F466331

General Info

Members Datasets Scaffolds Average Seq Length
584 220 584 62

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10146734|Ga0070658_101467343
Length 57
Sequence MRKAADKPKKCPLCGKPEPGCKDRDLLKWLGEGYRIPGPALDPLADPERVDSDETGD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
209 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
210 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
211 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
212 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
213 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
214 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 6.51
Rhizosphere 93.15
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4953892 2162886012 Bacteria 848
2 JGI24740J21852_10005513 3300001979 Bacteria 5341
3 JGI24737J22298_10000076 3300001990 Bacteria 29110
4 JGI24743J22301_10053976 3300001991 Bacteria 821
5 JGI24743J22301_10147289 3300001991 Bacteria 526
6 JGI24735J21928_10107100 3300002067 Bacteria 803
7 JGI24748J21848_1025758 3300002074 Bacteria 718
8 JGI24738J21930_10000015 3300002075 Bacteria 33032
9 JGI24742J22300_10119934 3300002244 Bacteria 519
10 JGI24751J29686_10033070 3300002459 Bacteria 1072
11 Ga0065715_10587902 3300005293 Bacteria 716
12 Ga0070658_10082352 3300005327 Bacteria 2644
13 Ga0070658_10092387 3300005327 Bacteria 2495
14 Ga0070658_10146734 3300005327 Bacteria 1973
15 Ga0070658_10165321 3300005327 Bacteria 1857
16 Ga0070658_10335462 3300005327 Bacteria 1293
17 Ga0070658_10552533 3300005327 Bacteria 996
18 Ga0070658_10597219 3300005327 Bacteria 957
19 Ga0070676_10006542 3300005328 Bacteria 6226
20 Ga0070676_10013642 3300005328 Bacteria 4455
21 Ga0070676_10056941 3300005328 Bacteria 2312
22 Ga0070676_10388527 3300005328 Bacteria 968
23 Ga0070676_11503507 3300005328 Bacteria 519
24 Ga0070683_100123221 3300005329 Bacteria 2449
25 Ga0070683_101003384 3300005329 Bacteria 801
26 Ga0070683_101230527 3300005329 Bacteria 719
27 Ga0070690_100245778 3300005330 Bacteria 1264
28 Ga0070690_100825471 3300005330 Bacteria 721
29 Ga0070690_101353828 3300005330 Bacteria 572
30 Ga0070670_100012026 3300005331 Bacteria 7403
31 Ga0070670_100017291 3300005331 Bacteria 6185
32 Ga0070670_100023817 3300005331 Bacteria 5268
33 Ga0070670_100037166 3300005331 Bacteria 4189
34 Ga0070670_100081478 3300005331 Bacteria 2780
35 Ga0070670_100084388 3300005331 Bacteria 2729
36 Ga0070670_100231979 3300005331 Bacteria 1606
37 Ga0070670_100369397 3300005331 Bacteria 1262
38 Ga0070670_100396054 3300005331 Bacteria 1219
39 Ga0068869_100000193 3300005334 Bacteria 31528
40 Ga0070666_10005906 3300005335 Bacteria 7517
41 Ga0070666_10008424 3300005335 Bacteria 6403
42 Ga0070666_10311692 3300005335 Bacteria 1122
43 Ga0070680_100030917 3300005336 Bacteria 4302
44 Ga0070682_100136170 3300005337 Bacteria 1668
45 Ga0070682_101062702 3300005337 Bacteria 676
46 Ga0068868_100001669 3300005338 Bacteria 15166
47 Ga0068868_100028211 3300005338 Bacteria 4289
48 Ga0068868_100303898 3300005338 Bacteria 1356
49 Ga0068868_100515989 3300005338 Bacteria 1049
50 Ga0068868_100574998 3300005338 Bacteria 996
51 Ga0070660_100010574 3300005339 Bacteria 6521
52 Ga0070660_100032709 3300005339 Bacteria 3916
53 Ga0070660_100039313 3300005339 Bacteria 3595
54 Ga0070660_100107995 3300005339 Bacteria 2211
55 Ga0070660_100303358 3300005339 Bacteria 1309
56 Ga0070660_100476950 3300005339 Bacteria 1036
57 Ga0070660_101393173 3300005339 Bacteria 596
58 Ga0070689_100041865 3300005340 Bacteria 3516
59 Ga0070691_10028214 3300005341 Bacteria 2621
60 Ga0070687_100404955 3300005343 Bacteria 896
61 Ga0070661_100001218 3300005344 Bacteria 18137
62 Ga0070661_100011598 3300005344 Bacteria 6144
63 Ga0070661_100019033 3300005344 Bacteria 4888
64 Ga0070661_100142048 3300005344 Bacteria 1810
65 Ga0070661_100187421 3300005344 Bacteria 1577
66 Ga0070661_100341197 3300005344 Bacteria 1173
67 Ga0070661_100428410 3300005344 Bacteria 1049
68 Ga0070661_100565220 3300005344 Bacteria 916
69 Ga0070661_100745270 3300005344 Bacteria 801
70 Ga0070661_100791674 3300005344 Bacteria 777
71 Ga0070668_100049452 3300005347 Bacteria 3235
72 Ga0070668_101999713 3300005347 Bacteria 534
73 Ga0070669_100001124 3300005353 Bacteria 19546
74 Ga0070669_100560188 3300005353 Bacteria 954
75 Ga0070669_100707196 3300005353 Bacteria 851
76 Ga0070675_100045768 3300005354 Bacteria 3581
77 Ga0070675_100088405 3300005354 Bacteria 2593
78 Ga0070675_100272868 3300005354 Bacteria 1484
79 Ga0070671_100002972 3300005355 Bacteria 13190
80 Ga0070671_100031163 3300005355 Bacteria 4404
81 Ga0070671_100035902 3300005355 Bacteria 4108
82 Ga0070671_100164564 3300005355 Bacteria 1875
83 Ga0070671_100480040 3300005355 Bacteria 1068
84 Ga0070671_100861494 3300005355 Bacteria 791
85 Ga0070673_100000693 3300005364 Bacteria 18567
86 Ga0070673_100012590 3300005364 Bacteria 5812
87 Ga0070673_100066623 3300005364 Bacteria 2877
88 Ga0070673_100154075 3300005364 Bacteria 1949
89 Ga0070673_100260150 3300005364 Bacteria 1516
90 Ga0070673_100303693 3300005364 Bacteria 1406
91 Ga0070673_100772684 3300005364 Bacteria 886
92 Ga0070688_100349088 3300005365 Bacteria 1083
93 Ga0070659_100001645 3300005366 Bacteria 16106
94 Ga0070659_100011088 3300005366 Bacteria 6659
95 Ga0070659_100076467 3300005366 Bacteria 2669
96 Ga0070659_100102846 3300005366 Bacteria 2300
97 Ga0070659_100409508 3300005366 Bacteria 1146
98 Ga0070659_100443990 3300005366 Bacteria 1100
99 Ga0070659_100643755 3300005366 Bacteria 914
100 Ga0070659_101038630 3300005366 Bacteria 720
101 Ga0070667_100008070 3300005367 Bacteria 8731
102 Ga0070667_100009666 3300005367 Bacteria 7999
103 Ga0070667_100018511 3300005367 Bacteria 5777
104 Ga0070667_100863324 3300005367 Bacteria 842
105 Ga0070663_100040499 3300005455 Bacteria 3262
106 Ga0070663_100064713 3300005455 Bacteria 2643
107 Ga0070663_100146579 3300005455 Bacteria 1806
108 Ga0070663_101444647 3300005455 Bacteria 610
109 Ga0070663_101613283 3300005455 Bacteria 579
110 Ga0070663_102122293 3300005455 Bacteria 506
111 Ga0070678_100001434 3300005456 Bacteria 12712
112 Ga0070678_100188821 3300005456 Bacteria 1693
113 Ga0070678_100199705 3300005456 Bacteria 1650
114 Ga0070662_100000572 3300005457 Bacteria 22470
115 Ga0070662_100006515 3300005457 Bacteria 7531
116 Ga0070662_100010701 3300005457 Bacteria 6037
117 Ga0070662_100104577 3300005457 Bacteria 2148
118 Ga0070662_100157965 3300005457 Bacteria 1771
119 Ga0070662_100188498 3300005457 Bacteria 1629
120 Ga0070662_100324285 3300005457 Bacteria 1256
121 Ga0070662_100442601 3300005457 Bacteria 1078
122 Ga0070681_10492711 3300005458 Bacteria 1139
123 Ga0070681_10515762 3300005458 Bacteria 1108
124 Ga0068867_100077535 3300005459 Bacteria 2497
125 Ga0068867_100201439 3300005459 Bacteria 1594
126 Ga0070685_10599188 3300005466 Bacteria 793
127 Ga0070685_10859452 3300005466 Bacteria 673
128 Ga0070679_100597881 3300005530 Bacteria 1046
129 Ga0070679_101148766 3300005530 Bacteria 722
130 Ga0070679_102189220 3300005530 Bacteria 502
131 Ga0070684_100013830 3300005535 Bacteria 6517
132 Ga0068853_100004056 3300005539 Bacteria 11275
133 Ga0068853_100013496 3300005539 Bacteria 6672
134 Ga0068853_100257040 3300005539 Bacteria 1605
135 Ga0068853_100599972 3300005539 Bacteria 1046
136 Ga0068853_100663050 3300005539 Bacteria 993
137 Ga0068853_100862994 3300005539 Bacteria 868
138 Ga0070672_100018375 3300005543 Bacteria 5054
139 Ga0070672_100053386 3300005543 Bacteria 3159
140 Ga0070672_100141806 3300005543 Bacteria 1983
141 Ga0070672_100249495 3300005543 Bacteria 1495
142 Ga0070672_102132162 3300005543 Bacteria 505
143 Ga0070686_100758962 3300005544 Bacteria 779
144 Ga0070696_100961333 3300005546 Bacteria 712
145 Ga0070693_100066716 3300005547 Bacteria 2107
146 Ga0070693_100365223 3300005547 Bacteria 992
147 Ga0070693_100860202 3300005547 Bacteria 677
148 Ga0070693_100962306 3300005547 Bacteria 644
149 Ga0070665_100037151 3300005548 Bacteria 4899
150 Ga0070665_100043419 3300005548 Bacteria 4518
151 Ga0070665_100223522 3300005548 Bacteria 1883
152 Ga0068855_100002282 3300005563 Bacteria 23688
153 Ga0068855_100002512 3300005563 Bacteria 22594
154 Ga0068855_100296136 3300005563 Bacteria 1793
155 Ga0068855_101074618 3300005563 Bacteria 842
156 Ga0068855_101397817 3300005563 Bacteria 721
157 Ga0068855_102263341 3300005563 Bacteria 545
158 Ga0070664_100006623 3300005564 Bacteria 9342
159 Ga0070664_100010371 3300005564 Bacteria 7560
160 Ga0070664_100028710 3300005564 Bacteria 4630
161 Ga0070664_100047468 3300005564 Bacteria 3627
162 Ga0070664_100170144 3300005564 Bacteria 1933
163 Ga0070664_100583985 3300005564 Bacteria 1035
164 Ga0068857_100000338 3300005577 Bacteria 32330
165 Ga0068857_100025569 3300005577 Bacteria 5198
166 Ga0068857_100031121 3300005577 Bacteria 4715
167 Ga0068857_100041267 3300005577 Bacteria 4092
168 Ga0068857_100262121 3300005577 Bacteria 1586
169 Ga0068857_100450850 3300005577 Bacteria 1203
170 Ga0068854_100304432 3300005578 Bacteria 1290
171 Ga0068854_100345332 3300005578 Bacteria 1216
172 Ga0068854_100459912 3300005578 Bacteria 1064
173 Ga0068854_100589483 3300005578 Bacteria 948
174 Ga0068856_100055783 3300005614 Bacteria 3899
175 Ga0068856_100190366 3300005614 Bacteria 2065
176 Ga0068856_100465838 3300005614 Bacteria 1284
177 Ga0068856_101446204 3300005614 Bacteria 702
178 Ga0068852_100001364 3300005616 Bacteria 16397
179 Ga0068852_100126615 3300005616 Bacteria 2347
180 Ga0068852_101645168 3300005616 Bacteria 664
181 Ga0068852_102732724 3300005616 Bacteria 512
182 Ga0068859_100001400 3300005617 Bacteria 24475
183 Ga0068859_100040235 3300005617 Bacteria 4692
184 Ga0068859_102627678 3300005617 Bacteria 554
185 Ga0068864_100000247 3300005618 Bacteria 48323
186 Ga0068864_100019593 3300005618 Bacteria 5659
187 Ga0068864_100160804 3300005618 Bacteria 2041
188 Ga0068864_101046915 3300005618 Bacteria 810
189 Ga0068866_10055086 3300005718 Bacteria 2041
190 Ga0068866_11069393 3300005718 Bacteria 577
191 Ga0068861_100009491 3300005719 Bacteria 6720
192 Ga0068851_10001413 3300005834 Bacteria 10495
193 Ga0068851_10066634 3300005834 Bacteria 1856
194 Ga0068851_10089417 3300005834 Bacteria 1620
195 Ga0068851_10638934 3300005834 Bacteria 651
196 Ga0068870_10039151 3300005840 Bacteria 2452
197 Ga0068863_100001653 3300005841 Bacteria 22048
198 Ga0068863_100006869 3300005841 Bacteria 11153
199 Ga0068863_100018916 3300005841 Bacteria 6592
200 Ga0068858_100001094 3300005842 Bacteria 28064
201 Ga0068858_100003322 3300005842 Bacteria 16018
202 Ga0068858_100085152 3300005842 Bacteria 2940
203 Ga0068858_100115417 3300005842 Bacteria 2509
204 Ga0068860_100042801 3300005843 Bacteria 4323
205 Ga0068860_100128219 3300005843 Bacteria 2433
206 Ga0068860_101589820 3300005843 Bacteria 676
207 Ga0068862_100015853 3300005844 Bacteria 6261
208 Ga0097621_100038091 3300006237 Bacteria 3857
209 Ga0097621_100039671 3300006237 Bacteria 3783
210 Ga0068871_100024031 3300006358 Bacteria 4723
211 Ga0068871_100060484 3300006358 Bacteria 3091
212 Ga0068871_101040868 3300006358 Bacteria 764
213 Ga0075434_101756369 3300006871 Bacteria 628
214 Ga0068865_100016671 3300006881 Bacteria 4707
215 Ga0068865_100022761 3300006881 Bacteria 4093
216 Ga0068865_100489434 3300006881 Bacteria 1024
217 Ga0097620_100001400 3300006931 Bacteria 24475
218 Ga0097620_100040239 3300006931 Bacteria 4692
219 Ga0097620_102627797 3300006931 Bacteria 554
220 Ga0075435_100518912 3300007076 Bacteria 1031
221 Ga0105240_10050358 3300009093 Bacteria 5252
222 Ga0105240_10257758 3300009093 Bacteria 2013
223 Ga0105245_10000128 3300009098 Bacteria 72249
224 Ga0105247_10606582 3300009101 Bacteria 812
225 Ga0105243_10013951 3300009148 Bacteria 6080
226 Ga0105241_10395204 3300009174 Bacteria 1211
227 Ga0105241_11195619 3300009174 Bacteria 720
228 Ga0105241_11272599 3300009174 Bacteria 699
229 Ga0105242_12152965 3300009176 Bacteria 602
230 Ga0105242_12321652 3300009176 Bacteria 583
231 Ga0105248_10000787 3300009177 Bacteria 35583
232 Ga0105248_10021872 3300009177 Bacteria 7086
233 Ga0105248_11309571 3300009177 Bacteria 819
234 Ga0105237_11011656 3300009545 Bacteria 838
235 Ga0105237_11382547 3300009545 Bacteria 710
236 Ga0105238_10099851 3300009551 Bacteria 2885
237 Ga0105238_10534349 3300009551 Bacteria 1176
238 Ga0105239_10073596 3300010375 Bacteria 3756
239 Ga0105239_11629598 3300010375 Bacteria 746
240 Ga0105246_10013355 3300011119 Bacteria 5147
241 Ga0105246_10226228 3300011119 Bacteria 1470
242 Ga0157373_10010173 3300013100 Bacteria 6930
243 Ga0157373_10011359 3300013100 Bacteria 6549
244 Ga0157373_10017549 3300013100 Bacteria 5212
245 Ga0157373_10063854 3300013100 Bacteria 2607
246 Ga0157373_10243413 3300013100 Bacteria 1271
247 Ga0157373_10283535 3300013100 Bacteria 1174
248 Ga0157373_11128618 3300013100 Bacteria 589
249 Ga0157371_10000850 3300013102 Bacteria 34892
250 Ga0157371_10002283 3300013102 Bacteria 18475
251 Ga0157371_10136480 3300013102 Bacteria 1747
252 Ga0157371_10921370 3300013102 Bacteria 663
253 Ga0157370_10002914 3300013104 Bacteria 20381
254 Ga0157370_10048327 3300013104 Bacteria 4076
255 Ga0157370_10057467 3300013104 Bacteria 3699
256 Ga0157370_10092528 3300013104 Bacteria 2838
257 Ga0157369_11604665 3300013105 Bacteria 661
258 Ga0157374_10007935 3300013296 Bacteria 9064
259 Ga0157374_10177953 3300013296 Bacteria 2077
260 Ga0157374_10334997 3300013296 Bacteria 1501
261 Ga0157374_11147619 3300013296 Bacteria 798
262 Ga0157378_10000396 3300013297 Bacteria 42907
263 Ga0157378_10129211 3300013297 Bacteria 2337
264 Ga0163162_10038822 3300013306 Bacteria 4753
265 Ga0163162_10283149 3300013306 Bacteria 1790
266 Ga0157372_10042447 3300013307 Bacteria 5031
267 Ga0157372_10052472 3300013307 Bacteria 4541
268 Ga0157375_10036724 3300013308 Bacteria 4689
269 Ga0157375_10171345 3300013308 Bacteria 2318
270 Ga0157375_11425235 3300013308 Bacteria 816
271 Ga0163163_10012045 3300014325 Bacteria 7869
272 Ga0163163_10067109 3300014325 Bacteria 3565
273 Ga0163163_10412729 3300014325 Bacteria 1409
274 Ga0182008_10895931 3300014497 Bacteria 522
275 Ga0157377_10022395 3300014745 Bacteria 3335
276 Ga0157379_10046223 3300014968 Bacteria 3885
277 Ga0163161_10040773 3300017792 Bacteria 3335
278 Ga0163161_10327277 3300017792 Bacteria 1213
279 Ga0197907_10872736 3300020069 Bacteria 1110
280 Ga0207697_10001345 3300025315 Bacteria 13489
281 Ga0207697_10016512 3300025315 Bacteria 3040
282 Ga0207697_10080201 3300025315 Bacteria 1375
283 Ga0207656_10050388 3300025321 Bacteria 1798
284 Ga0207688_10000063 3300025901 Bacteria 38711
285 Ga0207688_10128368 3300025901 Bacteria 1485
286 Ga0207680_10101456 3300025903 Bacteria 1850
287 Ga0207680_10230664 3300025903 Bacteria 1272
288 Ga0207647_10000227 3300025904 Bacteria 46631
289 Ga0207647_10785391 3300025904 Bacteria 513
290 Ga0207645_10008334 3300025907 Bacteria 7238
291 Ga0207643_10107273 3300025908 Bacteria 1642
292 Ga0207705_10001631 3300025909 Bacteria 17793
293 Ga0207705_10005876 3300025909 Bacteria 9128
294 Ga0207705_10043213 3300025909 Bacteria 3237
295 Ga0207705_10222002 3300025909 Bacteria 1436
296 Ga0207705_10361387 3300025909 Bacteria 1120
297 Ga0207654_11006154 3300025911 Bacteria 606
298 Ga0207707_11101402 3300025912 Bacteria 647
299 Ga0207695_10053788 3300025913 Bacteria 4208
300 Ga0207671_10105420 3300025914 Bacteria 2139
301 Ga0207660_10297703 3300025917 Bacteria 1284
302 Ga0207662_10081428 3300025918 Bacteria 1976
303 Ga0207657_10005706 3300025919 Bacteria 12994
304 Ga0207657_10014986 3300025919 Bacteria 7530
305 Ga0207657_10038370 3300025919 Bacteria 4265
306 Ga0207657_10063250 3300025919 Bacteria 3165
307 Ga0207657_10249104 3300025919 Bacteria 1417
308 Ga0207657_10337667 3300025919 Bacteria 1189
309 Ga0207657_10489567 3300025919 Bacteria 964
310 Ga0207649_10081764 3300025920 Bacteria 2093
311 Ga0207649_10120125 3300025920 Bacteria 1770
312 Ga0207649_11382122 3300025920 Bacteria 557
313 Ga0207652_10342739 3300025921 Bacteria 1349
314 Ga0207681_10002141 3300025923 Bacteria 12605
315 Ga0207650_10031461 3300025925 Bacteria 3832
316 Ga0207650_10518358 3300025925 Bacteria 997
317 Ga0207650_11033047 3300025925 Bacteria 699
318 Ga0207659_10016820 3300025926 Bacteria 4769
319 Ga0207659_10302679 3300025926 Bacteria 1314
320 Ga0207687_10000688 3300025927 Bacteria 22793
321 Ga0207644_10002354 3300025931 Bacteria 12202
322 Ga0207644_10031542 3300025931 Bacteria 3692
323 Ga0207644_10063596 3300025931 Bacteria 2679
324 Ga0207644_10486768 3300025931 Bacteria 1016
325 Ga0207690_10002416 3300025932 Bacteria 11291
326 Ga0207690_10105685 3300025932 Bacteria 2019
327 Ga0207690_10207744 3300025932 Bacteria 1491
328 Ga0207690_10334680 3300025932 Bacteria 1193
329 Ga0207706_10000648 3300025933 Bacteria 36742
330 Ga0207706_10015104 3300025933 Bacteria 6989
331 Ga0207706_10232479 3300025933 Bacteria 1613
332 Ga0207706_10352649 3300025933 Bacteria 1279
333 Ga0207686_11759848 3300025934 Bacteria 513
334 Ga0207670_10047031 3300025936 Bacteria 2871
335 Ga0207669_11224265 3300025937 Bacteria 636
336 Ga0207704_10029440 3300025938 Bacteria 3062
337 Ga0207704_10431846 3300025938 Bacteria 1047
338 Ga0207691_10000447 3300025940 Bacteria 40805
339 Ga0207691_10000926 3300025940 Bacteria 29127
340 Ga0207691_10668138 3300025940 Bacteria 877
341 Ga0207691_11693395 3300025940 Bacteria 512
342 Ga0207711_10006320 3300025941 Bacteria 9993
343 Ga0207711_10056579 3300025941 Bacteria 3370
344 Ga0207711_11353212 3300025941 Bacteria 654
345 Ga0207689_10000128 3300025942 Bacteria 64122
346 Ga0207679_10002019 3300025945 Bacteria 12587
347 Ga0207679_10150029 3300025945 Bacteria 1896
348 Ga0207679_10645152 3300025945 Bacteria 957
349 Ga0207679_11193248 3300025945 Bacteria 698
350 Ga0207679_11609852 3300025945 Bacteria 595
351 Ga0207667_10008152 3300025949 Bacteria 12475
352 Ga0207667_10194125 3300025949 Bacteria 2083
353 Ga0207651_10000352 3300025960 Bacteria 19418
354 Ga0207651_10017525 3300025960 Bacteria 4234
355 Ga0207651_10079387 3300025960 Bacteria 2357
356 Ga0207651_12013192 3300025960 Unclassified 519
357 Ga0207668_10093169 3300025972 Bacteria 2219
358 Ga0207668_10577140 3300025972 Bacteria 977
359 Ga0207668_10718433 3300025972 Bacteria 879
360 Ga0207640_10000450 3300025981 Bacteria 25025
361 Ga0207640_10189444 3300025981 Bacteria 1549
362 Ga0207658_10006524 3300025986 Bacteria 7963
363 Ga0207658_10043101 3300025986 Bacteria 3278
364 Ga0207677_10000532 3300026023 Bacteria 24064
365 Ga0207677_10206540 3300026023 Bacteria 1565
366 Ga0207703_10002043 3300026035 Bacteria 17819
367 Ga0207703_10095332 3300026035 Bacteria 2510
368 Ga0207703_10520045 3300026035 Bacteria 1119
369 Ga0207703_10596817 3300026035 Bacteria 1044
370 Ga0207639_10004878 3300026041 Bacteria 9029
371 Ga0207639_10171082 3300026041 Bacteria 1840
372 Ga0207639_11595067 3300026041 Bacteria 612
373 Ga0207678_10009892 3300026067 Bacteria 8372
374 Ga0207678_10334128 3300026067 Bacteria 1305
375 Ga0207702_10028534 3300026078 Bacteria 4639
376 Ga0207702_10150361 3300026078 Bacteria 2117
377 Ga0207702_10451427 3300026078 Bacteria 1247
378 Ga0207641_10001758 3300026088 Bacteria 20880
379 Ga0207641_10011841 3300026088 Bacteria 7157
380 Ga0207641_10025939 3300026088 Bacteria 4835
381 Ga0207648_10000876 3300026089 Bacteria 33914
382 Ga0207648_10486699 3300026089 Bacteria 1127
383 Ga0207676_10000220 3300026095 Bacteria 49329
384 Ga0207676_10024167 3300026095 Bacteria 4494
385 Ga0207674_10000859 3300026116 Bacteria 39717
386 Ga0207674_10001201 3300026116 Bacteria 33701
387 Ga0207674_10016891 3300026116 Bacteria 7974
388 Ga0207674_10043303 3300026116 Bacteria 4642
389 Ga0207674_10398177 3300026116 Bacteria 1331
390 Ga0207683_10001953 3300026121 Bacteria 18252
391 Ga0207698_10006945 3300026142 Bacteria 7085
392 Ga0207698_10219771 3300026142 Bacteria 1716
393 Ga0207698_10247751 3300026142 Bacteria 1628
394 Ga0268266_10093215 3300028379 Bacteria 2643
395 Ga0268266_10134911 3300028379 Bacteria 2210
396 Ga0268266_10500179 3300028379 Bacteria 1160
397 Ga0268265_10090927 3300028380 Bacteria 2439
398 Ga0268264_10023706 3300028381 Bacteria 5005
399 Ga0268264_10129213 3300028381 Bacteria 2237
400 Ga0268264_11431056 3300028381 Bacteria 702
401 Ga0307408_100014951 3300031548 Bacteria 5164
402 Ga0307405_10025842 3300031731 Bacteria 3376
403 Ga0307405_10302941 3300031731 Bacteria 1213
404 Ga0307413_10005918 3300031824 Bacteria 5525
405 Ga0307413_10089247 3300031824 Bacteria 2002
406 Ga0307410_10000318 3300031852 Bacteria 18700
407 Ga0307410_10004620 3300031852 Bacteria 7149
408 Ga0307410_10065671 3300031852 Bacteria 2496
409 Ga0307406_10606114 3300031901 Bacteria 903
410 Ga0307406_11053541 3300031901 Bacteria 700
411 Ga0307407_10008078 3300031903 Bacteria 4806
412 Ga0307407_10078983 3300031903 Bacteria 1984
413 Ga0307407_10135771 3300031903 Bacteria 1580
414 Ga0307412_10018649 3300031911 Bacteria 4181
415 Ga0307412_10204700 3300031911 Bacteria 1501
416 Ga0307409_100000544 3300031995 Bacteria 16354
417 Ga0307409_100024869 3300031995 Bacteria 4187
418 Ga0307409_100117589 3300031995 Bacteria 2243
419 Ga0307409_100123657 3300031995 Bacteria 2196
420 Ga0307409_100125727 3300031995 Bacteria 2180
421 Ga0307416_100038892 3300032002 Bacteria 3675
422 Ga0307416_100784589 3300032002 Bacteria 1047
423 Ga0307414_10006069 3300032004 Bacteria 6700
424 Ga0307414_10006389 3300032004 Bacteria 6571
425 Ga0307414_10125857 3300032004 Bacteria 1980
426 Ga0307411_10001198 3300032005 Bacteria 10265
427 Ga0307411_10030698 3300032005 Bacteria 3297
428 Ga0307411_10179025 3300032005 Bacteria 1607
429 Ga0307411_10294817 3300032005 Bacteria 1298
430 Ga0307411_10311773 3300032005 Bacteria 1266
431 Ga0307415_100033862 3300032126 Bacteria 3319
432 Ga0307415_100058509 3300032126 Bacteria 2654
433 Ga0307415_100181832 3300032126 Bacteria 1650
434 Ga0373948_0123659 3300034817 Bacteria 627
435 Ga0373959_0045578 3300034820 Bacteria 933
436 Ga0373943_0001269 3300035170 Bacteria 11294
437 Ga0373946_0029622 3300035171 Bacteria 2180
438 Ga0373931_0128326 3300035691 Bacteria 1457
439 Ga0373931_1081713 3300035691 Bacteria 545
440 Ga0373935_0080509 3300035692 Bacteria 2116
441 Ga0373947_0060691 3300035725 Bacteria 2296
442 Ga0373925_0050105 3300037068 Bacteria 3114
443 Ga0395899_0008800 3300037312 Bacteria 7767
444 Ga0395899_0070269 3300037312 Bacteria 2562
445 Ga0395899_0088236 3300037312 Bacteria 2250
446 Ga0395899_0147624 3300037312 Bacteria 1669
447 Ga0395899_0172350 3300037312 Bacteria 1523
448 Ga0395899_0188911 3300037312 Bacteria 1442
449 Ga0395899_0334146 3300037312 Bacteria 1017
450 Ga0395899_0960020 3300037312 Bacteria 518
451 Ga0395900_0002600 3300037418 Bacteria 19734
452 Ga0395900_0018874 3300037418 Bacteria 7034
453 Ga0395900_0022720 3300037418 Bacteria 6420
454 Ga0395900_0057890 3300037418 Bacteria 3990
455 Ga0395900_0140171 3300037418 Bacteria 2476
456 Ga0395900_0180293 3300037418 Bacteria 2147
457 Ga0395900_0222557 3300037418 Bacteria 1901
458 Ga0395900_0267408 3300037418 Bacteria 1705
459 Ga0395900_0328607 3300037418 Bacteria 1507
460 Ga0395900_0430045 3300037418 Bacteria 1279
461 Ga0395900_0792082 3300037418 Bacteria 876
462 Ga0395900_0805071 3300037418 Bacteria 867
463 Ga0395900_0939934 3300037418 Bacteria 786
464 Ga0395898_0014314 3300037466 Bacteria 8152
465 Ga0395898_0058736 3300037466 Bacteria 3743
466 Ga0395898_0163026 3300037466 Bacteria 2132
467 Ga0395898_0170538 3300037466 Bacteria 2080
468 Ga0395898_0283317 3300037466 Bacteria 1581
469 Ga0395898_0386140 3300037466 Bacteria 1335
470 Ga0395898_0391880 3300037466 Bacteria 1324
471 Ga0395898_0509677 3300037466 Bacteria 1144
472 Ga0395905_0000187 3300037471 Bacteria 98895
473 Ga0395905_0018501 3300037471 Bacteria 6613
474 Ga0395905_0026436 3300037471 Bacteria 5472
475 Ga0395905_0150037 3300037471 Bacteria 2193
476 Ga0395905_0193107 3300037471 Bacteria 1909
477 Ga0395905_0216772 3300037471 Bacteria 1792
478 Ga0395905_0231058 3300037471 Bacteria 1729
479 Ga0395905_0458135 3300037471 Bacteria 1173
480 Ga0395905_0683665 3300037471 Bacteria 928
481 Ga0395905_0857242 3300037471 Bacteria 811
482 Ga0395905_0941795 3300037471 Bacteria 766
483 Ga0395905_0942885 3300037471 Bacteria 766
484 Ga0395905_1298592 3300037471 Bacteria 631
485 Ga0395901_0000041 3300038443 Bacteria 202314
486 Ga0395901_0087139 3300038443 Bacteria 3264
487 Ga0395901_0088592 3300038443 Bacteria 3237
488 Ga0395901_0156330 3300038443 Bacteria 2395
489 Ga0395901_0230012 3300038443 Bacteria 1936
490 Ga0395901_0772083 3300038443 Bacteria 952
491 Ga0395901_1021325 3300038443 Bacteria 801
492 Ga0395901_1130084 3300038443 Bacteria 752
493 Ga0451791_0464501 3300041451 Bacteria 824
494 Ga0451849_1152474 3300041505 Bacteria 590
495 Ga0439432_183258 3300042006 Bacteria 609
496 Ga0466972_0154921 3300044658 Bacteria 1076
497 Ga0466965_0237127 3300044683 Bacteria 976
498 Ga0466961_0170332 3300044693 Bacteria 1354
499 Ga0466963_0064536 3300044694 Bacteria 2453
500 Ga0466963_0078400 3300044694 Bacteria 2233
501 Ga0466963_0119912 3300044694 Bacteria 1809
502 Ga0466963_0192344 3300044694 Bacteria 1425
503 Ga0466963_0229353 3300044694 Bacteria 1301
504 Ga0466963_0553395 3300044694 Bacteria 812
505 Ga0466963_0605087 3300044694 Bacteria 774
506 Ga0466971_0097586 3300044719 Bacteria 1348
507 Ga0466971_0141872 3300044719 Bacteria 1119
508 Ga0466970_0133469 3300044765 Bacteria 1365
509 Ga0466957_0001404 3300044842 Bacteria 12549
510 Ga0466957_0353133 3300044842 Bacteria 998
511 Ga0466960_0021587 3300044901 Bacteria 2869
512 Ga0466959_0087575 3300045049 Bacteria 2240
513 Ga0466958_0000406 3300045836 Bacteria 17679
514 Ga0466958_0439337 3300045836 Bacteria 844
515 Ga0466967_0003802 3300045976 Bacteria 9980
516 Ga0466967_0036444 3300045976 Bacteria 4199
517 Ga0466967_0193675 3300045976 Bacteria 1922
518 Ga0466967_0314053 3300045976 Bacteria 1510
519 Ga0466967_0534069 3300045976 Bacteria 1153
520 Ga0466967_0581043 3300045976 Bacteria 1104
521 Ga0466967_0593794 3300045976 Bacteria 1092
522 Ga0466967_0973724 3300045976 Bacteria 844
523 Ga0495580_0260473 3300046472 Bacteria 1186
524 Ga0495631_0505007 3300046518 Unclassified 515
525 Ga0495663_0027810 3300046525 Bacteria 1661
526 Ga0495663_0388229 3300046525 Bacteria 512
527 Ga0495621_0051325 3300046539 Bacteria 1476
528 Ga0495668_0509791 3300046616 Bacteria 663
529 Ga0495669_0000380 3300046684 Bacteria 22405
530 Ga0495669_0025416 3300046684 Bacteria 2583
531 Ga0495669_0084167 3300046684 Bacteria 1462
532 Ga0495669_0130954 3300046684 Bacteria 1180
533 Ga0495670_0200043 3300046691 Bacteria 1058
534 Ga0495677_0003986 3300047445 Bacteria 5704
535 Ga0496100_0013054 3300048903 Bacteria 4780
536 Ga0496100_0347637 3300048903 Bacteria 1119
537 Ga0496100_0962226 3300048903 Bacteria 671
538 Ga0496101_0001546 3300048904 Bacteria 13788
539 Ga0496101_0052814 3300048904 Bacteria 2931
540 Ga0496101_0098678 3300048904 Bacteria 2183
541 Ga0496101_0264462 3300048904 Bacteria 1342
542 Ga0496102_0074543 3300048905 Bacteria 3119
543 Ga0496102_0089404 3300048905 Bacteria 2849
544 Ga0496103_0135119 3300048906 Bacteria 1576
545 Ga0496106_0025859 3300048909 Bacteria 4368
546 Ga0496106_0043733 3300048909 Bacteria 3361
547 Ga0496106_0889592 3300048909 Bacteria 703
548 Ga0496107_0022291 3300048910 Bacteria 4476
549 Ga0496107_0039311 3300048910 Bacteria 3393
550 Ga0496107_0131362 3300048910 Bacteria 1849
551 Ga0496107_0980814 3300048910 Bacteria 614
552 Ga0496108_0006096 3300048911 Bacteria 9752
553 Ga0496108_0019846 3300048911 Bacteria 5521
554 Ga0496109_0013298 3300048912 Bacteria 7130
555 Ga0496109_1382401 3300048912 Bacteria 639
556 Ga0496110_0011640 3300048913 Bacteria 7213
557 Ga0496110_0026694 3300048913 Bacteria 4945
558 Ga0496111_0013072 3300048914 Bacteria 5638
559 Ga0496111_0313840 3300048914 Bacteria 1161
560 Ga0496112_0011982 3300048915 Bacteria 7949
561 Ga0496112_0068445 3300048915 Bacteria 3505
562 Ga0496112_0157345 3300048915 Bacteria 2239
563 Ga0496112_0196715 3300048915 Bacteria 1976
564 Ga0496113_0008110 3300048916 Bacteria 6820
565 Ga0496113_0198874 3300048916 Bacteria 1593
566 Ga0496113_0511901 3300048916 Bacteria 963
567 Ga0496114_0000029 3300048917 Bacteria 175132
568 Ga0496114_0013079 3300048917 Bacteria 6649
569 Ga0496114_0201105 3300048917 Bacteria 1745
570 Ga0496114_1036043 3300048917 Bacteria 704
571 Ga0496115_0004979 3300048918 Bacteria 9643
572 Ga0501242_058403 3300049674 Bacteria 582
573 Ga0501253_148530 3300049683 Bacteria 589
574 Ga0501263_015353 3300049760 Bacteria 988
575 Ga0501267_004722 3300049764 Bacteria 1274
576 Ga0501268_005931 3300049765 Bacteria 1773
577 Ga0501270_017815 3300049767 Bacteria 1044
578 Ga0501204_008952 3300049850 Bacteria 1150
579 nmdc:mga0n895_2068108_c1 3300050512 Bacteria 526
580 nmdc:mga0rr50_865057_c1 3300050513 Bacteria 771
581 nmdc:mga0a205_688129_c1 3300050515 Bacteria 873
582 Ga0500604_0010554 3300053151 Bacteria 2473
583 Ga0466962_0016571 3300061719 Bacteria 3553
584 Ga0530510_0421885 3300061734 Bacteria 1007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10146734 Ga0070658_101467343 52
2 3300005331 Ga0070670_100369397 Ga0070670_1003693972 52
3 3300005339 Ga0070660_100107995 Ga0070660_1001079952 52
4 3300005344 Ga0070661_100341197 Ga0070661_1003411971 52
5 3300005366 Ga0070659_100076467 Ga0070659_1000764675 52
6 3300005455 Ga0070663_100040499 Ga0070663_1000404993 52
7 3300005457 Ga0070662_100010701 Ga0070662_1000107018 52
8 3300005539 Ga0068853_100862994 Ga0068853_1008629942 52
9 3300005564 Ga0070664_100006623 Ga0070664_10000662311 52
10 3300009174 Ga0105241_10395204 Ga0105241_103952042 52
11 3300013100 Ga0157373_10063854 Ga0157373_100638542 52
12 3300025909 Ga0207705_10043213 Ga0207705_100432135 52
13 3300025919 Ga0207657_10038370 Ga0207657_100383702 52
14 3300025933 Ga0207706_10352649 Ga0207706_103526492 52
15 3300025945 Ga0207679_11193248 Ga0207679_111932482 52
16 3300026041 Ga0207639_10171082 Ga0207639_101710822 52
17 3300026067 Ga0207678_10334128 Ga0207678_103341283 52
18 3300061734 Ga0530510_0421885 Ga0530510_0421885_216_416 52
19 3300005293 Ga0065715_10587902 Ga0065715_105879022 57
20 3300005327 Ga0070658_10092387 Ga0070658_100923872 57
21 3300005331 Ga0070670_100084388 Ga0070670_1000843881 57
22 3300005339 Ga0070660_100032709 Ga0070660_1000327092 57
23 3300005347 Ga0070668_101999713 Ga0070668_1019997132 57
24 3300005353 Ga0070669_100560188 Ga0070669_1005601882 57
25 3300005353 Ga0070669_100707196 Ga0070669_1007071962 57
26 3300005354 Ga0070675_100045768 Ga0070675_1000457685 57
27 3300005355 Ga0070671_100480040 Ga0070671_1004800402 57
28 3300005364 Ga0070673_100154075 Ga0070673_1001540752 57
29 3300005364 Ga0070673_100260150 Ga0070673_1002601503 57
30 3300005364 Ga0070673_100303693 Ga0070673_1003036932 57
31 3300005366 Ga0070659_100443990 Ga0070659_1004439902 57
32 3300005455 Ga0070663_101444647 Ga0070663_1014446472 57
33 3300005457 Ga0070662_100188498 Ga0070662_1001884982 57
34 3300005563 Ga0068855_100002512 Ga0068855_10000251216 57
35 3300013100 Ga0157373_10010173 Ga0157373_100101737 57
36 3300013102 Ga0157371_10002283 Ga0157371_100022834 57
37 3300013104 Ga0157370_10057467 Ga0157370_100574673 57
38 3300025315 Ga0207697_10016512 Ga0207697_100165122 57
39 3300025901 Ga0207688_10128368 Ga0207688_101283682 57
40 3300025919 Ga0207657_10489567 Ga0207657_104895672 57
41 3300050515 nmdc:mga0a205_688129_c1 nmdc:mga0a205_688129_c1_314_499 57
42 3300005328 Ga0070676_10013642 Ga0070676_100136425 58
43 3300005338 Ga0068868_100515989 Ga0068868_1005159892 58
44 3300005344 Ga0070661_100001218 Ga0070661_10000121816 58
45 3300005458 Ga0070681_10492711 Ga0070681_104927112 58
46 3300025909 Ga0207705_10001631 Ga0207705_100016312 58
47 3300025912 Ga0207707_11101402 Ga0207707_111014022 58
48 3300025932 Ga0207690_10207744 Ga0207690_102077442 58
49 3300026023 Ga0207677_10206540 Ga0207677_102065403 58
50 3300026041 Ga0207639_11595067 Ga0207639_115950672 58
51 3300001990 JGI24737J22298_10000076 JGI24737J22298_100000767 59
52 3300001991 JGI24743J22301_10053976 JGI24743J22301_100539763 59
53 3300002074 JGI24748J21848_1025758 JGI24748J21848_10257583 59
54 3300002075 JGI24738J21930_10000015 JGI24738J21930_1000001510 59
55 3300002244 JGI24742J22300_10119934 JGI24742J22300_101199342 59
56 3300002459 JGI24751J29686_10033070 JGI24751J29686_100330703 59
57 3300005328 Ga0070676_10006542 Ga0070676_100065426 59
58 3300005330 Ga0070690_100825471 Ga0070690_1008254712 59
59 3300005331 Ga0070670_100023817 Ga0070670_1000238172 59
60 3300005331 Ga0070670_100037166 Ga0070670_1000371666 59
61 3300005334 Ga0068869_100000193 Ga0068869_10000019319 59
62 3300005335 Ga0070666_10008424 Ga0070666_100084247 59
63 3300005338 Ga0068868_100001669 Ga0068868_1000016693 59
64 3300005339 Ga0070660_100010574 Ga0070660_1000105747 59
65 3300005340 Ga0070689_100041865 Ga0070689_1000418654 59
66 3300005344 Ga0070661_100011598 Ga0070661_1000115985 59
67 3300005344 Ga0070661_100745270 Ga0070661_1007452702 59
68 3300005347 Ga0070668_100049452 Ga0070668_1000494522 59
69 3300005353 Ga0070669_100001124 Ga0070669_1000011247 59
70 3300005354 Ga0070675_100088405 Ga0070675_1000884052 59
71 3300005355 Ga0070671_100002972 Ga0070671_1000029728 59
72 3300005364 Ga0070673_100000693 Ga0070673_10000069312 59
73 3300005365 Ga0070688_100349088 Ga0070688_1003490882 59
74 3300005366 Ga0070659_100001645 Ga0070659_1000016458 59
75 3300005367 Ga0070667_100009666 Ga0070667_1000096667 59
76 3300005455 Ga0070663_102122293 Ga0070663_1021222932 59
77 3300005456 Ga0070678_100199705 Ga0070678_1001997052 59
78 3300005457 Ga0070662_100000572 Ga0070662_10000057211 59
79 3300005459 Ga0068867_100077535 Ga0068867_1000775352 59
80 3300005466 Ga0070685_10599188 Ga0070685_105991882 59
81 3300005539 Ga0068853_100004056 Ga0068853_1000040567 59
82 3300005543 Ga0070672_100141806 Ga0070672_1001418062 59
83 3300005543 Ga0070672_100249495 Ga0070672_1002494952 59
84 3300005547 Ga0070693_100066716 Ga0070693_1000667162 59
85 3300005548 Ga0070665_100223522 Ga0070665_1002235223 59
86 3300005563 Ga0068855_100002282 Ga0068855_10000228212 59
87 3300005564 Ga0070664_100170144 Ga0070664_1001701442 59
88 3300005577 Ga0068857_100000338 Ga0068857_10000033837 59
89 3300005578 Ga0068854_100304432 Ga0068854_1003044322 59
90 3300005616 Ga0068852_100001364 Ga0068852_1000013647 59
91 3300005617 Ga0068859_100001400 Ga0068859_10000140017 59
92 3300005618 Ga0068864_100000247 Ga0068864_10000024723 59
93 3300005719 Ga0068861_100009491 Ga0068861_1000094917 59
94 3300005834 Ga0068851_10001413 Ga0068851_100014132 59
95 3300005834 Ga0068851_10089417 Ga0068851_100894173 59
96 3300005840 Ga0068870_10039151 Ga0068870_100391512 59
97 3300005841 Ga0068863_100001653 Ga0068863_1000016537 59
98 3300005842 Ga0068858_100001094 Ga0068858_10000109421 59
99 3300005843 Ga0068860_100042801 Ga0068860_1000428016 59
100 3300005844 Ga0068862_100015853 Ga0068862_1000158537 59
101 3300006881 Ga0068865_100016671 Ga0068865_1000166716 59
102 3300006931 Ga0097620_100001400 Ga0097620_10000140017 59
103 3300009093 Ga0105240_10257758 Ga0105240_102577583 59
104 3300009098 Ga0105245_10000128 Ga0105245_1000012837 59
105 3300009148 Ga0105243_10013951 Ga0105243_100139513 59
106 3300009177 Ga0105248_10000787 Ga0105248_1000078730 59
107 3300010375 Ga0105239_10073596 Ga0105239_100735966 59
108 3300011119 Ga0105246_10013355 Ga0105246_100133556 59
109 3300013100 Ga0157373_10011359 Ga0157373_100113597 59
110 3300013102 Ga0157371_10000850 Ga0157371_1000085023 59
111 3300013297 Ga0157378_10000396 Ga0157378_1000039624 59
112 3300013306 Ga0163162_10283149 Ga0163162_102831493 59
113 3300013307 Ga0157372_10052472 Ga0157372_100524722 59
114 3300013308 Ga0157375_10171345 Ga0157375_101713453 59
115 3300014745 Ga0157377_10022395 Ga0157377_100223954 59
116 3300025315 Ga0207697_10001345 Ga0207697_100013453 59
117 3300025315 Ga0207697_10080201 Ga0207697_100802013 59
118 3300025901 Ga0207688_10000063 Ga0207688_100000638 59
119 3300025903 Ga0207680_10101456 Ga0207680_101014562 59
120 3300025904 Ga0207647_10000227 Ga0207647_1000022738 59
121 3300025907 Ga0207645_10008334 Ga0207645_100083345 59
122 3300025908 Ga0207643_10107273 Ga0207643_101072732 59
123 3300025913 Ga0207695_10053788 Ga0207695_100537883 59
124 3300025919 Ga0207657_10005706 Ga0207657_100057068 59
125 3300025920 Ga0207649_10081764 Ga0207649_100817642 59
126 3300025923 Ga0207681_10002141 Ga0207681_100021418 59
127 3300025926 Ga0207659_10016820 Ga0207659_100168203 59
128 3300025927 Ga0207687_10000688 Ga0207687_100006882 59
129 3300025931 Ga0207644_10031542 Ga0207644_100315425 59
130 3300025932 Ga0207690_10002416 Ga0207690_100024168 59
131 3300025933 Ga0207706_10000648 Ga0207706_1000064814 59
132 3300025936 Ga0207670_10047031 Ga0207670_100470314 59
133 3300025938 Ga0207704_10029440 Ga0207704_100294405 59
134 3300025940 Ga0207691_10000447 Ga0207691_1000044738 59
135 3300025941 Ga0207711_10006320 Ga0207711_100063203 59
136 3300025942 Ga0207689_10000128 Ga0207689_100001287 59
137 3300025945 Ga0207679_10150029 Ga0207679_101500293 59
138 3300025949 Ga0207667_10008152 Ga0207667_100081524 59
139 3300025960 Ga0207651_10000352 Ga0207651_100003527 59
140 3300025972 Ga0207668_10093169 Ga0207668_100931693 59
141 3300025981 Ga0207640_10000450 Ga0207640_100004508 59
142 3300025986 Ga0207658_10006524 Ga0207658_100065248 59
143 3300026023 Ga0207677_10000532 Ga0207677_100005328 59
144 3300026035 Ga0207703_10002043 Ga0207703_100020435 59
145 3300026041 Ga0207639_10004878 Ga0207639_100048785 59
146 3300026088 Ga0207641_10001758 Ga0207641_1000175821 59
147 3300026089 Ga0207648_10000876 Ga0207648_1000087627 59
148 3300026095 Ga0207676_10000220 Ga0207676_1000022031 59
149 3300026116 Ga0207674_10001201 Ga0207674_1000120138 59
150 3300026142 Ga0207698_10006945 Ga0207698_100069452 59
151 3300028379 Ga0268266_10093215 Ga0268266_100932152 59
152 3300028380 Ga0268265_10090927 Ga0268265_100909273 59
153 3300028381 Ga0268264_10023706 Ga0268264_100237066 59
154 3300037418 Ga0395900_0939934 Ga0395900_0939934_557_739 59
155 3300037471 Ga0395905_0683665 Ga0395905_0683665_571_753 59
156 3300041451 Ga0451791_0464501 Ga0451791_0464501_278_457 59
157 3300041505 Ga0451849_1152474 Ga0451849_1152474_152_331 59
158 3300005327 Ga0070658_10597219 Ga0070658_105972192 60
159 3300005366 Ga0070659_100409508 Ga0070659_1004095082 60
160 3300005539 Ga0068853_100599972 Ga0068853_1005999723 60
161 3300005547 Ga0070693_100365223 Ga0070693_1003652232 60
162 3300005577 Ga0068857_100450850 Ga0068857_1004508503 60
163 3300009174 Ga0105241_11272599 Ga0105241_112725992 60
164 3300025919 Ga0207657_10063250 Ga0207657_100632502 60
165 3300025919 Ga0207657_10337667 Ga0207657_103376672 60
166 3300025932 Ga0207690_10105685 Ga0207690_101056853 60
167 3300031548 Ga0307408_100014951 Ga0307408_1000149513 60
168 3300031731 Ga0307405_10025842 Ga0307405_100258423 60
169 3300031731 Ga0307405_10302941 Ga0307405_103029413 60
170 3300031824 Ga0307413_10005918 Ga0307413_100059183 60
171 3300031852 Ga0307410_10004620 Ga0307410_100046208 60
172 3300031852 Ga0307410_10065671 Ga0307410_100656712 60
173 3300031901 Ga0307406_10606114 Ga0307406_106061143 60
174 3300031901 Ga0307406_11053541 Ga0307406_110535412 60
175 3300031903 Ga0307407_10008078 Ga0307407_100080783 60
176 3300031903 Ga0307407_10078983 Ga0307407_100789833 60
177 3300031903 Ga0307407_10135771 Ga0307407_101357713 60
178 3300031911 Ga0307412_10018649 Ga0307412_100186495 60
179 3300031911 Ga0307412_10204700 Ga0307412_102047003 60
180 3300031995 Ga0307409_100024869 Ga0307409_1000248693 60
181 3300031995 Ga0307409_100117589 Ga0307409_1001175893 60
182 3300031995 Ga0307409_100123657 Ga0307409_1001236572 60
183 3300031995 Ga0307409_100125727 Ga0307409_1001257274 60
184 3300032002 Ga0307416_100038892 Ga0307416_1000388923 60
185 3300032002 Ga0307416_100784589 Ga0307416_1007845893 60
186 3300032004 Ga0307414_10006389 Ga0307414_100063893 60
187 3300032004 Ga0307414_10125857 Ga0307414_101258573 60
188 3300032005 Ga0307411_10030698 Ga0307411_100306983 60
189 3300032005 Ga0307411_10179025 Ga0307411_101790253 60
190 3300032005 Ga0307411_10294817 Ga0307411_102948172 60
191 3300032005 Ga0307411_10311773 Ga0307411_103117732 60
192 3300032126 Ga0307415_100033862 Ga0307415_1000338623 60
193 3300032126 Ga0307415_100058509 Ga0307415_1000585092 60
194 3300032126 Ga0307415_100181832 Ga0307415_1001818323 60
195 3300042006 Ga0439432_183258 Ga0439432_183258_266_466 60
196 3300048910 Ga0496107_0980814 Ga0496107_0980814_181_366 60
197 3300049674 Ga0501242_058403 Ga0501242_058403_183_383 60
198 3300049683 Ga0501253_148530 Ga0501253_148530_281_481 60
199 3300049760 Ga0501263_015353 Ga0501263_015353_297_497 60
200 3300049764 Ga0501267_004722 Ga0501267_004722_404_604 60
201 3300049765 Ga0501268_005931 Ga0501268_005931_1117_1317 60
202 3300049767 Ga0501270_017815 Ga0501270_017815_238_438 60
203 3300049850 Ga0501204_008952 Ga0501204_008952_144_344 60
204 3300053151 Ga0500604_0010554 Ga0500604_0010554_355_564 60
205 2162886012 MBSR1b_contig_4953892 MBSR1b_0184.00000360 61
206 3300001979 JGI24740J21852_10005513 JGI24740J21852_100055136 61
207 3300001991 JGI24743J22301_10147289 JGI24743J22301_101472892 61
208 3300002067 JGI24735J21928_10107100 JGI24735J21928_101071003 61
209 3300005327 Ga0070658_10082352 Ga0070658_100823524 61
210 3300005327 Ga0070658_10165321 Ga0070658_101653212 61
211 3300005327 Ga0070658_10335462 Ga0070658_103354622 61
212 3300005327 Ga0070658_10552533 Ga0070658_105525332 61
213 3300005328 Ga0070676_10056941 Ga0070676_100569413 61
214 3300005328 Ga0070676_10388527 Ga0070676_103885272 61
215 3300005328 Ga0070676_11503507 Ga0070676_115035072 61
216 3300005329 Ga0070683_100123221 Ga0070683_1001232213 61
217 3300005329 Ga0070683_101003384 Ga0070683_1010033842 61
218 3300005329 Ga0070683_101230527 Ga0070683_1012305272 61
219 3300005330 Ga0070690_100245778 Ga0070690_1002457782 61
220 3300005330 Ga0070690_101353828 Ga0070690_1013538282 61
221 3300005331 Ga0070670_100012026 Ga0070670_1000120265 61
222 3300005331 Ga0070670_100017291 Ga0070670_1000172917 61
223 3300005331 Ga0070670_100081478 Ga0070670_1000814785 61
224 3300005331 Ga0070670_100231979 Ga0070670_1002319793 61
225 3300005331 Ga0070670_100396054 Ga0070670_1003960542 61
226 3300005335 Ga0070666_10005906 Ga0070666_100059065 61
227 3300005335 Ga0070666_10311692 Ga0070666_103116923 61
228 3300005336 Ga0070680_100030917 Ga0070680_1000309175 61
229 3300005337 Ga0070682_100136170 Ga0070682_1001361702 61
230 3300005337 Ga0070682_101062702 Ga0070682_1010627022 61
231 3300005338 Ga0068868_100028211 Ga0068868_1000282113 61
232 3300005338 Ga0068868_100303898 Ga0068868_1003038982 61
233 3300005338 Ga0068868_100574998 Ga0068868_1005749982 61
234 3300005339 Ga0070660_100039313 Ga0070660_1000393134 61
235 3300005339 Ga0070660_100303358 Ga0070660_1003033582 61
236 3300005339 Ga0070660_100476950 Ga0070660_1004769502 61
237 3300005339 Ga0070660_101393173 Ga0070660_1013931732 61
238 3300005341 Ga0070691_10028214 Ga0070691_100282143 61
239 3300005343 Ga0070687_100404955 Ga0070687_1004049553 61
240 3300005344 Ga0070661_100019033 Ga0070661_1000190336 61
241 3300005344 Ga0070661_100142048 Ga0070661_1001420482 61
242 3300005344 Ga0070661_100187421 Ga0070661_1001874212 61
243 3300005344 Ga0070661_100428410 Ga0070661_1004284102 61
244 3300005344 Ga0070661_100565220 Ga0070661_1005652202 61
245 3300005344 Ga0070661_100791674 Ga0070661_1007916743 61
246 3300005354 Ga0070675_100272868 Ga0070675_1002728682 61
247 3300005355 Ga0070671_100031163 Ga0070671_1000311636 61
248 3300005355 Ga0070671_100035902 Ga0070671_1000359022 61
249 3300005355 Ga0070671_100164564 Ga0070671_1001645642 61
250 3300005355 Ga0070671_100861494 Ga0070671_1008614942 61
251 3300005364 Ga0070673_100012590 Ga0070673_1000125905 61
252 3300005364 Ga0070673_100066623 Ga0070673_1000666234 61
253 3300005364 Ga0070673_100772684 Ga0070673_1007726841 61
254 3300005366 Ga0070659_100011088 Ga0070659_1000110885 61
255 3300005366 Ga0070659_100102846 Ga0070659_1001028462 61
256 3300005366 Ga0070659_100643755 Ga0070659_1006437552 61
257 3300005366 Ga0070659_101038630 Ga0070659_1010386302 61
258 3300005367 Ga0070667_100008070 Ga0070667_1000080708 61
259 3300005367 Ga0070667_100018511 Ga0070667_1000185113 61
260 3300005367 Ga0070667_100863324 Ga0070667_1008633242 61
261 3300005455 Ga0070663_100064713 Ga0070663_1000647135 61
262 3300005455 Ga0070663_100146579 Ga0070663_1001465793 61
263 3300005455 Ga0070663_101613283 Ga0070663_1016132832 61
264 3300005456 Ga0070678_100001434 Ga0070678_10000143410 61
265 3300005456 Ga0070678_100188821 Ga0070678_1001888212 61
266 3300005457 Ga0070662_100006515 Ga0070662_1000065159 61
267 3300005457 Ga0070662_100104577 Ga0070662_1001045774 61
268 3300005457 Ga0070662_100157965 Ga0070662_1001579653 61
269 3300005457 Ga0070662_100324285 Ga0070662_1003242852 61
270 3300005457 Ga0070662_100442601 Ga0070662_1004426013 61
271 3300005458 Ga0070681_10515762 Ga0070681_105157622 61
272 3300005459 Ga0068867_100201439 Ga0068867_1002014392 61
273 3300005466 Ga0070685_10859452 Ga0070685_108594522 61
274 3300005530 Ga0070679_100597881 Ga0070679_1005978812 61
275 3300005530 Ga0070679_101148766 Ga0070679_1011487662 61
276 3300005530 Ga0070679_102189220 Ga0070679_1021892202 61
277 3300005535 Ga0070684_100013830 Ga0070684_1000138303 61
278 3300005539 Ga0068853_100013496 Ga0068853_1000134964 61
279 3300005539 Ga0068853_100257040 Ga0068853_1002570402 61
280 3300005539 Ga0068853_100663050 Ga0068853_1006630502 61
281 3300005543 Ga0070672_100018375 Ga0070672_1000183756 61
282 3300005543 Ga0070672_100053386 Ga0070672_1000533865 61
283 3300005543 Ga0070672_102132162 Ga0070672_1021321621 61
284 3300005544 Ga0070686_100758962 Ga0070686_1007589622 61
285 3300005546 Ga0070696_100961333 Ga0070696_1009613332 61
286 3300005547 Ga0070693_100860202 Ga0070693_1008602022 61
287 3300005547 Ga0070693_100962306 Ga0070693_1009623062 61
288 3300005548 Ga0070665_100037151 Ga0070665_1000371515 61
289 3300005548 Ga0070665_100043419 Ga0070665_1000434195 61
290 3300005563 Ga0068855_100296136 Ga0068855_1002961362 61
291 3300005563 Ga0068855_101074618 Ga0068855_1010746182 61
292 3300005563 Ga0068855_101397817 Ga0068855_1013978172 61
293 3300005563 Ga0068855_102263341 Ga0068855_1022633412 61
294 3300005564 Ga0070664_100010371 Ga0070664_1000103716 61
295 3300005564 Ga0070664_100028710 Ga0070664_1000287103 61
296 3300005564 Ga0070664_100047468 Ga0070664_1000474685 61
297 3300005564 Ga0070664_100583985 Ga0070664_1005839852 61
298 3300005577 Ga0068857_100025569 Ga0068857_1000255692 61
299 3300005577 Ga0068857_100031121 Ga0068857_1000311215 61
300 3300005577 Ga0068857_100041267 Ga0068857_1000412673 61
301 3300005577 Ga0068857_100262121 Ga0068857_1002621212 61
302 3300005578 Ga0068854_100345332 Ga0068854_1003453322 61
303 3300005578 Ga0068854_100459912 Ga0068854_1004599122 61
304 3300005578 Ga0068854_100589483 Ga0068854_1005894832 61
305 3300005614 Ga0068856_100055783 Ga0068856_1000557837 61
306 3300005614 Ga0068856_100190366 Ga0068856_1001903664 61
307 3300005614 Ga0068856_100465838 Ga0068856_1004658382 61
308 3300005614 Ga0068856_101446204 Ga0068856_1014462042 61
309 3300005616 Ga0068852_100126615 Ga0068852_1001266155 61
310 3300005616 Ga0068852_101645168 Ga0068852_1016451682 61
311 3300005616 Ga0068852_102732724 Ga0068852_1027327242 61
312 3300005617 Ga0068859_100040235 Ga0068859_1000402353 61
313 3300005617 Ga0068859_102627678 Ga0068859_1026276782 61
314 3300005618 Ga0068864_100019593 Ga0068864_1000195938 61
315 3300005618 Ga0068864_100160804 Ga0068864_1001608043 61
316 3300005618 Ga0068864_101046915 Ga0068864_1010469153 61
317 3300005718 Ga0068866_10055086 Ga0068866_100550862 61
318 3300005718 Ga0068866_11069393 Ga0068866_110693931 61
319 3300005834 Ga0068851_10066634 Ga0068851_100666342 61
320 3300005834 Ga0068851_10638934 Ga0068851_106389343 61
321 3300005841 Ga0068863_100006869 Ga0068863_1000068692 61
322 3300005841 Ga0068863_100018916 Ga0068863_1000189162 61
323 3300005842 Ga0068858_100003322 Ga0068858_1000033229 61
324 3300005842 Ga0068858_100085152 Ga0068858_1000851525 61
325 3300005842 Ga0068858_100115417 Ga0068858_1001154174 61
326 3300005843 Ga0068860_100128219 Ga0068860_1001282191 61
327 3300005843 Ga0068860_101589820 Ga0068860_1015898202 61
328 3300006237 Ga0097621_100038091 Ga0097621_1000380912 61
329 3300006237 Ga0097621_100039671 Ga0097621_1000396712 61
330 3300006358 Ga0068871_100024031 Ga0068871_1000240312 61
331 3300006358 Ga0068871_100060484 Ga0068871_1000604845 61
332 3300006358 Ga0068871_101040868 Ga0068871_1010408683 61
333 3300006871 Ga0075434_101756369 Ga0075434_1017563692 61
334 3300006881 Ga0068865_100022761 Ga0068865_1000227615 61
335 3300006881 Ga0068865_100489434 Ga0068865_1004894342 61
336 3300006931 Ga0097620_100040239 Ga0097620_1000402393 61
337 3300006931 Ga0097620_102627797 Ga0097620_1026277972 61
338 3300007076 Ga0075435_100518912 Ga0075435_1005189122 61
339 3300009093 Ga0105240_10050358 Ga0105240_100503582 61
340 3300009101 Ga0105247_10606582 Ga0105247_106065822 61
341 3300009174 Ga0105241_11195619 Ga0105241_111956192 61
342 3300009176 Ga0105242_12152965 Ga0105242_121529652 61
343 3300009176 Ga0105242_12321652 Ga0105242_123216522 61
344 3300009177 Ga0105248_10021872 Ga0105248_100218723 61
345 3300009177 Ga0105248_11309571 Ga0105248_113095712 61
346 3300009545 Ga0105237_11011656 Ga0105237_110116564 61
347 3300009545 Ga0105237_11382547 Ga0105237_113825472 61
348 3300009551 Ga0105238_10099851 Ga0105238_100998515 61
349 3300009551 Ga0105238_10534349 Ga0105238_105343493 61
350 3300010375 Ga0105239_11629598 Ga0105239_116295982 61
351 3300011119 Ga0105246_10226228 Ga0105246_102262282 61
352 3300013100 Ga0157373_10017549 Ga0157373_100175496 61
353 3300013100 Ga0157373_10243413 Ga0157373_102434133 61
354 3300013100 Ga0157373_10283535 Ga0157373_102835352 61
355 3300013100 Ga0157373_11128618 Ga0157373_111286182 61
356 3300013102 Ga0157371_10136480 Ga0157371_101364802 61
357 3300013102 Ga0157371_10921370 Ga0157371_109213702 61
358 3300013104 Ga0157370_10002914 Ga0157370_1000291428 61
359 3300013104 Ga0157370_10048327 Ga0157370_100483273 61
360 3300013104 Ga0157370_10092528 Ga0157370_100925282 61
361 3300013105 Ga0157369_11604665 Ga0157369_116046652 61
362 3300013296 Ga0157374_10007935 Ga0157374_100079356 61
363 3300013296 Ga0157374_10177953 Ga0157374_101779533 61
364 3300013296 Ga0157374_10334997 Ga0157374_103349972 61
365 3300013296 Ga0157374_11147619 Ga0157374_111476192 61
366 3300013297 Ga0157378_10129211 Ga0157378_101292114 61
367 3300013306 Ga0163162_10038822 Ga0163162_100388227 61
368 3300013307 Ga0157372_10042447 Ga0157372_100424476 61
369 3300013308 Ga0157375_10036724 Ga0157375_100367244 61
370 3300013308 Ga0157375_11425235 Ga0157375_114252353 61
371 3300014325 Ga0163163_10012045 Ga0163163_100120456 61
372 3300014325 Ga0163163_10067109 Ga0163163_100671092 61
373 3300014325 Ga0163163_10412729 Ga0163163_104127293 61
374 3300014497 Ga0182008_10895931 Ga0182008_108959312 61
375 3300014968 Ga0157379_10046223 Ga0157379_100462237 61
376 3300017792 Ga0163161_10040773 Ga0163161_100407735 61
377 3300017792 Ga0163161_10327277 Ga0163161_103272772 61
378 3300020069 Ga0197907_10872736 Ga0197907_108727362 61
379 3300025321 Ga0207656_10050388 Ga0207656_100503883 61
380 3300025903 Ga0207680_10230664 Ga0207680_102306642 61
381 3300025904 Ga0207647_10785391 Ga0207647_107853911 61
382 3300025909 Ga0207705_10005876 Ga0207705_100058769 61
383 3300025909 Ga0207705_10222002 Ga0207705_102220022 61
384 3300025909 Ga0207705_10361387 Ga0207705_103613872 61
385 3300025911 Ga0207654_11006154 Ga0207654_110061541 61
386 3300025914 Ga0207671_10105420 Ga0207671_101054202 61
387 3300025917 Ga0207660_10297703 Ga0207660_102977032 61
388 3300025918 Ga0207662_10081428 Ga0207662_100814283 61
389 3300025919 Ga0207657_10014986 Ga0207657_100149866 61
390 3300025919 Ga0207657_10249104 Ga0207657_102491043 61
391 3300025920 Ga0207649_10120125 Ga0207649_101201253 61
392 3300025920 Ga0207649_11382122 Ga0207649_113821221 61
393 3300025921 Ga0207652_10342739 Ga0207652_103427392 61
394 3300025925 Ga0207650_10031461 Ga0207650_100314615 61
395 3300025925 Ga0207650_10518358 Ga0207650_105183582 61
396 3300025925 Ga0207650_11033047 Ga0207650_110330471 61
397 3300025926 Ga0207659_10302679 Ga0207659_103026792 61
398 3300025931 Ga0207644_10002354 Ga0207644_1000235411 61
399 3300025931 Ga0207644_10063596 Ga0207644_100635963 61
400 3300025931 Ga0207644_10486768 Ga0207644_104867682 61
401 3300025932 Ga0207690_10334680 Ga0207690_103346802 61
402 3300025933 Ga0207706_10015104 Ga0207706_100151043 61
403 3300025933 Ga0207706_10232479 Ga0207706_102324792 61
404 3300025934 Ga0207686_11759848 Ga0207686_117598482 61
405 3300025937 Ga0207669_11224265 Ga0207669_112242651 61
406 3300025938 Ga0207704_10431846 Ga0207704_104318462 61
407 3300025940 Ga0207691_10000926 Ga0207691_100009262 61
408 3300025940 Ga0207691_10668138 Ga0207691_106681381 61
409 3300025940 Ga0207691_11693395 Ga0207691_116933951 61
410 3300025941 Ga0207711_10056579 Ga0207711_100565795 61
411 3300025941 Ga0207711_11353212 Ga0207711_113532122 61
412 3300025945 Ga0207679_10002019 Ga0207679_1000201912 61
413 3300025945 Ga0207679_10645152 Ga0207679_106451522 61
414 3300025945 Ga0207679_11609852 Ga0207679_116098522 61
415 3300025949 Ga0207667_10194125 Ga0207667_101941255 61
416 3300025960 Ga0207651_10017525 Ga0207651_100175256 61
417 3300025960 Ga0207651_10079387 Ga0207651_100793873 61
418 3300025960 Ga0207651_12013192 Ga0207651_120131922 61
419 3300025972 Ga0207668_10577140 Ga0207668_105771403 61
420 3300025972 Ga0207668_10718433 Ga0207668_107184333 61
421 3300025981 Ga0207640_10189444 Ga0207640_101894442 61
422 3300025986 Ga0207658_10043101 Ga0207658_100431015 61
423 3300026035 Ga0207703_10095332 Ga0207703_100953324 61
424 3300026035 Ga0207703_10520045 Ga0207703_105200454 61
425 3300026035 Ga0207703_10596817 Ga0207703_105968173 61
426 3300026067 Ga0207678_10009892 Ga0207678_1000989210 61
427 3300026078 Ga0207702_10028534 Ga0207702_100285345 61
428 3300026078 Ga0207702_10150361 Ga0207702_101503612 61
429 3300026078 Ga0207702_10451427 Ga0207702_104514274 61
430 3300026088 Ga0207641_10011841 Ga0207641_100118414 61
431 3300026088 Ga0207641_10025939 Ga0207641_100259394 61
432 3300026089 Ga0207648_10486699 Ga0207648_104866993 61
433 3300026095 Ga0207676_10024167 Ga0207676_100241673 61
434 3300026116 Ga0207674_10000859 Ga0207674_1000085937 61
435 3300026116 Ga0207674_10016891 Ga0207674_100168916 61
436 3300026116 Ga0207674_10043303 Ga0207674_100433032 61
437 3300026116 Ga0207674_10398177 Ga0207674_103981772 61
438 3300026121 Ga0207683_10001953 Ga0207683_100019536 61
439 3300026142 Ga0207698_10219771 Ga0207698_102197712 61
440 3300026142 Ga0207698_10247751 Ga0207698_102477513 61
441 3300028379 Ga0268266_10134911 Ga0268266_101349112 61
442 3300028379 Ga0268266_10500179 Ga0268266_105001792 61
443 3300028381 Ga0268264_10129213 Ga0268264_101292135 61
444 3300028381 Ga0268264_11431056 Ga0268264_114310562 61
445 3300031824 Ga0307413_10089247 Ga0307413_100892472 61
446 3300031852 Ga0307410_10000318 Ga0307410_100003186 61
447 3300031995 Ga0307409_100000544 Ga0307409_1000005446 61
448 3300032004 Ga0307414_10006069 Ga0307414_100060693 61
449 3300032005 Ga0307411_10001198 Ga0307411_1000119812 61
450 3300034817 Ga0373948_0123659 Ga0373948_0123659_170_355 61
451 3300034820 Ga0373959_0045578 Ga0373959_0045578_605_793 61
452 3300035170 Ga0373943_0001269 Ga0373943_0001269_757_945 61
453 3300035171 Ga0373946_0029622 Ga0373946_0029622_1976_2164 61
454 3300035691 Ga0373931_0128326 Ga0373931_0128326_649_837 61
455 3300035691 Ga0373931_1081713 Ga0373931_1081713_195_383 61
456 3300035692 Ga0373935_0080509 Ga0373935_0080509_578_766 61
457 3300035725 Ga0373947_0060691 Ga0373947_0060691_1190_1378 61
458 3300037068 Ga0373925_0050105 Ga0373925_0050105_1827_2015 61
459 3300037312 Ga0395899_0008800 Ga0395899_0008800_4158_4346 61
460 3300037312 Ga0395899_0070269 Ga0395899_0070269_1567_1755 61
461 3300037312 Ga0395899_0088236 Ga0395899_0088236_1126_1314 61
462 3300037312 Ga0395899_0147624 Ga0395899_0147624_817_1005 61
463 3300037312 Ga0395899_0172350 Ga0395899_0172350_996_1184 61
464 3300037312 Ga0395899_0188911 Ga0395899_0188911_973_1161 61
465 3300037312 Ga0395899_0334146 Ga0395899_0334146_786_974 61
466 3300037312 Ga0395899_0960020 Ga0395899_0960020_281_469 61
467 3300037418 Ga0395900_0002600 Ga0395900_0002600_2332_2532 61
468 3300037418 Ga0395900_0018874 Ga0395900_0018874_4277_4465 61
469 3300037418 Ga0395900_0022720 Ga0395900_0022720_3333_3521 61
470 3300037418 Ga0395900_0057890 Ga0395900_0057890_2074_2262 61
471 3300037418 Ga0395900_0140171 Ga0395900_0140171_1705_1893 61
472 3300037418 Ga0395900_0180293 Ga0395900_0180293_172_357 61
473 3300037418 Ga0395900_0222557 Ga0395900_0222557_1570_1758 61
474 3300037418 Ga0395900_0267408 Ga0395900_0267408_1029_1229 61
475 3300037418 Ga0395900_0328607 Ga0395900_0328607_454_642 61
476 3300037418 Ga0395900_0430045 Ga0395900_0430045_1042_1230 61
477 3300037418 Ga0395900_0792082 Ga0395900_0792082_228_416 61
478 3300037418 Ga0395900_0805071 Ga0395900_0805071_178_366 61
479 3300037466 Ga0395898_0014314 Ga0395898_0014314_5360_5548 61
480 3300037466 Ga0395898_0058736 Ga0395898_0058736_1171_1359 61
481 3300037466 Ga0395898_0163026 Ga0395898_0163026_1826_2014 61
482 3300037466 Ga0395898_0170538 Ga0395898_0170538_69_269 61
483 3300037466 Ga0395898_0283317 Ga0395898_0283317_1167_1355 61
484 3300037466 Ga0395898_0386140 Ga0395898_0386140_547_735 61
485 3300037466 Ga0395898_0391880 Ga0395898_0391880_14_202 61
486 3300037466 Ga0395898_0509677 Ga0395898_0509677_922_1110 61
487 3300037471 Ga0395905_0000187 Ga0395905_0000187_49918_50106 61
488 3300037471 Ga0395905_0018501 Ga0395905_0018501_6339_6524 61
489 3300037471 Ga0395905_0026436 Ga0395905_0026436_3532_3720 61
490 3300037471 Ga0395905_0150037 Ga0395905_0150037_981_1169 61
491 3300037471 Ga0395905_0193107 Ga0395905_0193107_618_818 61
492 3300037471 Ga0395905_0216772 Ga0395905_0216772_844_1032 61
493 3300037471 Ga0395905_0231058 Ga0395905_0231058_954_1142 61
494 3300037471 Ga0395905_0458135 Ga0395905_0458135_868_1056 61
495 3300037471 Ga0395905_0857242 Ga0395905_0857242_170_358 61
496 3300037471 Ga0395905_0941795 Ga0395905_0941795_338_526 61
497 3300037471 Ga0395905_0942885 Ga0395905_0942885_26_214 61
498 3300037471 Ga0395905_1298592 Ga0395905_1298592_323_511 61
499 3300038443 Ga0395901_0000041 Ga0395901_0000041_180993_181193 61
500 3300038443 Ga0395901_0087139 Ga0395901_0087139_2623_2811 61
501 3300038443 Ga0395901_0088592 Ga0395901_0088592_1861_2049 61
502 3300038443 Ga0395901_0156330 Ga0395901_0156330_860_1048 61
503 3300038443 Ga0395901_0230012 Ga0395901_0230012_1277_1465 61
504 3300038443 Ga0395901_0772083 Ga0395901_0772083_733_921 61
505 3300038443 Ga0395901_1021325 Ga0395901_1021325_334_522 61
506 3300038443 Ga0395901_1130084 Ga0395901_1130084_447_635 61
507 3300044658 Ga0466972_0154921 Ga0466972_0154921_170_358 61
508 3300044683 Ga0466965_0237127 Ga0466965_0237127_76_264 61
509 3300044693 Ga0466961_0170332 Ga0466961_0170332_280_468 61
510 3300044694 Ga0466963_0064536 Ga0466963_0064536_1977_2165 61
511 3300044694 Ga0466963_0078400 Ga0466963_0078400_1552_1740 61
512 3300044694 Ga0466963_0119912 Ga0466963_0119912_77_265 61
513 3300044694 Ga0466963_0192344 Ga0466963_0192344_832_1020 61
514 3300044694 Ga0466963_0229353 Ga0466963_0229353_649_837 61
515 3300044694 Ga0466963_0553395 Ga0466963_0553395_451_639 61
516 3300044694 Ga0466963_0605087 Ga0466963_0605087_466_654 61
517 3300044719 Ga0466971_0097586 Ga0466971_0097586_378_566 61
518 3300044719 Ga0466971_0141872 Ga0466971_0141872_156_344 61
519 3300044765 Ga0466970_0133469 Ga0466970_0133469_138_326 61
520 3300044842 Ga0466957_0001404 Ga0466957_0001404_11681_11869 61
521 3300044842 Ga0466957_0353133 Ga0466957_0353133_535_723 61
522 3300044901 Ga0466960_0021587 Ga0466960_0021587_1391_1579 61
523 3300045049 Ga0466959_0087575 Ga0466959_0087575_682_870 61
524 3300045836 Ga0466958_0000406 Ga0466958_0000406_14561_14749 61
525 3300045836 Ga0466958_0439337 Ga0466958_0439337_237_425 61
526 3300045976 Ga0466967_0003802 Ga0466967_0003802_910_1098 61
527 3300045976 Ga0466967_0036444 Ga0466967_0036444_3990_4178 61
528 3300045976 Ga0466967_0193675 Ga0466967_0193675_678_866 61
529 3300045976 Ga0466967_0314053 Ga0466967_0314053_901_1089 61
530 3300045976 Ga0466967_0534069 Ga0466967_0534069_523_711 61
531 3300045976 Ga0466967_0581043 Ga0466967_0581043_73_261 61
532 3300045976 Ga0466967_0593794 Ga0466967_0593794_363_551 61
533 3300045976 Ga0466967_0973724 Ga0466967_0973724_291_479 61
534 3300046472 Ga0495580_0260473 Ga0495580_0260473_177_365 61
535 3300046518 Ga0495631_0505007 Ga0495631_0505007_39_227 61
536 3300046525 Ga0495663_0027810 Ga0495663_0027810_1192_1380 61
537 3300046525 Ga0495663_0388229 Ga0495663_0388229_82_300 61
538 3300046539 Ga0495621_0051325 Ga0495621_0051325_1169_1357 61
539 3300046616 Ga0495668_0509791 Ga0495668_0509791_20_205 61
540 3300046684 Ga0495669_0000380 Ga0495669_0000380_5441_5629 61
541 3300046684 Ga0495669_0025416 Ga0495669_0025416_1376_1564 61
542 3300046684 Ga0495669_0084167 Ga0495669_0084167_1180_1365 61
543 3300046684 Ga0495669_0130954 Ga0495669_0130954_855_1052 61
544 3300046691 Ga0495670_0200043 Ga0495670_0200043_294_488 61
545 3300047445 Ga0495677_0003986 Ga0495677_0003986_369_557 61
546 3300048903 Ga0496100_0013054 Ga0496100_0013054_4015_4203 61
547 3300048903 Ga0496100_0347637 Ga0496100_0347637_655_843 61
548 3300048903 Ga0496100_0962226 Ga0496100_0962226_382_567 61
549 3300048904 Ga0496101_0001546 Ga0496101_0001546_7162_7350 61
550 3300048904 Ga0496101_0052814 Ga0496101_0052814_2579_2767 61
551 3300048904 Ga0496101_0098678 Ga0496101_0098678_559_747 61
552 3300048904 Ga0496101_0264462 Ga0496101_0264462_752_937 61
553 3300048905 Ga0496102_0074543 Ga0496102_0074543_2533_2718 61
554 3300048905 Ga0496102_0089404 Ga0496102_0089404_904_1092 61
555 3300048906 Ga0496103_0135119 Ga0496103_0135119_1284_1472 61
556 3300048909 Ga0496106_0025859 Ga0496106_0025859_1279_1464 61
557 3300048909 Ga0496106_0043733 Ga0496106_0043733_3015_3203 61
558 3300048909 Ga0496106_0889592 Ga0496106_0889592_106_294 61
559 3300048910 Ga0496107_0022291 Ga0496107_0022291_3623_3811 61
560 3300048910 Ga0496107_0039311 Ga0496107_0039311_2438_2623 61
561 3300048910 Ga0496107_0131362 Ga0496107_0131362_549_737 61
562 3300048911 Ga0496108_0006096 Ga0496108_0006096_5130_5318 61
563 3300048911 Ga0496108_0019846 Ga0496108_0019846_3160_3345 61
564 3300048912 Ga0496109_0013298 Ga0496109_0013298_6674_6862 61
565 3300048912 Ga0496109_1382401 Ga0496109_1382401_209_394 61
566 3300048913 Ga0496110_0011640 Ga0496110_0011640_5945_6133 61
567 3300048913 Ga0496110_0026694 Ga0496110_0026694_429_614 61
568 3300048914 Ga0496111_0013072 Ga0496111_0013072_743_931 61
569 3300048914 Ga0496111_0313840 Ga0496111_0313840_417_602 61
570 3300048915 Ga0496112_0011982 Ga0496112_0011982_3425_3613 61
571 3300048915 Ga0496112_0068445 Ga0496112_0068445_204_389 61
572 3300048915 Ga0496112_0157345 Ga0496112_0157345_1412_1600 61
573 3300048915 Ga0496112_0196715 Ga0496112_0196715_885_1070 61
574 3300048916 Ga0496113_0008110 Ga0496113_0008110_2827_3015 61
575 3300048916 Ga0496113_0198874 Ga0496113_0198874_1393_1578 61
576 3300048916 Ga0496113_0511901 Ga0496113_0511901_150_335 61
577 3300048917 Ga0496114_0000029 Ga0496114_0000029_113774_113962 61
578 3300048917 Ga0496114_0013079 Ga0496114_0013079_2392_2580 61
579 3300048917 Ga0496114_0201105 Ga0496114_0201105_1159_1347 61
580 3300048917 Ga0496114_1036043 Ga0496114_1036043_348_536 61
581 3300048918 Ga0496115_0004979 Ga0496115_0004979_4585_4773 61
582 3300050512 nmdc:mga0n895_2068108_c1 nmdc:mga0n895_2068108_c1_242_427 61
583 3300050513 nmdc:mga0rr50_865057_c1 nmdc:mga0rr50_865057_c1_167_352 61
584 3300061719 Ga0466962_0016571 Ga0466962_0016571_568_756 61

Feature Viewer

pLDDT pTM Quality
72 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map