F466349

General Info

Members Datasets Scaffolds Average Seq Length
584 263 1168 139

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10336394|Ga0075368_103363942
Length 135
Sequence VTYFADAQEVYGTLGRMLEIAGADGDLGMQQANTVVRSEYSEPDSVITISLRPGESRVDFGDSDLEPEIVMSMRADVAHRFWLGEVNVPLALARGDMQATGPTAKILRFVPLLKPVFPRYRELLVEQGREDLARA

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 4.79
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 12.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10336394 3300006042 Bacteria 656
2 JGI24744J21845_10071187 3300002077 Bacteria 635
3 JGI24742J22300_10051460 3300002244 Bacteria 747
4 JGI25407J50210_10000100 3300003373 Bacteria 11811
5 JGI25407J50210_10001025 3300003373 Bacteria 6109
6 JGI25407J50210_10042291 3300003373 Bacteria 1166
7 JGI25407J50210_10134421 3300003373 Unclassified 609
8 Ga0058863_11799775 3300004799 Bacteria 622
9 Ga0070676_10439555 3300005328 Bacteria 915
10 Ga0070683_100080822 3300005329 Bacteria 3042
11 Ga0070683_101033249 3300005329 Bacteria 789
12 Ga0068869_100216918 3300005334 Unclassified 1515
13 Ga0068869_100370501 3300005334 Bacteria 1172
14 Ga0070680_100787783 3300005336 Bacteria 819
15 Ga0070680_101036383 3300005336 Bacteria 709
16 Ga0070680_101507426 3300005336 Bacteria 582
17 Ga0070682_100010011 3300005337 Bacteria 5370
18 Ga0068868_100006100 3300005338 Bacteria 8515
19 Ga0070660_100569864 3300005339 Bacteria 945
20 Ga0070660_101947429 3300005339 Bacteria 501
21 Ga0070691_10053830 3300005341 Bacteria 1926
22 Ga0070691_10302085 3300005341 Bacteria 875
23 Ga0070687_100250440 3300005343 Bacteria 1100
24 Ga0070661_100286933 3300005344 Bacteria 1278
25 Ga0070692_10131248 3300005345 Bacteria 1408
26 Ga0070668_100001272 3300005347 Bacteria 18008
27 Ga0070668_100237772 3300005347 Bacteria 1508
28 Ga0070671_100230241 3300005355 Bacteria 1572
29 Ga0070674_100047671 3300005356 Bacteria 2938
30 Ga0070674_100079397 3300005356 Bacteria 2341
31 Ga0070674_100325405 3300005356 Bacteria 1234
32 Ga0070674_101374200 3300005356 Bacteria 632
33 Ga0070673_100326398 3300005364 Bacteria 1357
34 Ga0070688_100454570 3300005365 Bacteria 958
35 Ga0070659_100350313 3300005366 Bacteria 1239
36 Ga0070667_101619937 3300005367 Bacteria 608
37 Ga0070703_10082712 3300005406 Bacteria 1097
38 Ga0070714_100844176 3300005435 Bacteria 888
39 Ga0070713_101499724 3300005436 Unclassified 654
40 Ga0070710_10016754 3300005437 Bacteria 3736
41 Ga0070701_10861201 3300005438 Bacteria 623
42 Ga0070711_100496424 3300005439 Bacteria 1006
43 Ga0070705_100171780 3300005440 Bacteria 1460
44 Ga0070705_100671663 3300005440 Bacteria 810
45 Ga0070705_100855430 3300005440 Bacteria 728
46 Ga0070705_100864049 3300005440 Bacteria 725
47 Ga0070705_101052411 3300005440 Bacteria 663
48 Ga0070700_100010802 3300005441 Bacteria 5047
49 Ga0070700_100021971 3300005441 Bacteria 3714
50 Ga0070700_101170805 3300005441 Bacteria 641
51 Ga0070694_100076400 3300005444 Bacteria 2318
52 Ga0070694_100100879 3300005444 Unclassified 2042
53 Ga0070694_100125115 3300005444 Bacteria 1850
54 Ga0070694_100321572 3300005444 Bacteria 1191
55 Ga0070694_100378029 3300005444 Bacteria 1104
56 Ga0070694_100404754 3300005444 Unclassified 1069
57 Ga0070708_101594395 3300005445 Bacteria 608
58 Ga0070678_100119496 3300005456 Bacteria 2076
59 Ga0070678_101594350 3300005456 Bacteria 613
60 Ga0070662_100021603 3300005457 Bacteria 4396
61 Ga0070662_100118511 3300005457 Bacteria 2026
62 Ga0068867_100067098 3300005459 Bacteria 2674
63 Ga0070685_10007771 3300005466 Bacteria 5488
64 Ga0070699_100306608 3300005518 Unclassified 1425
65 Ga0070699_101549135 3300005518 Bacteria 607
66 Ga0070684_100001904 3300005535 Bacteria 15292
67 Ga0068853_100448502 3300005539 Bacteria 1213
68 Ga0068853_101133221 3300005539 Bacteria 755
69 Ga0070686_100579220 3300005544 Bacteria 881
70 Ga0070695_100614302 3300005545 Bacteria 855
71 Ga0070695_100880616 3300005545 Bacteria 722
72 Ga0070696_100045564 3300005546 Bacteria 3039
73 Ga0070696_100081425 3300005546 Bacteria 2294
74 Ga0070696_100341090 3300005546 Bacteria 1158
75 Ga0070696_101494786 3300005546 Unclassified 578
76 Ga0070693_100225876 3300005547 Bacteria 1229
77 Ga0070665_101501068 3300005548 Bacteria 682
78 Ga0070704_100101516 3300005549 Bacteria 2169
79 Ga0068855_101277247 3300005563 Bacteria 761
80 Ga0070664_100035371 3300005564 Bacteria 4193
81 Ga0068857_100884059 3300005577 Bacteria 856
82 Ga0068854_101401551 3300005578 Unclassified 632
83 Ga0068856_100111406 3300005614 Bacteria 2734
84 Ga0070702_100210309 3300005615 Bacteria 1294
85 Ga0068852_100069346 3300005616 Bacteria 3090
86 Ga0068859_100382368 3300005617 Bacteria 1503
87 Ga0068864_100017259 3300005618 Bacteria 6018
88 Ga0068866_10075667 3300005718 Bacteria 1793
89 Ga0068866_10537716 3300005718 Bacteria 779
90 Ga0068861_100117025 3300005719 Bacteria 2144
91 Ga0068861_100381851 3300005719 Bacteria 1245
92 Ga0068861_100551647 3300005719 Archaea 1050
93 Ga0068851_10074985 3300005834 Bacteria 1757
94 Ga0068870_10234261 3300005840 Bacteria 1130
95 Ga0068863_100439513 3300005841 Bacteria 1279
96 Ga0068858_100188444 3300005842 Bacteria 1949
97 Ga0068860_101464789 3300005843 Bacteria 704
98 Ga0068860_101636122 3300005843 Bacteria 666
99 Ga0068860_101888342 3300005843 Bacteria 619
100 Ga0068862_100311370 3300005844 Bacteria 1451
101 Ga0068862_100860233 3300005844 Unclassified 889
102 Ga0081455_10179270 3300005937 Bacteria 1606
103 Ga0081455_10357287 3300005937 Bacteria 1028
104 Ga0081538_10000313 3300005981 Bacteria 55735
105 Ga0081538_10000338 3300005981 Bacteria 53185
106 Ga0081538_10000396 3300005981 Bacteria 49639
107 Ga0081538_10001266 3300005981 Bacteria 26342
108 Ga0081538_10002078 3300005981 Bacteria 19943
109 Ga0081538_10007400 3300005981 Bacteria 9510
110 Ga0081538_10007547 3300005981 Bacteria 9393
111 Ga0081538_10013299 3300005981 Bacteria 6525
112 Ga0081538_10018364 3300005981 Bacteria 5254
113 Ga0081538_10062951 3300005981 Bacteria 2110
114 Ga0081538_10152786 3300005981 Bacteria 1042
115 Ga0081538_10197504 3300005981 Bacteria 832
116 Ga0081538_10335697 3300005981 Unclassified 549
117 Ga0081539_10107461 3300005985 Bacteria 1411
118 Ga0070717_10586015 3300006028 Bacteria 1011
119 Ga0075365_10000722 3300006038 Bacteria 13367
120 Ga0075365_10042951 3300006038 Bacteria 2958
121 Ga0075365_10082915 3300006038 Bacteria 2175
122 Ga0075365_10875024 3300006038 Bacteria 634
123 Ga0075363_100083218 3300006048 Bacteria 1753
124 Ga0075363_100418968 3300006048 Bacteria 788
125 Ga0075364_10123709 3300006051 Bacteria 1733
126 Ga0075364_10331876 3300006051 Bacteria 1036
127 Ga0075432_10041516 3300006058 Bacteria 1607
128 Ga0075432_10291391 3300006058 Bacteria 675
129 Ga0070712_100007136 3300006175 Bacteria 6968
130 Ga0070712_100007464 3300006175 Bacteria 6826
131 Ga0075367_10078566 3300006178 Bacteria 1993
132 Ga0075367_10323545 3300006178 Bacteria 972
133 Ga0068871_100544864 3300006358 Bacteria 1050
134 Ga0068871_100674948 3300006358 Bacteria 945
135 Ga0075428_100034972 3300006844 Bacteria 5539
136 Ga0075428_100036040 3300006844 Bacteria 5451
137 Ga0075428_100083705 3300006844 Bacteria 3481
138 Ga0075428_100096200 3300006844 Bacteria 3228
139 Ga0075428_100274257 3300006844 Bacteria 1815
140 Ga0075428_100401694 3300006844 Unclassified 1469
141 Ga0075428_100686388 3300006844 Bacteria 1091
142 Ga0075428_100739428 3300006844 Bacteria 1047
143 Ga0075428_100878041 3300006844 Bacteria 952
144 Ga0075430_100004397 3300006846 Bacteria 11899
145 Ga0075430_100017610 3300006846 Bacteria 6084
146 Ga0075430_100133795 3300006846 Bacteria 2066
147 Ga0075430_100142504 3300006846 Bacteria 1996
148 Ga0075430_100159664 3300006846 Bacteria 1877
149 Ga0075431_100001972 3300006847 Bacteria 19571
150 Ga0075431_100007338 3300006847 Bacteria 10982
151 Ga0075431_100011336 3300006847 Bacteria 8982
152 Ga0075431_100019643 3300006847 Bacteria 6893
153 Ga0075431_100246191 3300006847 Bacteria 1817
154 Ga0075431_100578028 3300006847 Bacteria 1109
155 Ga0075431_101338584 3300006847 Bacteria 676
156 Ga0075431_101400443 3300006847 Unclassified 659
157 Ga0075433_10044352 3300006852 Bacteria 3863
158 Ga0075433_10092075 3300006852 Bacteria 2681
159 Ga0075433_10855099 3300006852 Bacteria 794
160 Ga0075434_100013814 3300006871 Bacteria 7700
161 Ga0075434_100121661 3300006871 Unclassified 2626
162 Ga0075434_100291438 3300006871 Bacteria 1652
163 Ga0075429_100017622 3300006880 Bacteria 6175
164 Ga0075429_100021271 3300006880 Bacteria 5624
165 Ga0075429_100089676 3300006880 Bacteria 2680
166 Ga0075429_100216894 3300006880 Bacteria 1676
167 Ga0075429_100346375 3300006880 Bacteria 1301
168 Ga0068865_100412056 3300006881 Bacteria 1109
169 Ga0068865_100522268 3300006881 Bacteria 993
170 Ga0075436_100009102 3300006914 Bacteria 6794
171 Ga0097620_100382350 3300006931 Bacteria 1503
172 Ga0075435_100129896 3300007076 Bacteria 2108
173 Ga0075435_100307532 3300007076 Unclassified 1356
174 Ga0075435_100499987 3300007076 Bacteria 1051
175 Ga0105244_10412338 3300009036 Unclassified 621
176 Ga0111539_10017683 3300009094 Bacteria 8827
177 Ga0111539_10185487 3300009094 Bacteria 2429
178 Ga0111539_10244062 3300009094 Bacteria 2091
179 Ga0111539_10245020 3300009094 Bacteria 2087
180 Ga0111539_10263583 3300009094 Bacteria 2006
181 Ga0111539_10370851 3300009094 Bacteria 1666
182 Ga0111539_10696937 3300009094 Bacteria 1182
183 Ga0111539_11505734 3300009094 Unclassified 780
184 Ga0105245_10020413 3300009098 Bacteria 5811
185 Ga0105245_10040454 3300009098 Bacteria 4153
186 Ga0105245_10043322 3300009098 Bacteria 4014
187 Ga0105245_10229739 3300009098 Bacteria 1794
188 Ga0105245_11456482 3300009098 Unclassified 735
189 Ga0105247_10070284 3300009101 Bacteria 2186
190 Ga0105247_10094102 3300009101 Bacteria 1906
191 Ga0114129_10007486 3300009147 Bacteria 15551
192 Ga0114129_10014800 3300009147 Bacteria 11115
193 Ga0114129_10066738 3300009147 Bacteria 5018
194 Ga0114129_10087100 3300009147 Bacteria 4331
195 Ga0114129_10176316 3300009147 Bacteria 2912
196 Ga0114129_10280967 3300009147 Unclassified 2224
197 Ga0114129_10496324 3300009147 Bacteria 1595
198 Ga0114129_11016590 3300009147 Unclassified 1043
199 Ga0114129_11135568 3300009147 Bacteria 976
200 Ga0114129_11190164 3300009147 Bacteria 950
201 Ga0114129_11329603 3300009147 Unclassified 889
202 Ga0114129_11435882 3300009147 Unclassified 850
203 Ga0105243_10126470 3300009148 Bacteria 2163
204 Ga0105243_10644856 3300009148 Bacteria 1026
205 Ga0105243_11769341 3300009148 Unclassified 648
206 Ga0105241_11135873 3300009174 Unclassified 737
207 Ga0105241_11957251 3300009174 Bacteria 576
208 Ga0105242_10304263 3300009176 Bacteria 1456
209 Ga0105242_10306151 3300009176 Unclassified 1452
210 Ga0105242_10488227 3300009176 Bacteria 1169
211 Ga0105248_10033087 3300009177 Bacteria 5775
212 Ga0105248_11974752 3300009177 Bacteria 663
213 Ga0105237_11030644 3300009545 Bacteria 830
214 Ga0105237_11285804 3300009545 Bacteria 738
215 Ga0105238_10298239 3300009551 Bacteria 1595
216 Ga0105249_10008631 3300009553 Bacteria 8880
217 Ga0105249_10033843 3300009553 Bacteria 4628
218 Ga0105249_10471503 3300009553 Bacteria 1297
219 Ga0105249_10997715 3300009553 Bacteria 906
220 Ga0105249_11565044 3300009553 Bacteria 732
221 Ga0105239_10025694 3300010375 Bacteria 6486
222 Ga0105239_10344600 3300010375 Bacteria 1682
223 Ga0105239_10753708 3300010375 Unclassified 1114
224 Ga0105239_11589502 3300010375 Bacteria 756
225 Ga0105239_12890339 3300010375 Bacteria 560
226 Ga0105246_10083139 3300011119 Bacteria 2287
227 Ga0105246_10293642 3300011119 Bacteria 1309
228 Ga0105246_11087517 3300011119 Bacteria 729
229 Ga0157373_10847042 3300013100 Bacteria 676
230 Ga0157371_10585271 3300013102 Bacteria 829
231 Ga0157374_10002114 3300013296 Bacteria 16709
232 Ga0157374_10440350 3300013296 Bacteria 1304
233 Ga0157378_10256100 3300013297 Bacteria 1677
234 Ga0157378_10506848 3300013297 Bacteria 1206
235 Ga0163162_10415020 3300013306 Bacteria 1478
236 Ga0163162_11203920 3300013306 Bacteria 860
237 Ga0163162_11270605 3300013306 Bacteria 836
238 Ga0157372_10010491 3300013307 Bacteria 9863
239 Ga0157375_10162049 3300013308 Bacteria 2379
240 Ga0157375_10172499 3300013308 Bacteria 2311
241 Ga0157375_10303862 3300013308 Bacteria 1759
242 Ga0157375_11338635 3300013308 Bacteria 843
243 Ga0163163_10247915 3300014325 Bacteria 1831
244 Ga0157380_10135011 3300014326 Bacteria 2111
245 Ga0157380_10722790 3300014326 Bacteria 1004
246 Ga0157380_10853330 3300014326 Unclassified 933
247 Ga0157380_11047734 3300014326 Bacteria 852
248 Ga0157377_10001181 3300014745 Bacteria 11092
249 Ga0157377_10465069 3300014745 Bacteria 876
250 Ga0157379_10222127 3300014968 Bacteria 1712
251 Ga0163161_10020509 3300017792 Unclassified 4639
252 Ga0207692_10180835 3300025898 Bacteria 1228
253 Ga0207642_10911605 3300025899 Bacteria 563
254 Ga0207688_10000802 3300025901 Bacteria 15722
255 Ga0207688_10030450 3300025901 Bacteria 2975
256 Ga0207647_10572962 3300025904 Bacteria 625
257 Ga0207699_10868622 3300025906 Unclassified 665
258 Ga0207643_10152642 3300025908 Bacteria 1385
259 Ga0207684_10637589 3300025910 Bacteria 908
260 Ga0207654_11212707 3300025911 Unclassified 550
261 Ga0207671_10115280 3300025914 Bacteria 2048
262 Ga0207671_10713097 3300025914 Bacteria 797
263 Ga0207693_10008752 3300025915 Bacteria 8273
264 Ga0207693_10011576 3300025915 Bacteria 7135
265 Ga0207660_10894051 3300025917 Bacteria 725
266 Ga0207662_10257013 3300025918 Bacteria 1148
267 Ga0207662_10589381 3300025918 Bacteria 773
268 Ga0207657_10157239 3300025919 Bacteria 1848
269 Ga0207649_10528697 3300025920 Bacteria 900
270 Ga0207652_10243412 3300025921 Bacteria 1621
271 Ga0207681_10530759 3300025923 Bacteria 967
272 Ga0207681_10634683 3300025923 Unclassified 885
273 Ga0207694_10145723 3300025924 Bacteria 1906
274 Ga0207687_10012722 3300025927 Bacteria 5499
275 Ga0207687_10043890 3300025927 Bacteria 3083
276 Ga0207687_10103162 3300025927 Bacteria 2103
277 Ga0207664_10317991 3300025929 Bacteria 1373
278 Ga0207644_10376417 3300025931 Bacteria 1157
279 Ga0207690_10098483 3300025932 Bacteria 2083
280 Ga0207706_10005072 3300025933 Bacteria 12300
281 Ga0207706_10037305 3300025933 Bacteria 4316
282 Ga0207706_10446171 3300025933 Bacteria 1119
283 Ga0207686_10305363 3300025934 Bacteria 1183
284 Ga0207686_10430027 3300025934 Bacteria 1012
285 Ga0207709_10231099 3300025935 Bacteria 1340
286 Ga0207669_10625580 3300025937 Unclassified 878
287 Ga0207669_11501804 3300025937 Unclassified 574
288 Ga0207704_10117038 3300025938 Bacteria 1815
289 Ga0207704_10688817 3300025938 Bacteria 845
290 Ga0207711_10863071 3300025941 Bacteria 842
291 Ga0207689_10349077 3300025942 Bacteria 1230
292 Ga0207661_10018247 3300025944 Bacteria 5211
293 Ga0207679_10072611 3300025945 Bacteria 2600
294 Ga0207667_10133761 3300025949 Bacteria 2554
295 Ga0207667_11069142 3300025949 Bacteria 791
296 Ga0207651_10333305 3300025960 Bacteria 1272
297 Ga0207712_10049593 3300025961 Bacteria 2926
298 Ga0207712_10425073 3300025961 Bacteria 1122
299 Ga0207668_10149332 3300025972 Bacteria 1807
300 Ga0207668_10170349 3300025972 Bacteria 1707
301 Ga0207668_11992789 3300025972 Unclassified 523
302 Ga0207658_11497443 3300025986 Bacteria 617
303 Ga0207677_10208902 3300026023 Bacteria 1557
304 Ga0207677_10303484 3300026023 Bacteria 1320
305 Ga0207677_10322282 3300026023 Bacteria 1284
306 Ga0207703_10306324 3300026035 Bacteria 1450
307 Ga0207639_10734355 3300026041 Bacteria 917
308 Ga0207708_10002362 3300026075 Bacteria 13865
309 Ga0207708_10014053 3300026075 Bacteria 5982
310 Ga0207702_10376525 3300026078 Bacteria 1364
311 Ga0207641_10148295 3300026088 Bacteria 2123
312 Ga0207648_10350708 3300026089 Bacteria 1330
313 Ga0207648_10654509 3300026089 Unclassified 971
314 Ga0207676_10075651 3300026095 Bacteria 2717
315 Ga0207674_10079819 3300026116 Bacteria 3275
316 Ga0207674_11243126 3300026116 Bacteria 714
317 Ga0207675_100004951 3300026118 Bacteria 12838
318 Ga0207675_100165077 3300026118 Bacteria 2114
319 Ga0207675_100686136 3300026118 Bacteria 1032
320 Ga0207675_101567985 3300026118 Bacteria 679
321 Ga0207683_10043313 3300026121 Bacteria 3934
322 Ga0207683_10274278 3300026121 Bacteria 1541
323 Ga0207683_10426380 3300026121 Bacteria 1222
324 Ga0207698_10215617 3300026142 Bacteria 1730
325 Ga0207428_10007473 3300027907 Bacteria 9962
326 Ga0207428_10024774 3300027907 Bacteria 5036
327 Ga0207428_10037793 3300027907 Bacteria 3927
328 Ga0207428_10134942 3300027907 Bacteria 1887
329 Ga0207428_10319659 3300027907 Bacteria 1146
330 Ga0207428_10340702 3300027907 Bacteria 1104
331 Ga0207428_10669298 3300027907 Bacteria 744
332 Ga0207428_10842357 3300027907 Bacteria 650
333 Ga0268265_10217952 3300028380 Bacteria 1668
334 Ga0268264_11586206 3300028381 Bacteria 665
335 Ga0265337_1177885 3300028556 Bacteria 577
336 Ga0265319_1061826 3300028563 Bacteria 1213
337 Ga0265319_1062394 3300028563 Bacteria 1207
338 Ga0265318_10087856 3300028577 Bacteria 1145
339 Ga0265322_10152963 3300028654 Bacteria 659
340 Ga0265338_10228463 3300028800 Bacteria 1385
341 Ga0265320_10023225 3300031240 Bacteria 3305
342 Ga0265320_10030678 3300031240 Bacteria 2769
343 Ga0307408_100047073 3300031548 Bacteria 3087
344 Ga0307408_101486287 3300031548 Bacteria 640
345 Ga0265314_10051739 3300031711 Bacteria 2860
346 Ga0265342_10473887 3300031712 Bacteria 641
347 Ga0307405_10081517 3300031731 Bacteria 2115
348 Ga0307413_10090806 3300031824 Bacteria 1988
349 Ga0307410_10068063 3300031852 Bacteria 2458
350 Ga0307410_10101808 3300031852 Bacteria 2060
351 Ga0307410_10356862 3300031852 Bacteria 1170
352 Ga0307406_10084954 3300031901 Bacteria 2115
353 Ga0307406_11626566 3300031901 Bacteria 571
354 Ga0307407_10644874 3300031903 Bacteria 793
355 Ga0307412_10132143 3300031911 Bacteria 1815
356 Ga0307412_10273605 3300031911 Bacteria 1323
357 Ga0307409_100021293 3300031995 Bacteria 4442
358 Ga0307409_100048776 3300031995 Bacteria 3225
359 Ga0307409_100716626 3300031995 Archaea 1001
360 Ga0307409_100803192 3300031995 Bacteria 948
361 Ga0307416_100005355 3300032002 Bacteria 7873
362 Ga0307416_100047514 3300032002 Bacteria 3398
363 Ga0307416_100131794 3300032002 Bacteria 2252
364 Ga0307416_100148495 3300032002 Bacteria 2145
365 Ga0307416_101589345 3300032002 Unclassified 759
366 Ga0307411_10115624 3300032005 Bacteria 1930
367 Ga0307411_10128230 3300032005 Bacteria 1849
368 Ga0307415_100058838 3300032126 Bacteria 2647
369 Ga0307415_100621450 3300032126 Bacteria 964
370 Ga0307415_100722928 3300032126 Bacteria 901
371 Ga0373952_0058805 3300035092 Unclassified 935
372 Ga0373932_0333324 3300035112 Bacteria 573
373 Ga0373960_0015356 3300035121 Bacteria 1954
374 Ga0373942_0091779 3300035207 Bacteria 916
375 Ga0373962_0102011 3300035242 Bacteria 896
376 Ga0373925_0496610 3300037068 Bacteria 1002
377 Ga0395900_0093027 3300037418 Bacteria 3097
378 Ga0395900_0418690 3300037418 Bacteria 1301
379 Ga0395900_0558697 3300037418 Bacteria 1088
380 Ga0395900_0577854 3300037418 Bacteria 1066
381 Ga0395898_0026087 3300037466 Bacteria 5883
382 Ga0395898_0092276 3300037466 Bacteria 2912
383 Ga0395898_0106971 3300037466 Bacteria 2682
384 Ga0395898_0326999 3300037466 Bacteria 1462
385 Ga0395898_0692506 3300037466 Bacteria 961
386 Ga0395898_1437103 3300037466 Bacteria 617
387 Ga0395905_0015772 3300037471 Bacteria 7177
388 Ga0395901_0003934 3300038443 Bacteria 14945
389 Ga0395901_0028155 3300038443 Bacteria 5780
390 Ga0395901_0165531 3300038443 Bacteria 2322
391 Ga0395901_0202443 3300038443 Bacteria 2081
392 Ga0395901_0579961 3300038443 Bacteria 1133
393 Ga0395901_0680512 3300038443 Unclassified 1028
394 Ga0395901_0816295 3300038443 Bacteria 920
395 Ga0395901_0882032 3300038443 Unclassified 878
396 Ga0395901_1116018 3300038443 Bacteria 758
397 Ga0451853_3162749 3300041512 Unclassified 555
398 Ga0466960_0026054 3300044901 Bacteria 2652
399 Ga0466960_0051804 3300044901 Bacteria 1984
400 Ga0495603_0240853 3300046455 Bacteria 1042
401 Ga0495584_0112893 3300046491 Bacteria 1375
402 Ga0495584_0152776 3300046491 Bacteria 1173
403 Ga0495584_0326795 3300046491 Unclassified 779
404 Ga0495596_0041694 3300046500 Bacteria 1810
405 Ga0495607_0145737 3300046501 Unclassified 1217
406 Ga0495616_0259185 3300046513 Bacteria 745
407 Ga0495663_0095214 3300046525 Bacteria 975
408 Ga0495663_0110325 3300046525 Bacteria 914
409 Ga0495668_0198442 3300046616 Bacteria 1099
410 Ga0495668_0395886 3300046616 Unclassified 759
411 Ga0495647_0180435 3300046681 Bacteria 918
412 Ga0495658_0441549 3300046683 Bacteria 831
413 Ga0495624_0627197 3300046690 Bacteria 640
414 Ga0495670_0403999 3300046691 Unclassified 738
415 Ga0495589_0292619 3300046794 Bacteria 756
416 Ga0495589_0539327 3300046794 Unclassified 532
417 Ga0495672_0305147 3300047320 Bacteria 752
418 Ga0495676_0156171 3300047321 Bacteria 1618
419 Ga0495676_1108246 3300047321 Unclassified 503
420 Ga0496100_0121017 3300048903 Bacteria 1831
421 Ga0496100_0129393 3300048903 Bacteria 1776
422 Ga0496101_0096096 3300048904 Bacteria 2211
423 Ga0496101_0135816 3300048904 Bacteria 1871
424 Ga0496102_0010240 3300048905 Bacteria 8061
425 Ga0496102_0506499 3300048905 Bacteria 1129
426 Ga0496103_0238983 3300048906 Bacteria 1168
427 Ga0496104_0038727 3300048907 Bacteria 4462
428 Ga0496104_0420451 3300048907 Bacteria 1248
429 Ga0496105_0017098 3300048908 Bacteria 5807
430 Ga0496105_0690404 3300048908 Bacteria 784
431 Ga0496106_0052187 3300048909 Bacteria 3084
432 Ga0496106_0499347 3300048909 Bacteria 977
433 Ga0496107_0026016 3300048910 Bacteria 4146
434 Ga0496107_0279994 3300048910 Bacteria 1241
435 Ga0496108_0006479 3300048911 Bacteria 9495
436 Ga0496108_0039890 3300048911 Bacteria 3913
437 Ga0496109_0706399 3300048912 Bacteria 946
438 Ga0496110_0045223 3300048913 Bacteria 3847
439 Ga0496110_0122644 3300048913 Bacteria 2342
440 Ga0496111_0028634 3300048914 Bacteria 3949
441 Ga0496111_0397490 3300048914 Bacteria 1018
442 Ga0496112_0156021 3300048915 Bacteria 2249
443 Ga0496113_0058963 3300048916 Bacteria 2890
444 Ga0496113_0101852 3300048916 Bacteria 2226
445 Ga0496114_0341724 3300048917 Bacteria 1324
446 Ga0496114_0518416 3300048917 Bacteria 1054
447 Ga0496115_0119028 3300048918 Bacteria 2172
448 Ga0501031_0120670 3300049568 Bacteria 1712
449 Ga0501031_0449686 3300049568 Unclassified 832
450 Ga0501032_0594923 3300049569 Unclassified 704
451 Ga0501036_0546829 3300049572 Bacteria 962
452 Ga0501036_0656997 3300049572 Bacteria 868
453 Ga0501036_0759232 3300049572 Bacteria 800
454 Ga0501038_0128561 3300049574 Bacteria 2083
455 Ga0501038_0264230 3300049574 Bacteria 1359
456 Ga0501039_0396696 3300049575 Bacteria 1084
457 Ga0501040_0112141 3300049576 Bacteria 1907
458 Ga0501040_0818765 3300049576 Bacteria 674
459 Ga0501040_0826595 3300049576 Unclassified 670
460 Ga0501041_0018297 3300049577 Bacteria 4174
461 Ga0501041_0031656 3300049577 Bacteria 3197
462 Ga0501041_0230033 3300049577 Bacteria 1164
463 Ga0501042_0089240 3300049578 Bacteria 2212
464 Ga0501042_0104886 3300049578 Bacteria 2034
465 Ga0501042_0235255 3300049578 Bacteria 1322
466 Ga0501046_0123592 3300049580 Bacteria 1968
467 Ga0501046_0446992 3300049580 Bacteria 930
468 Ga0501046_0720472 3300049580 Unclassified 702
469 Ga0501048_0215329 3300049582 Bacteria 1362
470 Ga0501067_0296848 3300049583 Unclassified 900
471 Ga0501067_0640175 3300049583 Bacteria 597
472 Ga0501067_0809593 3300049583 Unclassified 528
473 Ga0501068_0073439 3300049584 Bacteria 2090
474 Ga0501068_0174418 3300049584 Bacteria 1358
475 Ga0501068_0303795 3300049584 Bacteria 1022
476 Ga0501068_0655402 3300049584 Unclassified 685
477 Ga0501068_0825257 3300049584 Unclassified 608
478 Ga0501069_0193518 3300049585 Unclassified 1177
479 Ga0501069_0224043 3300049585 Bacteria 1094
480 Ga0501069_0227701 3300049585 Bacteria 1085
481 Ga0501070_0150743 3300049586 Bacteria 1918
482 Ga0501070_0658702 3300049586 Bacteria 831
483 Ga0501070_1330499 3300049586 Unclassified 548
484 Ga0501071_0050991 3300049587 Bacteria 2981
485 Ga0501071_0079258 3300049587 Bacteria 2401
486 Ga0501071_0575380 3300049587 Bacteria 865
487 Ga0501071_0669835 3300049587 Bacteria 799
488 Ga0501072_0038516 3300049588 Bacteria 3752
489 Ga0501072_0413109 3300049588 Bacteria 1070
490 Ga0501072_1095207 3300049588 Bacteria 620
491 Ga0501072_1156515 3300049588 Unclassified 601
492 Ga0501072_1202446 3300049588 Unclassified 589
493 Ga0501074_0047438 3300049590 Bacteria 3105
494 Ga0501075_0008822 3300049591 Bacteria 7029
495 Ga0501075_0164225 3300049591 Bacteria 1694
496 Ga0501075_0174942 3300049591 Bacteria 1638
497 Ga0501075_0252358 3300049591 Bacteria 1345
498 Ga0501076_0034143 3300049592 Bacteria 3974
499 Ga0501077_0210826 3300049593 Bacteria 1234
500 Ga0501079_0079359 3300049741 Bacteria 2538
501 Ga0501079_0202717 3300049741 Bacteria 1550
502 Ga0501079_1044778 3300049741 Unclassified 644
503 Ga0501079_1515509 3300049741 Unclassified 527
504 Ga0501080_0230953 3300049742 Bacteria 1691
505 Ga0501080_0298525 3300049742 Unclassified 1461
506 Ga0501081_0192385 3300049743 Bacteria 1477
507 Ga0501081_0401736 3300049743 Bacteria 1014
508 Ga0501081_0600709 3300049743 Bacteria 824
509 Ga0501081_0733120 3300049743 Bacteria 742
510 Ga0501083_0734023 3300049744 Unclassified 642
511 Ga0501035_1109686 3300049822 Unclassified 617
512 Ga0501045_0022206 3300049824 Bacteria 4542
513 Ga0501045_0241595 3300049824 Bacteria 1344
514 Ga0501045_0353068 3300049824 Bacteria 1094
515 Ga0501045_1083889 3300049824 Unclassified 586
516 nmdc:mga03n38_365197_c1 3300050490 Bacteria 788
517 nmdc:mga03n38_694317_c1 3300050490 Unclassified 586
518 nmdc:mga00v17_307657_c1 3300050491 Bacteria 1029
519 nmdc:mga00v17_411807_c1 3300050491 Bacteria 878
520 nmdc:mga0yw44_10477_c1 3300050492 Bacteria 4739
521 nmdc:mga0yw44_1064207_c1 3300050492 Unclassified 547
522 nmdc:mga0yw44_1252442_c1 3300050492 Bacteria 500
523 nmdc:mga0yw44_239616_c1 3300050492 Bacteria 1205
524 nmdc:mga06z11_100731_c1 3300050494 Bacteria 1584
525 nmdc:mga06z11_117733_c1 3300050494 Bacteria 1479
526 nmdc:mga06z11_287168_c1 3300050494 Bacteria 975
527 nmdc:mga05p37_10445_c1 3300050507 Bacteria 5014
528 nmdc:mga05p37_1205180_c1 3300050507 Unclassified 782
529 nmdc:mga05p37_135351_c1 3300050507 Bacteria 3022
530 nmdc:mga05p37_138516_c1 3300050507 Bacteria 2982
531 nmdc:mga05p37_219686_c1 3300050507 Bacteria 2294
532 nmdc:mga05p37_243636_c1 3300050507 Bacteria 2160
533 nmdc:mga05p37_283092_c1 3300050507 Bacteria 1976
534 nmdc:mga05p37_293580_c1 3300050507 Unclassified 1934
535 nmdc:mga05p37_294178_c1 3300050507 Bacteria 1932
536 nmdc:mga05p37_409548_c1 3300050507 Bacteria 1581
537 nmdc:mga05p37_411092_c1 3300050507 Bacteria 1577
538 nmdc:mga05p37_46562_c1 3300050507 Bacteria 5332
539 nmdc:mga09592_1192248_c1 3300050508 Bacteria 630
540 nmdc:mga09592_18673_c1 3300050508 Bacteria 5687
541 nmdc:mga09592_264754_c1 3300050508 Unclassified 1491
542 nmdc:mga09592_42496_c1 3300050508 Bacteria 3823
543 nmdc:mga09592_464011_c1 3300050508 Bacteria 1092
544 nmdc:mga0qj67_1522639_c1 3300050509 Bacteria 514
545 nmdc:mga0qj67_39690_c1 3300050509 Bacteria 3698
546 nmdc:mga0qj67_412404_c1 3300050509 Bacteria 1089
547 nmdc:mga0qj67_46248_c1 3300050509 Bacteria 3436
548 nmdc:mga0qj67_5016_c1 3300050509 Bacteria 9618
549 nmdc:mga0qj67_914715_c1 3300050509 Bacteria 691
550 nmdc:mga0qj67_915704_c1 3300050509 Bacteria 690
551 nmdc:mga06r32_1138651_c1 3300050510 Bacteria 728
552 nmdc:mga06r32_12466_c1 3300050510 Bacteria 7673
553 nmdc:mga06r32_187471_c1 3300050510 Bacteria 2056
554 nmdc:mga06r32_2495_c1 3300050510 Bacteria 16465
555 nmdc:mga06r32_819256_c1 3300050510 Bacteria 891
556 nmdc:mga06r32_852157_c1 3300050510 Bacteria 870
557 nmdc:mga06r32_89254_c1 3300050510 Bacteria 3009
558 nmdc:mga08y16_1621797_c1 3300050511 Bacteria 604
559 nmdc:mga08y16_19951_c1 3300050511 Bacteria 7072
560 nmdc:mga08y16_321231_c1 3300050511 Bacteria 1594
561 nmdc:mga08y16_537744_c1 3300050511 Bacteria 1184
562 nmdc:mga08y16_8339_c1 3300050511 Bacteria 10845
563 nmdc:mga0n895_21750_c1 3300050512 Bacteria 6003
564 nmdc:mga0n895_24741_c1 3300050512 Bacteria 5662
565 nmdc:mga0n895_280234_c1 3300050512 Bacteria 1690
566 nmdc:mga0n895_999460_c1 3300050512 Unclassified 818
567 nmdc:mga0rr50_214499_c1 3300050513 Bacteria 1587
568 nmdc:mga0a205_184045_c1 3300050515 Unclassified 1983
569 nmdc:mga0a205_342615_c1 3300050515 Bacteria 1363
570 nmdc:mga0a205_4382_c1 3300050515 Bacteria 12655
571 nmdc:mga0a205_672340_c1 3300050515 Bacteria 886
572 Ga0495655_0024189 3300053083 Bacteria 1408
573 Ga0501084_0134619 3300054114 Bacteria 2080
574 Ga0501084_0419046 3300054114 Bacteria 1132
575 Ga0501084_0549934 3300054114 Bacteria 975
576 Ga0501084_0730058 3300054114 Bacteria 835
577 Ga0501082_0069195 3300060353 Bacteria 3039
578 Ga0501082_0161909 3300060353 Bacteria 1944
579 Ga0501082_0831202 3300060353 Bacteria 808
580 Ga0530510_0003841 3300061734 Bacteria 10354
581 Ga0530510_0156449 3300061734 Bacteria 1685
582 Ga0530510_0348159 3300061734 Bacteria 1113
583 Ga0530510_0690558 3300061734 Bacteria 778
584 Ga0530510_0887849 3300061734 Unclassified 681
585 Ga0075368_10336394
586 JGI24744J21845_10071187
587 JGI24742J22300_10051460
588 JGI25407J50210_10000100
589 JGI25407J50210_10001025
590 JGI25407J50210_10042291
591 JGI25407J50210_10134421
592 Ga0058863_11799775
593 Ga0070676_10439555
594 Ga0070683_100080822
595 Ga0070683_101033249
596 Ga0068869_100216918
597 Ga0068869_100370501
598 Ga0070680_100787783
599 Ga0070680_101036383
600 Ga0070680_101507426
601 Ga0070682_100010011
602 Ga0068868_100006100
603 Ga0070660_100569864
604 Ga0070660_101947429
605 Ga0070691_10053830
606 Ga0070691_10302085
607 Ga0070687_100250440
608 Ga0070661_100286933
609 Ga0070692_10131248
610 Ga0070668_100001272
611 Ga0070668_100237772
612 Ga0070671_100230241
613 Ga0070674_100047671
614 Ga0070674_100079397
615 Ga0070674_100325405
616 Ga0070674_101374200
617 Ga0070673_100326398
618 Ga0070688_100454570
619 Ga0070659_100350313
620 Ga0070667_101619937
621 Ga0070703_10082712
622 Ga0070714_100844176
623 Ga0070713_101499724
624 Ga0070710_10016754
625 Ga0070701_10861201
626 Ga0070711_100496424
627 Ga0070705_100171780
628 Ga0070705_100671663
629 Ga0070705_100855430
630 Ga0070705_100864049
631 Ga0070705_101052411
632 Ga0070700_100010802
633 Ga0070700_100021971
634 Ga0070700_101170805
635 Ga0070694_100076400
636 Ga0070694_100100879
637 Ga0070694_100125115
638 Ga0070694_100321572
639 Ga0070694_100378029
640 Ga0070694_100404754
641 Ga0070708_101594395
642 Ga0070678_100119496
643 Ga0070678_101594350
644 Ga0070662_100021603
645 Ga0070662_100118511
646 Ga0068867_100067098
647 Ga0070685_10007771
648 Ga0070699_100306608
649 Ga0070699_101549135
650 Ga0070684_100001904
651 Ga0068853_100448502
652 Ga0068853_101133221
653 Ga0070686_100579220
654 Ga0070695_100614302
655 Ga0070695_100880616
656 Ga0070696_100045564
657 Ga0070696_100081425
658 Ga0070696_100341090
659 Ga0070696_101494786
660 Ga0070693_100225876
661 Ga0070665_101501068
662 Ga0070704_100101516
663 Ga0068855_101277247
664 Ga0070664_100035371
665 Ga0068857_100884059
666 Ga0068854_101401551
667 Ga0068856_100111406
668 Ga0070702_100210309
669 Ga0068852_100069346
670 Ga0068859_100382368
671 Ga0068864_100017259
672 Ga0068866_10075667
673 Ga0068866_10537716
674 Ga0068861_100117025
675 Ga0068861_100381851
676 Ga0068861_100551647
677 Ga0068851_10074985
678 Ga0068870_10234261
679 Ga0068863_100439513
680 Ga0068858_100188444
681 Ga0068860_101464789
682 Ga0068860_101636122
683 Ga0068860_101888342
684 Ga0068862_100311370
685 Ga0068862_100860233
686 Ga0081455_10179270
687 Ga0081455_10357287
688 Ga0081538_10000313
689 Ga0081538_10000338
690 Ga0081538_10000396
691 Ga0081538_10001266
692 Ga0081538_10002078
693 Ga0081538_10007400
694 Ga0081538_10007547
695 Ga0081538_10013299
696 Ga0081538_10018364
697 Ga0081538_10062951
698 Ga0081538_10152786
699 Ga0081538_10197504
700 Ga0081538_10335697
701 Ga0081539_10107461
702 Ga0070717_10586015
703 Ga0075365_10000722
704 Ga0075365_10042951
705 Ga0075365_10082915
706 Ga0075365_10875024
707 Ga0075363_100083218
708 Ga0075363_100418968
709 Ga0075364_10123709
710 Ga0075364_10331876
711 Ga0075432_10041516
712 Ga0075432_10291391
713 Ga0070712_100007136
714 Ga0070712_100007464
715 Ga0075367_10078566
716 Ga0075367_10323545
717 Ga0068871_100544864
718 Ga0068871_100674948
719 Ga0075428_100034972
720 Ga0075428_100036040
721 Ga0075428_100083705
722 Ga0075428_100096200
723 Ga0075428_100274257
724 Ga0075428_100401694
725 Ga0075428_100686388
726 Ga0075428_100739428
727 Ga0075428_100878041
728 Ga0075430_100004397
729 Ga0075430_100017610
730 Ga0075430_100133795
731 Ga0075430_100142504
732 Ga0075430_100159664
733 Ga0075431_100001972
734 Ga0075431_100007338
735 Ga0075431_100011336
736 Ga0075431_100019643
737 Ga0075431_100246191
738 Ga0075431_100578028
739 Ga0075431_101338584
740 Ga0075431_101400443
741 Ga0075433_10044352
742 Ga0075433_10092075
743 Ga0075433_10855099
744 Ga0075434_100013814
745 Ga0075434_100121661
746 Ga0075434_100291438
747 Ga0075429_100017622
748 Ga0075429_100021271
749 Ga0075429_100089676
750 Ga0075429_100216894
751 Ga0075429_100346375
752 Ga0068865_100412056
753 Ga0068865_100522268
754 Ga0075436_100009102
755 Ga0097620_100382350
756 Ga0075435_100129896
757 Ga0075435_100307532
758 Ga0075435_100499987
759 Ga0105244_10412338
760 Ga0111539_10017683
761 Ga0111539_10185487
762 Ga0111539_10244062
763 Ga0111539_10245020
764 Ga0111539_10263583
765 Ga0111539_10370851
766 Ga0111539_10696937
767 Ga0111539_11505734
768 Ga0105245_10020413
769 Ga0105245_10040454
770 Ga0105245_10043322
771 Ga0105245_10229739
772 Ga0105245_11456482
773 Ga0105247_10070284
774 Ga0105247_10094102
775 Ga0114129_10007486
776 Ga0114129_10014800
777 Ga0114129_10066738
778 Ga0114129_10087100
779 Ga0114129_10176316
780 Ga0114129_10280967
781 Ga0114129_10496324
782 Ga0114129_11016590
783 Ga0114129_11135568
784 Ga0114129_11190164
785 Ga0114129_11329603
786 Ga0114129_11435882
787 Ga0105243_10126470
788 Ga0105243_10644856
789 Ga0105243_11769341
790 Ga0105241_11135873
791 Ga0105241_11957251
792 Ga0105242_10304263
793 Ga0105242_10306151
794 Ga0105242_10488227
795 Ga0105248_10033087
796 Ga0105248_11974752
797 Ga0105237_11030644
798 Ga0105237_11285804
799 Ga0105238_10298239
800 Ga0105249_10008631
801 Ga0105249_10033843
802 Ga0105249_10471503
803 Ga0105249_10997715
804 Ga0105249_11565044
805 Ga0105239_10025694
806 Ga0105239_10344600
807 Ga0105239_10753708
808 Ga0105239_11589502
809 Ga0105239_12890339
810 Ga0105246_10083139
811 Ga0105246_10293642
812 Ga0105246_11087517
813 Ga0157373_10847042
814 Ga0157371_10585271
815 Ga0157374_10002114
816 Ga0157374_10440350
817 Ga0157378_10256100
818 Ga0157378_10506848
819 Ga0163162_10415020
820 Ga0163162_11203920
821 Ga0163162_11270605
822 Ga0157372_10010491
823 Ga0157375_10162049
824 Ga0157375_10172499
825 Ga0157375_10303862
826 Ga0157375_11338635
827 Ga0163163_10247915
828 Ga0157380_10135011
829 Ga0157380_10722790
830 Ga0157380_10853330
831 Ga0157380_11047734
832 Ga0157377_10001181
833 Ga0157377_10465069
834 Ga0157379_10222127
835 Ga0163161_10020509
836 Ga0207692_10180835
837 Ga0207642_10911605
838 Ga0207688_10000802
839 Ga0207688_10030450
840 Ga0207647_10572962
841 Ga0207699_10868622
842 Ga0207643_10152642
843 Ga0207684_10637589
844 Ga0207654_11212707
845 Ga0207671_10115280
846 Ga0207671_10713097
847 Ga0207693_10008752
848 Ga0207693_10011576
849 Ga0207660_10894051
850 Ga0207662_10257013
851 Ga0207662_10589381
852 Ga0207657_10157239
853 Ga0207649_10528697
854 Ga0207652_10243412
855 Ga0207681_10530759
856 Ga0207681_10634683
857 Ga0207694_10145723
858 Ga0207687_10012722
859 Ga0207687_10043890
860 Ga0207687_10103162
861 Ga0207664_10317991
862 Ga0207644_10376417
863 Ga0207690_10098483
864 Ga0207706_10005072
865 Ga0207706_10037305
866 Ga0207706_10446171
867 Ga0207686_10305363
868 Ga0207686_10430027
869 Ga0207709_10231099
870 Ga0207669_10625580
871 Ga0207669_11501804
872 Ga0207704_10117038
873 Ga0207704_10688817
874 Ga0207711_10863071
875 Ga0207689_10349077
876 Ga0207661_10018247
877 Ga0207679_10072611
878 Ga0207667_10133761
879 Ga0207667_11069142
880 Ga0207651_10333305
881 Ga0207712_10049593
882 Ga0207712_10425073
883 Ga0207668_10149332
884 Ga0207668_10170349
885 Ga0207668_11992789
886 Ga0207658_11497443
887 Ga0207677_10208902
888 Ga0207677_10303484
889 Ga0207677_10322282
890 Ga0207703_10306324
891 Ga0207639_10734355
892 Ga0207708_10002362
893 Ga0207708_10014053
894 Ga0207702_10376525
895 Ga0207641_10148295
896 Ga0207648_10350708
897 Ga0207648_10654509
898 Ga0207676_10075651
899 Ga0207674_10079819
900 Ga0207674_11243126
901 Ga0207675_100004951
902 Ga0207675_100165077
903 Ga0207675_100686136
904 Ga0207675_101567985
905 Ga0207683_10043313
906 Ga0207683_10274278
907 Ga0207683_10426380
908 Ga0207698_10215617
909 Ga0207428_10007473
910 Ga0207428_10024774
911 Ga0207428_10037793
912 Ga0207428_10134942
913 Ga0207428_10319659
914 Ga0207428_10340702
915 Ga0207428_10669298
916 Ga0207428_10842357
917 Ga0268265_10217952
918 Ga0268264_11586206
919 Ga0265337_1177885
920 Ga0265319_1061826
921 Ga0265319_1062394
922 Ga0265318_10087856
923 Ga0265322_10152963
924 Ga0265338_10228463
925 Ga0265320_10023225
926 Ga0265320_10030678
927 Ga0307408_100047073
928 Ga0307408_101486287
929 Ga0265314_10051739
930 Ga0265342_10473887
931 Ga0307405_10081517
932 Ga0307413_10090806
933 Ga0307410_10068063
934 Ga0307410_10101808
935 Ga0307410_10356862
936 Ga0307406_10084954
937 Ga0307406_11626566
938 Ga0307407_10644874
939 Ga0307412_10132143
940 Ga0307412_10273605
941 Ga0307409_100021293
942 Ga0307409_100048776
943 Ga0307409_100716626
944 Ga0307409_100803192
945 Ga0307416_100005355
946 Ga0307416_100047514
947 Ga0307416_100131794
948 Ga0307416_100148495
949 Ga0307416_101589345
950 Ga0307411_10115624
951 Ga0307411_10128230
952 Ga0307415_100058838
953 Ga0307415_100621450
954 Ga0307415_100722928
955 Ga0373952_0058805
956 Ga0373932_0333324
957 Ga0373960_0015356
958 Ga0373942_0091779
959 Ga0373962_0102011
960 Ga0373925_0496610
961 Ga0395900_0093027
962 Ga0395900_0418690
963 Ga0395900_0558697
964 Ga0395900_0577854
965 Ga0395898_0026087
966 Ga0395898_0092276
967 Ga0395898_0106971
968 Ga0395898_0326999
969 Ga0395898_0692506
970 Ga0395898_1437103
971 Ga0395905_0015772
972 Ga0395901_0003934
973 Ga0395901_0028155
974 Ga0395901_0165531
975 Ga0395901_0202443
976 Ga0395901_0579961
977 Ga0395901_0680512
978 Ga0395901_0816295
979 Ga0395901_0882032
980 Ga0395901_1116018
981 Ga0451853_3162749
982 Ga0466960_0026054
983 Ga0466960_0051804
984 Ga0495603_0240853
985 Ga0495584_0112893
986 Ga0495584_0152776
987 Ga0495584_0326795
988 Ga0495596_0041694
989 Ga0495607_0145737
990 Ga0495616_0259185
991 Ga0495663_0095214
992 Ga0495663_0110325
993 Ga0495668_0198442
994 Ga0495668_0395886
995 Ga0495647_0180435
996 Ga0495658_0441549
997 Ga0495624_0627197
998 Ga0495670_0403999
999 Ga0495589_0292619
1000 Ga0495589_0539327
1001 Ga0495672_0305147
1002 Ga0495676_0156171
1003 Ga0495676_1108246
1004 Ga0496100_0121017
1005 Ga0496100_0129393
1006 Ga0496101_0096096
1007 Ga0496101_0135816
1008 Ga0496102_0010240
1009 Ga0496102_0506499
1010 Ga0496103_0238983
1011 Ga0496104_0038727
1012 Ga0496104_0420451
1013 Ga0496105_0017098
1014 Ga0496105_0690404
1015 Ga0496106_0052187
1016 Ga0496106_0499347
1017 Ga0496107_0026016
1018 Ga0496107_0279994
1019 Ga0496108_0006479
1020 Ga0496108_0039890
1021 Ga0496109_0706399
1022 Ga0496110_0045223
1023 Ga0496110_0122644
1024 Ga0496111_0028634
1025 Ga0496111_0397490
1026 Ga0496112_0156021
1027 Ga0496113_0058963
1028 Ga0496113_0101852
1029 Ga0496114_0341724
1030 Ga0496114_0518416
1031 Ga0496115_0119028
1032 Ga0501031_0120670
1033 Ga0501031_0449686
1034 Ga0501032_0594923
1035 Ga0501036_0546829
1036 Ga0501036_0656997
1037 Ga0501036_0759232
1038 Ga0501038_0128561
1039 Ga0501038_0264230
1040 Ga0501039_0396696
1041 Ga0501040_0112141
1042 Ga0501040_0818765
1043 Ga0501040_0826595
1044 Ga0501041_0018297
1045 Ga0501041_0031656
1046 Ga0501041_0230033
1047 Ga0501042_0089240
1048 Ga0501042_0104886
1049 Ga0501042_0235255
1050 Ga0501046_0123592
1051 Ga0501046_0446992
1052 Ga0501046_0720472
1053 Ga0501048_0215329
1054 Ga0501067_0296848
1055 Ga0501067_0640175
1056 Ga0501067_0809593
1057 Ga0501068_0073439
1058 Ga0501068_0174418
1059 Ga0501068_0303795
1060 Ga0501068_0655402
1061 Ga0501068_0825257
1062 Ga0501069_0193518
1063 Ga0501069_0224043
1064 Ga0501069_0227701
1065 Ga0501070_0150743
1066 Ga0501070_0658702
1067 Ga0501070_1330499
1068 Ga0501071_0050991
1069 Ga0501071_0079258
1070 Ga0501071_0575380
1071 Ga0501071_0669835
1072 Ga0501072_0038516
1073 Ga0501072_0413109
1074 Ga0501072_1095207
1075 Ga0501072_1156515
1076 Ga0501072_1202446
1077 Ga0501074_0047438
1078 Ga0501075_0008822
1079 Ga0501075_0164225
1080 Ga0501075_0174942
1081 Ga0501075_0252358
1082 Ga0501076_0034143
1083 Ga0501077_0210826
1084 Ga0501079_0079359
1085 Ga0501079_0202717
1086 Ga0501079_1044778
1087 Ga0501079_1515509
1088 Ga0501080_0230953
1089 Ga0501080_0298525
1090 Ga0501081_0192385
1091 Ga0501081_0401736
1092 Ga0501081_0600709
1093 Ga0501081_0733120
1094 Ga0501083_0734023
1095 Ga0501035_1109686
1096 Ga0501045_0022206
1097 Ga0501045_0241595
1098 Ga0501045_0353068
1099 Ga0501045_1083889
1100 nmdc:mga03n38_365197_c1
1101 nmdc:mga03n38_694317_c1
1102 nmdc:mga00v17_307657_c1
1103 nmdc:mga00v17_411807_c1
1104 nmdc:mga0yw44_10477_c1
1105 nmdc:mga0yw44_1064207_c1
1106 nmdc:mga0yw44_1252442_c1
1107 nmdc:mga0yw44_239616_c1
1108 nmdc:mga06z11_100731_c1
1109 nmdc:mga06z11_117733_c1
1110 nmdc:mga06z11_287168_c1
1111 nmdc:mga05p37_10445_c1
1112 nmdc:mga05p37_1205180_c1
1113 nmdc:mga05p37_135351_c1
1114 nmdc:mga05p37_138516_c1
1115 nmdc:mga05p37_219686_c1
1116 nmdc:mga05p37_243636_c1
1117 nmdc:mga05p37_283092_c1
1118 nmdc:mga05p37_293580_c1
1119 nmdc:mga05p37_294178_c1
1120 nmdc:mga05p37_409548_c1
1121 nmdc:mga05p37_411092_c1
1122 nmdc:mga05p37_46562_c1
1123 nmdc:mga09592_1192248_c1
1124 nmdc:mga09592_18673_c1
1125 nmdc:mga09592_264754_c1
1126 nmdc:mga09592_42496_c1
1127 nmdc:mga09592_464011_c1
1128 nmdc:mga0qj67_1522639_c1
1129 nmdc:mga0qj67_39690_c1
1130 nmdc:mga0qj67_412404_c1
1131 nmdc:mga0qj67_46248_c1
1132 nmdc:mga0qj67_5016_c1
1133 nmdc:mga0qj67_914715_c1
1134 nmdc:mga0qj67_915704_c1
1135 nmdc:mga06r32_1138651_c1
1136 nmdc:mga06r32_12466_c1
1137 nmdc:mga06r32_187471_c1
1138 nmdc:mga06r32_2495_c1
1139 nmdc:mga06r32_819256_c1
1140 nmdc:mga06r32_852157_c1
1141 nmdc:mga06r32_89254_c1
1142 nmdc:mga08y16_1621797_c1
1143 nmdc:mga08y16_19951_c1
1144 nmdc:mga08y16_321231_c1
1145 nmdc:mga08y16_537744_c1
1146 nmdc:mga08y16_8339_c1
1147 nmdc:mga0n895_21750_c1
1148 nmdc:mga0n895_24741_c1
1149 nmdc:mga0n895_280234_c1
1150 nmdc:mga0n895_999460_c1
1151 nmdc:mga0rr50_214499_c1
1152 nmdc:mga0a205_184045_c1
1153 nmdc:mga0a205_342615_c1
1154 nmdc:mga0a205_4382_c1
1155 nmdc:mga0a205_672340_c1
1156 Ga0495655_0024189
1157 Ga0501084_0134619
1158 Ga0501084_0419046
1159 Ga0501084_0549934
1160 Ga0501084_0730058
1161 Ga0501082_0069195
1162 Ga0501082_0161909
1163 Ga0501082_0831202
1164 Ga0530510_0003841
1165 Ga0530510_0156449
1166 Ga0530510_0348159
1167 Ga0530510_0690558
1168 Ga0530510_0887849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ovp-assembly1.cif.gz_A sterol carrier protein 2 from yarrowia lipolytica (apo form) 0.8387 14 111
8af2-assembly2.cif.gz_B human sterol carrier protein with unnatural amino acid 2,2'-bipyridine alanine incorporated at position 111 0.8175 14 115
4av7-assembly3.cif.gz_F structure determination of the double mutant s233y f250g from the sec- alkyl sulfatase pisa1 0.8153 15 116
4uei-assembly1.cif.gz_A solution structure of the sterol carrier protein domain 2 of helicoverpa armigera 0.8135 10 121
6ovp-assembly1.cif.gz_B sterol carrier protein 2 from yarrowia lipolytica (apo form) 0.8059 14 119
ID Description Score Start End Superfamily
af_P64599_56_138_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8564 37 119 3.30.1050.10
af_Q54PA2_138_240_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8179 15 117 3.30.1050.10
af_Q23655_1_112_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8143 15 118 3.30.1050.10
af_Q54PA2_1_113_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8132 14 119 3.30.1050.10
af_Q7KPQ9_334_441_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8111 14 120 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A538A315-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9749 1 138
AF-A0A2W5ZDF7-F1-model_v4 Sterol carrier protein 0.9738 1 139
AF-H0E6C7-F1-model_v4 SCP2 domain-containing protein 0.9727 4 139
AF-A0A538A315-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.968 1 138
AF-A0A2W5ZDF7-F1-model_v4 Sterol carrier protein 0.967 1 139

Map