga0207683_10000485 3300026121 Bacteria 36699
361 Ga0207683_10017190 3300026121 Bacteria 6159
362 Ga0207683_10043643 3300026121 Bacteria 3919
363 Ga0207683_10105027 3300026121 Bacteria 2525
364 Ga0207683_10308526 3300026121 Bacteria 1448
365 Ga0207698_10002556 3300026142 Bacteria 10798
366 Ga0207698_10031328 3300026142 Bacteria 3837
367 Ga0268266_10238280 3300028379 Bacteria 1678
368 Ga0268265_10127369 3300028380 Bacteria 2110
369 Ga0268265_10174640 3300028380 Bacteria 1840
370 Ga0268264_10281457 3300028381 Bacteria 1558
371 Ga0268264_10499306 3300028381 Bacteria 1186
372 Ga0265334_10009134 3300028573 Bacteria 4201
373 Ga0265338_10000267 3300028800 Bacteria 95163
374 Ga0307512_10038108 3300030522 Bacteria 4050
375 Ga0265328_10002700 3300031239 Bacteria 7931
376 Ga0265325_10005326 3300031241 Bacteria 7967
377 Ga0265339_10002909 3300031249 Bacteria 12120
378 Ga0265331_10054411 3300031250 Bacteria 1906
379 Ga0265316_10109699 3300031344 Bacteria 2091
380 Ga0307509_10000031 3300031507 Bacteria 205072
381 Ga0307509_10000120 3300031507 Bacteria 114238
382 Ga0307509_10281227 3300031507 Bacteria 1425
383 Ga0265313_10000281 3300031595 Bacteria 55832
384 Ga0316575_10109117 3300031665 Bacteria 1129
385 Ga0265314_10029850 3300031711 Bacteria 4046
386 Ga0307409_100340871 3300031995 Bacteria 1410
387 Ga0307415_100101216 3300032126 Bacteria 2114
388 Ga0307510_10008677 3300033180 Bacteria 12113
389 Ga0307510_10042231 3300033180 Bacteria 4971
390 Ga0373948_0012736 3300034817 Bacteria 1507
391 Ga0373926_0106013 3300035083 Bacteria 1054
392 Ga0373929_0020302 3300035085 Bacteria 1339
393 Ga0373934_0000317 3300035086 Bacteria 16928
394 Ga0373934_0046139 3300035086 Bacteria 1723
395 Ga0373954_0003485 3300035118 Bacteria 6677
396 Ga0373956_0000505 3300035119 Bacteria 15945
397 Ga0373957_0000402 3300035120 Bacteria 11010
398 Ga0373943_0317030 3300035170 Bacteria 888
399 Ga0373955_0000033 3300035172 Bacteria 54239
400 Ga0373955_0271762 3300035172 Bacteria 1019
401 Ga0373924_0001746 3300035410 Bacteria 7175
402 Ga0373924_0215651 3300035410 Bacteria 848
403 Ga0373933_0000011 3300035724 Bacteria 110003
404 Ga0373947_0218591 3300035725 Bacteria 1252
405 Ga0373937_0000021 3300036401 Bacteria 128447
406 Ga0373937_0028960 3300036401 Bacteria 5015
407 Ga0373925_0042583 3300037068 Bacteria 3368
408 Ga0395899_0026110 3300037312 Bacteria 4408
409 Ga0395900_0001291 3300037418 Bacteria 30553
410 Ga0395900_0001589 3300037418 Bacteria 26870
411 Ga0395898_0001382 3300037466 Bacteria 34742
412 Ga0395898_0001958 3300037466 Bacteria 26038
413 Ga0395898_0067853 3300037466 Bacteria 3452
414 Ga0395898_0254974 3300037466 Bacteria 1673
415 Ga0395905_0003055 3300037471 Bacteria 18136
416 Ga0395905_0025905 3300037471 Bacteria 5528
417 Ga0395905_0339787 3300037471 Bacteria 1393
418 Ga0395901_0000365 3300038443 Bacteria 54535
419 Ga0395901_0002616 3300038443 Bacteria 18216
420 Ga0395901_0005244 3300038443 Bacteria 13085
421 Ga0436365_0637699 3300039437 Bacteria 1533
422 Ga0450898_004406 3300042134 Bacteria 2081
423 Ga0439434_0003407 3300042435 Bacteria 4649
424 Ga0439464_0003086 3300042439 Bacteria 4168
425 Ga0451577_0012846 3300042876 Bacteria 7861
426 Ga0451577_0036594 3300042876 Bacteria 4418
427 Ga0451577_0039901 3300042876 Bacteria 4217
428 Ga0451577_0316063 3300042876 Bacteria 1416
429 Ga0453683_0021703 3300044673 Bacteria 4097
430 Ga0466966_0403303 3300044684 Bacteria 822
431 Ga0466961_0041350 3300044693 Bacteria 2955
432 Ga0453684_0000005 3300044712 Bacteria 1431632
433 Ga0453684_0000702 3300044712 Bacteria 118936
434 Ga0453684_0002168 3300044712 Bacteria 49060
435 Ga0453684_0006744 3300044712 Bacteria 21617
436 Ga0453684_0051703 3300044712 Bacteria 5383
437 Ga0466968_0389940 3300044735 Bacteria 681
438 Ga0466970_0016972 3300044765 Bacteria 3758
439 Ga0466959_0139445 3300045049 Bacteria 1715
440 Ga0451576_0000119 3300045051 Bacteria 200621
441 Ga0451576_0001432 3300045051 Bacteria 40803
442 Ga0451576_0021534 3300045051 Bacteria 7008
443 Ga0451576_0027145 3300045051 Bacteria 6153
444 Ga0451576_0061489 3300045051 Bacteria 3916
445 Ga0451576_0475571 3300045051 Bacteria 1312
446 Ga0466958_0056931 3300045836 Bacteria 2376
447 Ga0466958_0063500 3300045836 Bacteria 2252
448 Ga0466967_0424056 3300045976 Bacteria 1297
449 Ga0466967_0550132 3300045976 Bacteria 1136
450 Ga0495592_0000013 3300046454 Bacteria 151780
451 Ga0495592_0000222 3300046454 Bacteria 48902
452 Ga0495592_0022317 3300046454 Bacteria 4816
453 Ga0495638_0045405 3300046460 Bacteria 2764
454 Ga0495651_0000411 3300046462 Bacteria 33201
455 Ga0495651_0007528 3300046462 Bacteria 8329
456 Ga0495653_0016065 3300046463 Bacteria 6102
457 Ga0495653_0028237 3300046463 Bacteria 4487
458 Ga0495608_0000029 3300046511 Bacteria 151790
459 Ga0495608_0002433 3300046511 Bacteria 13387
460 Ga0495628_0000607 3300046516 Bacteria 32960
461 Ga0495628_0024164 3300046516 Bacteria 4977
462 Ga0495628_0339439 3300046516 Bacteria 1106
463 Ga0495630_0070841 3300046517 Bacteria 2623
464 Ga0495630_0080095 3300046517 Bacteria 2463
465 Ga0495630_0513327 3300046517 Bacteria 919
466 Ga0495648_0195205 3300046524 Bacteria 1018
467 Ga0495652_0000083 3300046529 Bacteria 102109
468 Ga0495652_0008902 3300046529 Bacteria 9134
469 Ga0495587_0000022 3300046536 Bacteria 151790
470 Ga0495587_0026391 3300046536 Bacteria 3543
471 Ga0495667_0000028 3300046559 Bacteria 151705
472 Ga0495667_0000527 3300046559 Bacteria 24480
473 Ga0495635_0021822 3300046663 Bacteria 4463
474 Ga0495657_0000591 3300046675 Bacteria 33189
475 Ga0495657_0006749 3300046675 Bacteria 8951
476 Ga0495599_0000262 3300046678 Bacteria 33196
477 Ga0495599_0014266 3300046678 Bacteria 4919
478 Ga0495599_0110380 3300046678 Bacteria 1713
479 Ga0495599_0134779 3300046678 Bacteria 1533
480 Ga0495623_0000070 3300046679 Bacteria 62394
481 Ga0495646_0001500 3300046680 Bacteria 13904
482 Ga0495600_0014140 3300046809 Bacteria 5027
483 Ga0495600_0025581 3300046809 Bacteria 3804
484 Ga0495604_0000023 3300047317 Bacteria 151689
485 Ga0495604_0011566 3300047317 Bacteria 7014
486 Ga0495674_0147417 3300047319 Bacteria 1975
487 Ga0495674_0220847 3300047319 Bacteria 1566
488 Ga0495680_0000469 3300047322 Bacteria 45409
489 Ga0495680_0009491 3300047322 Bacteria 8744
490 Ga0495675_0003000 3300047444 Bacteria 10130
491 Ga0495684_0049633 3300047471 Bacteria 3205
492 Ga0495602_0000627 3300048088 Bacteria 33109
493 Ga0495602_0012291 3300048088 Bacteria 8810
494 Ga0495602_0390570 3300048088 Bacteria 994
495 Ga0496100_0102817 3300048903 Unclassified 1972
496 Ga0496100_0412532 3300048903 Bacteria 1030
497 Ga0496101_0184404 3300048904 Unclassified 1608
498 Ga0496102_0082348 3300048905 Bacteria 2967
499 Ga0496102_0306758 3300048905 Bacteria 1496
500 Ga0496102_0418503 3300048905 Unclassified 1259
501 Ga0496102_0568195 3300048905 Bacteria 1057
502 Ga0496104_0069086 3300048907 Bacteria 3357
503 Ga0496105_0003824 3300048908 Bacteria 11233
504 Ga0496105_0029515 3300048908 Bacteria 4489
505 Ga0496105_0064673 3300048908 Bacteria 3018
506 Ga0496105_0160338 3300048908 Bacteria 1847
507 Ga0496106_0173332 3300048909 Bacteria 1711
508 Ga0496106_0224018 3300048909 Bacteria 1500
509 Ga0496107_0457033 3300048910 Bacteria 948
510 Ga0496108_0046628 3300048911 Bacteria 3621
511 Ga0496108_0049299 3300048911 Unclassified 3522
512 Ga0496108_0062104 3300048911 Bacteria 3146
513 Ga0496109_0027866 3300048912 Bacteria 5049
514 Ga0496109_0227319 3300048912 Bacteria 1755
515 Ga0496110_0010154 3300048913 Bacteria 7649
516 Ga0496110_0075313 3300048913 Bacteria 2999
517 Ga0496110_0121270 3300048913 Bacteria 2355
518 Ga0496110_0390866 3300048913 Bacteria 1268
519 Ga0496110_0509903 3300048913 Bacteria 1095
520 Ga0496110_0559210 3300048913 Bacteria 1039
521 Ga0496110_1016233 3300048913 Bacteria 737
522 Ga0496113_0135359 3300048916 Bacteria 1936
523 Ga0496114_0199472 3300048917 Bacteria 1752
524 Ga0496114_0249581 3300048917 Bacteria 1561
525 Ga0496125_0224490 3300048928 Bacteria 1207
526 Ga0501034_0102675 3300049571 Bacteria 2853
527 Ga0501034_0176373 3300049571 Bacteria 2103
528 Ga0501036_0085249 3300049572 Bacteria 2670
529 Ga0501037_0087490 3300049573 Bacteria 2255
530 Ga0501037_0239717 3300049573 Bacteria 1271
531 Ga0501040_0093208 3300049576 Bacteria 2095
532 Ga0501041_0072539 3300049577 Bacteria 2115
533 Ga0501043_0142845 3300049579 Bacteria 1874
534 Ga0501046_0152135 3300049580 Bacteria 1745
535 Ga0501048_0188918 3300049582 Bacteria 1460
536 Ga0501071_0041630 3300049587 Bacteria 3290
537 Ga0501071_0405086 3300049587 Bacteria 1042
538 Ga0501072_0065340 3300049588 Bacteria 2869
539 Ga0501072_0187143 3300049588 Bacteria 1651
540 Ga0501072_0529159 3300049588 Bacteria 932
541 Ga0501073_0000117 3300049589 Bacteria 50986
542 Ga0501073_0335497 3300049589 Bacteria 1044
543 Ga0501074_0065365 3300049590 Bacteria 2618
544 Ga0501074_0144218 3300049590 Bacteria 1703
545 Ga0501074_0209715 3300049590 Bacteria 1388
546 Ga0501075_0018470 3300049591 Bacteria 5048
547 Ga0501075_0120948 3300049591 Bacteria 1993
548 Ga0501076_0006320 3300049592 Bacteria 8584
549 Ga0501076_0216399 3300049592 Bacteria 1566
550 Ga0501077_0022344 3300049593 Bacteria 4006
551 Ga0501079_0014387 3300049741 Bacteria 6032
552 Ga0501079_0036420 3300049741 Bacteria 3790
553 Ga0501079_0137089 3300049741 Bacteria 1906
554 Ga0501080_0045745 3300049742 Bacteria 4074
555 Ga0501080_0363153 3300049742 Bacteria 1306
556 Ga0501081_0184765 3300049743 Bacteria 1508
557 Ga0501081_0453101 3300049743 Bacteria 953
558 Ga0501035_0208342 3300049822 Bacteria 1674
559 Ga0501045_0325621 3300049824 Bacteria 1143
560 nmdc:mga03n38_171062_c1 3300050490 Bacteria 1106
561 nmdc:mga0k408_85797_c2 3300050493 Bacteria 1319
562 nmdc:mga07m45_62187_c1 3300050496 Bacteria 2115
563 nmdc:mga05p37_402287_c1 3300050507 Bacteria 1598
564 nmdc:mga05p37_425772_c1 3300050507 Bacteria 1543
565 nmdc:mga05p37_55948_c1 3300050507 Bacteria 4856
566 nmdc:mga05p37_8804_c1 3300050507 Bacteria 11926
567 nmdc:mga09592_224716_c1 3300050508 Bacteria 1626
568 nmdc:mga08y16_499243_c1 3300050511 Bacteria 1236
569 nmdc:mga0n895_372471_c1 3300050512 Bacteria 1445
570 nmdc:mga0rr50_538218_c1 3300050513 Bacteria 994
571 nmdc:mga0rr50_755252_c1 3300050513 Bacteria 830
572 Ga0495595_0018429 3300053084 Bacteria 3016
573 Ga0495619_0022457 3300053085 Bacteria 4039
574 Ga0495619_0030527 3300053085 Bacteria 3489
575 Ga0500644_0008882 3300053088 Bacteria 2667
576 Ga0500647_0210447 3300053091 Bacteria 877
577 Ga0500651_0065647 3300053093 Bacteria 2261
578 Ga0500559_0000011 3300053136 Bacteria 164751
579 Ga0500622_0228908 3300053156 Bacteria 829
580 Ga0501084_0100843 3300054114 Bacteria 2424
581 Ga0530510_0064832 3300061734 Bacteria 2646
582 Ga0530510_0145279 3300061734 Bacteria 1750
583 2891634628 2891633521 Bacteria 4602265
584 639786843 639633007 Bacteria 4376040
585 Ga0501045_0398220
586 MRS1b_contig_1910819
587 JGI25407J50210_10002560
588 JGI25404J52841_10044109
589 Ga0070676_10224384
590 Ga0070683_100000896
591 Ga0070690_100003496
592 Ga0070690_100047126
593 Ga0070690_100078619
594 Ga0070670_100012138
595 Ga0070670_100146426
596 Ga0070677_10005783
597 Ga0070677_10010682
598 Ga0068869_100001092
599 Ga0068869_100019711
600 Ga0070666_10028864
601 Ga0070680_100017701
602 Ga0070680_100122266
603 Ga0068868_100007891
604 Ga0068868_100019915
605 Ga0068868_100092562
606 Ga0068868_100206612
607 Ga0068868_100479377
608 Ga0070660_100126830
609 Ga0070689_100001270
610 Ga0070691_10013858
611 Ga0070687_100065952
612 Ga0070687_100192612
613 Ga0070661_100009455
614 Ga0070692_10017031
615 Ga0070692_10079354
616 Ga0070669_100047530
617 Ga0070669_100104440
618 Ga0070669_100109986
619 Ga0070675_100002728
620 Ga0070675_100030142
621 Ga0070675_100112288
622 Ga0070675_100201654
623 Ga0070675_100285329
624 Ga0070671_100002418
625 Ga0070671_100208974
626 Ga0070674_100369402
627 Ga0070673_100004156
628 Ga0070673_100074502
629 Ga0070673_100495160
630 Ga0070659_100141108
631 Ga0070667_100002650
632 Ga0070667_100041161
633 Ga0070667_100076134
634 Ga0070714_100216335
635 Ga0070701_10208700
636 Ga0070705_100088781
637 Ga0070705_100257698
638 Ga0070705_100484648
639 Ga0070700_100000365
640 Ga0070700_100114414
641 Ga0070700_100202825
642 Ga0070700_100295743
643 Ga0070700_100537039
644 Ga0070708_100002228
645 Ga0070708_100038971
646 Ga0070708_100067529
647 Ga0070708_100214013
648 Ga0070708_100322964
649 Ga0070678_100000305
650 Ga0070678_100090279
651 Ga0070678_100120114
652 Ga0070662_100070315
653 Ga0070681_10049304
654 Ga0068867_100000569
655 Ga0068867_100012497
656 Ga0068867_100016876
657 Ga0068867_100099637
658 Ga0070706_100006981
659 Ga0070706_100039917
660 Ga0070707_100123445
661 Ga0070707_100249913
662 Ga0070699_100011333
663 Ga0070699_100286665
664 Ga0070679_100365972
665 Ga0070684_100030403
666 Ga0070697_100084681
667 Ga0070697_100107305
668 Ga0070672_100003001
669 Ga0070672_100003967
670 Ga0070672_100136821
671 Ga0070672_100213447
672 Ga0070686_100001320
673 Ga0070695_100054498
674 Ga0070695_100057585
675 Ga0070695_100076657
676 Ga0070696_100014293
677 Ga0070696_100123944
678 Ga0070696_100387732
679 Ga0070696_100426938
680 Ga0070693_100030214
681 Ga0070665_100090845
682 Ga0070665_100834863
683 Ga0070704_100011594
684 Ga0070704_100210277
685 Ga0068855_100076101
686 Ga0070664_100005309
687 Ga0068857_100148339
688 Ga0068854_100004873
689 Ga0068854_100006626
690 Ga0070702_100000173
691 Ga0070702_100049496
692 Ga0070702_100304605
693 Ga0068852_100035301
694 Ga0068852_100044663
695 Ga0068859_100031746
696 Ga0068859_100109299
697 Ga0068864_100038763
698 Ga0068864_100067878
699 Ga0068864_100069725
700 Ga0068864_100073263
701 Ga0068864_100278550
702 Ga0068866_10018635
703 Ga0068861_100008434
704 Ga0068861_100248090
705 Ga0068851_10025766
706 Ga0068870_10004607
707 Ga0068870_10024054
708 Ga0068863_100029961
709 Ga0068863_100048364
710 Ga0068863_100048431
711 Ga0068863_100083206
712 Ga0068858_100002333
713 Ga0068858_100022944
714 Ga0068858_100029690
715 Ga0068858_100698482
716 Ga0068860_100233732
717 Ga0068860_100366736
718 Ga0068860_100475018
719 Ga0081538_10000130
720 Ga0081538_10004564
721 Ga0081538_10012955
722 Ga0081538_10019315
723 Ga0081538_10045799
724 Ga0081540_1000151
725 Ga0081539_10096208
726 Ga0075365_10131076
727 Ga0070715_10016705
728 Ga0097621_100010735
729 Ga0097621_100015865
730 Ga0097621_100223463
731 Ga0097621_100267481
732 Ga0068871_100000683
733 Ga0068871_100002963
734 Ga0068871_100044364
735 Ga0068871_100073456
736 Ga0068871_100147466
737 Ga0075428_100240966
738 Ga0075430_100364732
739 Ga0075431_100587018
740 Ga0075434_100277035
741 Ga0075434_100645777
742 Ga0068865_100001084
743 Ga0068865_100013535
744 Ga0068865_100014353
745 Ga0068865_100050519
746 Ga0068865_100452322
747 Ga0075436_100092959
748 Ga0097620_100031746
749 Ga0097620_100109293
750 Ga0099794_10180249
751 Ga0105240_10089296
752 Ga0105240_10271249
753 Ga0111539_10742778
754 Ga0105245_10000207
755 Ga0105245_10016791
756 Ga0105245_10032182
757 Ga0105245_10073799
758 Ga0105247_10085242
759 Ga0114129_10056474
760 Ga0114129_10208986
761 Ga0114129_10255258
762 Ga0114129_10263937
763 Ga0105243_10003259
764 Ga0105243_10019038
765 Ga0105243_10044739
766 Ga0105243_10047232
767 Ga0105243_10208595
768 Ga0105243_10319043
769 Ga0105241_10451649
770 Ga0105242_10004469
771 Ga0105242_10007047
772 Ga0105242_10034157
773 Ga0105242_10144493
774 Ga0105242_10206366
775 Ga0105248_10002280
776 Ga0105248_10821679
777 Ga0105237_10003826
778 Ga0105237_10016726
779 Ga0105237_10039973
780 Ga0105238_10000006
781 Ga0105238_10075390
782 Ga0105238_10144179
783 Ga0105249_10053384
784 Ga0105249_10053523
785 Ga0105249_10357643
786 Ga0105239_10003842
787 Ga0105239_10009973
788 Ga0105239_10158035
789 Ga0105246_10111687
790 Ga0157338_1003100
791 Ga0157374_10031314
792 Ga0157374_10663774
793 Ga0157378_10003992
794 Ga0157378_10423790
795 Ga0157378_10682426
796 Ga0157378_10718818
797 Ga0163162_10008381
798 Ga0163162_10049920
799 Ga0163162_10108999
800 Ga0163162_10935103
801 Ga0157375_10023365
802 Ga0157375_10100974
803 Ga0157375_10301631
804 Ga0163163_10150726
805 Ga0163163_10195612
806 Ga0163163_10286897
807 Ga0163163_10565547
808 Ga0163163_10703258
809 Ga0157380_10005823
810 Ga0157380_10006249
811 Ga0157380_10314707
812 Ga0157380_10531335
813 Ga0157377_10046398
814 Ga0157377_10085793
815 Ga0157377_10149977
816 Ga0157379_10516200
817 Ga0157376_10007523
818 Ga0157376_10066974
819 Ga0182006_1000177
820 Ga0182007_10004055
821 Ga0163161_10100118
822 Ga0163161_10379343
823 Ga0207697_10005297
824 Ga0207682_10002721
825 Ga0207682_10016190
826 Ga0207682_10035547
827 Ga0207642_10005217
828 Ga0207642_10066684
829 Ga0207688_10327716
830 Ga0207680_10021258
831 Ga0207680_10147636
832 Ga0207685_10002775
833 Ga0207645_10000973
834 Ga0207645_10021969
835 Ga0207645_10101173
836 Ga0207643_10033492
837 Ga0207643_10043788
838 Ga0207684_10018151
839 Ga0207684_10025804
840 Ga0207684_10033585
841 Ga0207684_10453726
842 Ga0207695_10000827
843 Ga0207695_10056846
844 Ga0207695_10137688
845 Ga0207671_10004302
846 Ga0207671_10014843
847 Ga0207660_10182190
848 Ga0207660_10532480
849 Ga0207662_10071819
850 Ga0207649_10009481
851 Ga0207646_10034659
852 Ga0207646_10115931
853 Ga0207646_10147997
854 Ga0207646_10279375
855 Ga0207681_10018468
856 Ga0207681_10238594
857 Ga0207694_10000110
858 Ga0207694_10282147
859 Ga0207650_10006921
860 Ga0207650_10128102
861 Ga0207650_10378748
862 Ga0207659_10000576
863 Ga0207659_10013870
864 Ga0207659_10015152
865 Ga0207659_10024943
866 Ga0207659_10220043
867 Ga0207659_10338269
868 Ga0207687_10008155
869 Ga0207687_10158577
870 Ga0207687_10208402
871 Ga0207700_10346120
872 Ga0207664_10048926
873 Ga0207644_10008876
874 Ga0207644_10011863
875 Ga0207644_10058308
876 Ga0207690_10042730
877 Ga0207690_10338023
878 Ga0207706_10019231
879 Ga0207706_10033950
880 Ga0207706_10179313
881 Ga0207686_10000586
882 Ga0207686_10002506
883 Ga0207686_10063697
884 Ga0207686_10464181
885 Ga0207709_10027818
886 Ga0207709_10091173
887 Ga0207670_10195522
888 Ga0207670_10488279
889 Ga0207669_10159364
890 Ga0207669_10578027
891 Ga0207704_10000475
892 Ga0207704_10039738
893 Ga0207704_10130578
894 Ga0207691_10007242
895 Ga0207691_10007489
896 Ga0207691_10030642
897 Ga0207691_10044802
898 Ga0207691_10151962
899 Ga0207711_10061793
900 Ga0207711_10194367
901 Ga0207689_10000384
902 Ga0207689_10000988
903 Ga0207689_10013046
904 Ga0207661_10010871
905 Ga0207679_10267736
906 Ga0207679_10494279
907 Ga0207667_10050147
908 Ga0207651_10063359
909 Ga0207712_10142581
910 Ga0207712_10234922
911 Ga0207668_10528790
912 Ga0207640_10014189
913 Ga0207640_10047305
914 Ga0207658_10000919
915 Ga0207658_10095047
916 Ga0207677_10007547
917 Ga0207677_10060153
918 Ga0207677_10082412
919 Ga0207677_10212227
920 Ga0207703_10001476
921 Ga0207703_10097658
922 Ga0207639_10020895
923 Ga0207708_10000156
924 Ga0207708_10008417
925 Ga0207708_10018414
926 Ga0207708_10133069
927 Ga0207641_10031298
928 Ga0207641_10220275
929 Ga0207641_10221077
930 Ga0207641_10619996
931 Ga0207648_10000128
932 Ga0207648_10005567
933 Ga0207648_10010265
934 Ga0207676_10053023
935 Ga0207676_10074481
936 Ga0207676_10534940
937 Ga0207674_10016785
938 Ga0207674_10029700
939 Ga0207675_100000408
940 Ga0207675_100011231
941 Ga0207675_100025327
942 Ga0207675_100079871
943 Ga0207675_100472263
944 Ga0207683_10000485
945 Ga0207683_10017190
946 Ga0207683_10043643
947 Ga0207683_10105027
948 Ga0207683_10308526
949 Ga0207698_10002556
950 Ga0207698_10031328
951 Ga0268266_10238280
952 Ga0268265_10127369
953 Ga0268265_10174640
954 Ga0268264_10281457
955 Ga0268264_10499306
956 Ga0265334_10009134
957 Ga0265338_10000267
958 Ga0307512_10038108
959 Ga0265328_10002700
960 Ga0265325_10005326
961 Ga0265339_10002909
962 Ga0265331_10054411
963 Ga0265316_10109699
964 Ga0307509_10000031
965 Ga0307509_10000120
966 Ga0307509_10281227
967 Ga0265313_10000281
968 Ga0316575_10109117
969 Ga0265314_10029850
970 Ga0307409_100340871
971 Ga0307415_100101216
972 Ga0307510_10008677
973 Ga0307510_10042231
974 Ga0373948_0012736
975 Ga0373926_0106013
976 Ga0373929_0020302
977 Ga0373934_0000317
978 Ga0373934_0046139
979 Ga0373954_0003485
980 Ga0373956_0000505
981 Ga0373957_0000402
982 Ga0373943_0317030
983 Ga0373955_0000033
984 Ga0373955_0271762
985 Ga0373924_0001746
986 Ga0373924_0215651
987 Ga0373933_0000011
988 Ga0373947_0218591
989 Ga0373937_0000021
990 Ga0373937_0028960
991 Ga0373925_0042583
992 Ga0395899_0026110
993 Ga0395900_0001291
994 Ga0395900_0001589
995 Ga0395898_0001382
996 Ga0395898_0001958
997 Ga0395898_0067853
998 Ga0395898_0254974
999 Ga0395905_0003055
1000 Ga0395905_0025905
1001 Ga0395905_0339787
1002 Ga0395901_0000365
1003 Ga0395901_0002616
1004 Ga0395901_0005244
1005 Ga0436365_0637699
1006 Ga0450898_004406
1007 Ga0439434_0003407
1008 Ga0439464_0003086
1009 Ga0451577_0012846
1010 Ga0451577_0036594
1011 Ga0451577_0039901
1012 Ga0451577_0316063
1013 Ga0453683_0021703
1014 Ga0466966_0403303
1015 Ga0466961_0041350
1016 Ga0453684_0000005
1017 Ga0453684_0000702
1018 Ga0453684_0002168
1019 Ga0453684_0006744
1020 Ga0453684_0051703
1021 Ga0466968_0389940
1022 Ga0466970_0016972
1023 Ga0466959_0139445
1024 Ga0451576_0000119
1025 Ga0451576_0001432
1026 Ga0451576_0021534
1027 Ga0451576_0027145
1028 Ga0451576_0061489
1029 Ga0451576_0475571
1030 Ga0466958_0056931
1031 Ga0466958_0063500
1032 Ga0466967_0424056
1033 Ga0466967_0550132
1034 Ga0495592_0000013
1035 Ga0495592_0000222
1036 Ga0495592_0022317
1037 Ga0495638_0045405
1038 Ga0495651_0000411
1039 Ga0495651_0007528
1040 Ga0495653_0016065
1041 Ga0495653_0028237
1042 Ga0495608_0000029
1043 Ga0495608_0002433
1044 Ga0495628_0000607
1045 Ga0495628_0024164
1046 Ga0495628_0339439
1047 Ga0495630_0070841
1048 Ga0495630_0080095
1049 Ga0495630_0513327
1050 Ga0495648_0195205
1051 Ga0495652_0000083
1052 Ga0495652_0008902
1053 Ga0495587_0000022
1054 Ga0495587_0026391
1055 Ga0495667_0000028
1056 Ga0495667_0000527
1057 Ga0495635_0021822
1058 Ga0495657_0000591
1059 Ga0495657_0006749
1060 Ga0495599_0000262
1061 Ga0495599_0014266
1062 Ga0495599_0110380
1063 Ga0495599_0134779
1064 Ga0495623_0000070
1065 Ga0495646_0001500
1066 Ga0495600_0014140
1067 Ga0495600_0025581
1068 Ga0495604_0000023
1069 Ga0495604_0011566
1070 Ga0495674_0147417
1071 Ga0495674_0220847
1072 Ga0495680_0000469
1073 Ga0495680_0009491
1074 Ga0495675_0003000
1075 Ga0495684_0049633
1076 Ga0495602_0000627
1077 Ga0495602_0012291
1078 Ga0495602_0390570
1079 Ga0496100_0102817
1080 Ga0496100_0412532
1081 Ga0496101_0184404
1082 Ga0496102_0082348
1083 Ga0496102_0306758
1084 Ga0496102_0418503
1085 Ga0496102_0568195
1086 Ga0496104_0069086
1087 Ga0496105_0003824
1088 Ga0496105_0029515
1089 Ga0496105_0064673
1090 Ga0496105_0160338
1091 Ga0496106_0173332
1092 Ga0496106_0224018
1093 Ga0496107_0457033
1094 Ga0496108_0046628
1095 Ga0496108_0049299
1096 Ga0496108_0062104
1097 Ga0496109_0027866
1098 Ga0496109_0227319
1099 Ga0496110_0010154
1100 Ga0496110_0075313
1101 Ga0496110_0121270
1102 Ga0496110_0390866
1103 Ga0496110_0509903
1104 Ga0496110_0559210
1105 Ga0496110_1016233
1106 Ga0496113_0135359
1107 Ga0496114_0199472
1108 Ga0496114_0249581
1109 Ga0496125_0224490
1110 Ga0501034_0102675
1111 Ga0501034_0176373
1112 Ga0501036_0085249
1113 Ga0501037_0087490
1114 Ga0501037_0239717
1115 Ga0501040_0093208
1116 Ga0501041_0072539
1117 Ga0501043_0142845
1118 Ga0501046_0152135
1119 Ga0501048_0188918
1120 Ga0501071_0041630
1121 Ga0501071_0405086
1122 Ga0501072_0065340
1123 Ga0501072_0187143
1124 Ga0501072_0529159
1125 Ga0501073_0000117
1126 Ga0501073_0335497
1127 Ga0501074_0065365
1128 Ga0501074_0144218
1129 Ga0501074_0209715
1130 Ga0501075_0018470
1131 Ga0501075_0120948
1132 Ga0501076_0006320
1133 Ga0501076_0216399
1134 Ga0501077_0022344
1135 Ga0501079_0014387
1136 Ga0501079_0036420
1137 Ga0501079_0137089
1138 Ga0501080_0045745
1139 Ga0501080_0363153
1140 Ga0501081_0184765
1141 Ga0501081_0453101
1142 Ga0501035_0208342
1143 Ga0501045_0325621
1144 nmdc:mga03n38_171062_c1
1145 nmdc:mga0k408_85797_c2
1146 nmdc:mga07m45_62187_c1
1147 nmdc:mga05p37_402287_c1
1148 nmdc:mga05p37_425772_c1
1149 nmdc:mga05p37_55948_c1
1150 nmdc:mga05p37_8804_c1
1151 nmdc:mga09592_224716_c1
1152 nmdc:mga08y16_499243_c1
1153 nmdc:mga0n895_372471_c1
1154 nmdc:mga0rr50_538218_c1
1155 nmdc:mga0rr50_755252_c1
1156 Ga0495595_0018429
1157 Ga0495619_0022457
1158 Ga0495619_0030527
1159 Ga0500644_0008882
1160 Ga0500647_0210447
1161 Ga0500651_0065647
1162 Ga0500559_0000011
1163 Ga0500622_0228908
1164 Ga0501084_0100843
1165 Ga0530510_0064832
1166 Ga0530510_0145279
1167 2891634628
1168 639786843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

47

297

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

52

251

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9837 13 264
3l3s-assembly2.cif.gz_F crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.97 14 247
3l3s-assembly4.cif.gz_L crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.9691 14 246
3l3s-assembly4.cif.gz_J crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.9654 14 246
3l3s-assembly1.cif.gz_C crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.964 14 246
ID Description Score Start End Superfamily
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9875 13 209 3.90.226.10
3mybB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9862 210 264 1.10.12.10
2vx2D02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9808 212 264 1.10.12.10
2vx2E02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9798 212 265 1.10.12.10
2vx2F02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9761 212 265 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A2G6HP14-F1-model_v4 deleted 0.998 13 202
AF-A0A3B9C8F6-F1-model_v4 deleted 0.9958 13 218
AF-A0A661F146-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9955 13 265 GO:0004300
GO:0006631
AF-A0A519IDY8-F1-model_v4 deleted 0.9948 27 194
AF-A0A2D7KXY9-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9937 12 265 GO:0006631
GO:0016836

Map