F466289

General Info

Members Datasets Scaffolds Average Seq Length
583 483 232 393

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0005173|Ga0395905_0005173_4052_5239
Length 395
Sequence MFLPFFLELKAAKIPVTLREFLTLMEGMDAHIADYDVEAFYYLARASLIKDERFIDRFDQVFAHYFRSVQAVSGAAEIVDVAEIPTEWLMRLAEKHLSEEEKRLIESLGGFEKIMDTLKQRLAEQKGRHQGGNKWIGTGGTSPFGAYGYNPEGVRIGQSESRHHRAVKVWDERNFKNLDDSVELGTRNIKVALKRLRRWVRDGADEELDLDNTIRATAEHGWLDVQTRPERRNRVKLLMFFDIGGSMDEHLKIAEELFSAARAEFRQLEYFYFHNCLYEGIWKDNLRRKSSMIPTEEVIRTYGPDYKVIFAGDASMSPYEISMAGGSVEHWNKEPGAVWLNRITGHFRKWVWLNPVSEAYWGHTHSIGMIRSLFGGKMYPLTLGGLEAAAKELSR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2512875024 Mesorhizobium loti R88b Isolate Nodule
12 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
13 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
14 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
16 2516143018 Ensifer sp. BR816 Isolate Nodule
17 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
20 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
21 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
22 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
23 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
24 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
25 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
26 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
27 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
28 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
29 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
30 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
31 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
32 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
33 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
34 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
35 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
36 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
37 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
38 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
39 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
40 2643221557 Ensifer sp. Root558 Isolate Unclassified
41 2643221558 Rhizobium sp. Root149 Isolate Unclassified
42 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
43 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
44 2643221610 Ensifer sp. Root74 Isolate Unclassified
45 2643221618 Ensifer sp. Root231 Isolate Unclassified
46 2643221626 Ensifer sp. Root31 Isolate Unclassified
47 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
48 2643221655 Ensifer sp. Root1252 Isolate Unclassified
49 2643221659 Ensifer sp. Root127 Isolate Unclassified
50 2643221668 Ensifer sp. Root423 Isolate Unclassified
51 2643221675 Ensifer sp. Root1298 Isolate Unclassified
52 2643221680 Ensifer sp. Root1312 Isolate Unclassified
53 2643221698 Ensifer sp. Root142 Isolate Unclassified
54 2643221712 Ensifer sp. Root258 Isolate Unclassified
55 2643221723 Ensifer sp. Root278 Isolate Unclassified
56 2643221726 Ensifer sp. Root954 Isolate Unclassified
57 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
58 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
59 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
60 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
61 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
62 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
63 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
64 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
65 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
66 2738543024 Aminobacter sp. AP02 Isolate Unclassified
67 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
68 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
69 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
70 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
71 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
72 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
73 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
74 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
75 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
76 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
77 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
78 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
79 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
80 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
81 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
82 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
83 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
84 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
85 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
86 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
87 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
88 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
89 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
90 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
91 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
92 2844163670 Ensifer sp. 1H6 Isolate Unclassified
93 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
94 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
95 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
96 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
97 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
98 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
99 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
100 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
101 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
102 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
103 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
104 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
105 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
106 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
107 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
108 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
109 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
110 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
111 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
112 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
113 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
114 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
115 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
116 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
117 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
118 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
119 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
120 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
121 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
122 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
123 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
124 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
125 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
126 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
127 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
128 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
129 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
130 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
131 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
132 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
133 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
134 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
135 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
136 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
137 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
138 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
139 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
140 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
141 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
142 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
143 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
144 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
145 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
146 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
147 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
148 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
149 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
150 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
151 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
152 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
153 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
154 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
155 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
156 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
157 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
158 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
159 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
160 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
161 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
162 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
163 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
164 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
165 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
166 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
167 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
168 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
169 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
170 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
171 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
172 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
173 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
174 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
175 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
176 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
177 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
178 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
179 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
180 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
181 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
182 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
183 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
184 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
185 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
186 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
187 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
188 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
189 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
190 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
191 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
192 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
193 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
194 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
195 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
196 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
197 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
198 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
199 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
200 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
201 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
202 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
203 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
204 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
205 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
206 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
207 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
208 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
209 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
210 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
211 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
212 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
213 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
214 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
215 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
216 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
217 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
218 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
219 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
220 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
221 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
222 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
223 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
224 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
225 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
226 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
227 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
228 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
229 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
230 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
231 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
232 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
233 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
234 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
235 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
236 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
237 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
238 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
239 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
240 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
241 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
242 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
243 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
244 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
245 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
246 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
247 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
248 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
249 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
250 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
251 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
252 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
253 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
254 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
255 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
256 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
257 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
258 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
259 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
260 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
261 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
262 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
263 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
264 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
265 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
266 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
267 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
268 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
269 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
270 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
271 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
272 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
273 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
274 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
275 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
276 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
277 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
278 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
279 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
280 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
281 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
282 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
283 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
284 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
285 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
286 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
287 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
288 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
289 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
290 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
291 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
292 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
293 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
294 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
295 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
296 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
297 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
298 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
299 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
300 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
301 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
302 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
303 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
304 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
305 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
306 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
307 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
308 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
309 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
310 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
311 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
312 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
313 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
314 3004167301 Mesorhizobium loti 582 Isolate Unclassified
315 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
316 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
317 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
318 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
319 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
320 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
321 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
322 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
323 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
324 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
325 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
326 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
327 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
328 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
329 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
330 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
331 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
332 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
333 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
334 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
335 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
336 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
337 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
338 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
339 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
340 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
341 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
342 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
343 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
344 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
345 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
346 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
347 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
348 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
349 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
350 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
351 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
352 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
353 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
354 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
355 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
356 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
357 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
358 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
359 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
360 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
361 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
362 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
363 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
364 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
365 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
366 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
367 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
368 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
369 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
370 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
371 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
372 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
373 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
374 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
376 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
377 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
378 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
379 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
380 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
381 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
382 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
384 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
386 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
387 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
388 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
390 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
391 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
402 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
403 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
404 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
405 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
406 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
407 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
408 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
409 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
410 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
411 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
412 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
413 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
414 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
415 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
416 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
417 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
418 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
419 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
420 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
421 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
422 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
425 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
426 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
427 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
441 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
442 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
443 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
444 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
450 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
451 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
452 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
453 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
454 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
455 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
458 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
459 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
460 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
461 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
462 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
463 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
464 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
465 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
466 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
467 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
468 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
469 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
470 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
471 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
472 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
473 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
474 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
475 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
476 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
477 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
478 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
479 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
480 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
481 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
482 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
483 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.79
Metatranscriptomes 0
Isolates 60.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.38
Nodule 42.71
Rhizoplane 0.51
Rhizosphere 24.36
Stem 0
Stem Tuber 0
Unclassified 19.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10023545 3300001979 Bacteria 2102
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25156J39149_1000015 3300002705 Bacteria 181949
5 JGI25162J39368_1000654 3300002737 Bacteria 24456
6 JGI25162J39368_1000789 3300002737 Bacteria 21250
7 JGI25154J39366_1000026 3300002738 Bacteria 200613
8 JGI25157J39369_1000005 3300002741 Bacteria 269089
9 JGI25157J39369_1001877 3300002741 Bacteria 6437
10 JGI25159J45721_1000326 3300002987 Bacteria 22165
11 JGI25159J45721_1002163 3300002987 Bacteria 7657
12 JGI25151J46595_10033677 3300003187 Bacteria 1969
13 JGI25406J46586_10004253 3300003203 Bacteria 6687
14 JGI25165J46597_1000026 3300003214 Bacteria 332550
15 JGI25165J46597_1000633 3300003214 Bacteria 29109
16 JGI25165J46597_1000642 3300003214 Bacteria 28950
17 JGI25160J50197_1000022 3300003354 Bacteria 201071
18 JGI25160J50197_1000027 3300003354 Bacteria 182809
19 JGI25161J50226_1000024 3300003374 Bacteria 152176
20 JGI25161J50226_1001541 3300003374 Bacteria 6776
21 Ga0055542_1000838 3300003762 Bacteria 21800
22 Ga0055529_1002018 3300003763 Bacteria 4434
23 Ga0055526_1000643 3300003771 Bacteria 27115
24 Ga0055536_1000540 3300003781 Bacteria 25879
25 Ga0055530_10009611 3300003791 Bacteria 3694
26 Ga0055540_1011658 3300003792 Bacteria 2814
27 Ga0055531_10004567 3300003794 Bacteria 8370
28 Ga0055531_10013995 3300003794 Bacteria 3651
29 Ga0055543_1000025 3300004625 Bacteria 137886
30 Ga0055543_1000030 3300004625 Bacteria 130849
31 Ga0065165_1000133 3300005262 Bacteria 128540
32 Ga0065165_1000200 3300005262 Bacteria 103564
33 Ga0070667_100009682 3300005367 Bacteria 7988
34 Ga0068853_100014335 3300005539 Bacteria 6488
35 Ga0070665_100065591 3300005548 Bacteria 3642
36 Ga0068857_100074412 3300005577 Bacteria 3026
37 Ga0068856_100008817 3300005614 Bacteria 9816
38 Ga0068862_100064183 3300005844 Bacteria 3161
39 Ga0081539_10002121 3300005985 Bacteria 29391
40 Ga0075365_10000442 3300006038 Bacteria 15431
41 Ga0075365_10006071 3300006038 Bacteria 6600
42 Ga0075365_10009573 3300006038 Bacteria 5583
43 Ga0075365_10137933 3300006038 Bacteria 1692
44 Ga0075364_10073184 3300006051 Bacteria 2259
45 Ga0075367_10040065 3300006178 Bacteria 2734
46 Ga0075367_10044839 3300006178 Bacteria 2593
47 Ga0075366_10037308 3300006195 Bacteria 2869
48 Ga0075370_10008035 3300006353 Bacteria 5412
49 Ga0075370_10018368 3300006353 Bacteria 3795
50 Ga0079104_1014104 3300006946 Bacteria 2428
51 Ga0105240_10000013 3300009093 Bacteria 483458
52 Ga0105240_10095775 3300009093 Bacteria 3618
53 Ga0105240_10153740 3300009093 Bacteria 2738
54 Ga0105248_10100282 3300009177 Bacteria 3263
55 Ga0105237_10002515 3300009545 Bacteria 22704
56 Ga0105237_10085078 3300009545 Bacteria 3152
57 Ga0105238_10014332 3300009551 Bacteria 8013
58 Ga0105239_10000768 3300010375 Bacteria 45353
59 Ga0157370_10001544 3300013104 Bacteria 28489
60 Ga0157370_10207289 3300013104 Bacteria 1817
61 Ga0157369_10060514 3300013105 Bacteria 4084
62 Ga0171463_1004 3300013249 Bacteria 437207
63 Ga0183363_1216 3300015690 Bacteria 11212
64 Ga0213874_10007136 3300021377 Bacteria 2670
65 Ga0213875_10013653 3300021388 Bacteria 3980
66 Ga0209435_100009 3300025206 Bacteria 476614
67 Ga0209436_101843 3300025208 Bacteria 6875
68 Ga0209436_104511 3300025208 Bacteria 3429
69 Ga0209672_102687 3300025228 Bacteria 4139
70 Ga0209437_100182 3300025233 Bacteria 130514
71 Ga0209437_100204 3300025233 Bacteria 115781
72 Ga0207425_1011965 3300025245 Bacteria 2051
73 Ga0209646_1000018 3300025246 Bacteria 476716
74 Ga0209026_1000032 3300025250 Bacteria 322378
75 Ga0209026_1000043 3300025250 Bacteria 269142
76 Ga0209148_1000317 3300025254 Bacteria 67724
77 Ga0209148_1007586 3300025254 Bacteria 2240
78 Ga0209759_1000007 3300025256 Bacteria 476614
79 Ga0209759_1000168 3300025256 Bacteria 111106
80 Ga0209233_1000030 3300025261 Bacteria 636702
81 Ga0209233_1000130 3300025261 Bacteria 205687
82 Ga0209233_1000255 3300025261 Bacteria 82230
83 Ga0209233_1000332 3300025261 Bacteria 48225
84 Ga0209233_1015697 3300025261 Bacteria 2103
85 Ga0209455_1000152 3300025272 Bacteria 125942
86 Ga0209130_1000027 3300025284 Bacteria 327700
87 Ga0209130_1000164 3300025284 Bacteria 97595
88 Ga0209676_1000406 3300025292 Bacteria 77603
89 Ga0209676_1019437 3300025292 Bacteria 2338
90 Ga0209025_1000241 3300025294 Bacteria 128329
91 Ga0209564_1000111 3300025295 Bacteria 212210
92 Ga0209758_1003330 3300025297 Bacteria 14781
93 Ga0209758_1017148 3300025297 Bacteria 3628
94 Ga0209050_1001751 3300025298 Bacteria 21554
95 Ga0209050_1002627 3300025298 Bacteria 14778
96 Ga0209256_1000773 3300025299 Bacteria 41485
97 Ga0209256_1004304 3300025299 Bacteria 9067
98 Ga0207426_1000072 3300025302 Bacteria 327700
99 Ga0207426_1000082 3300025302 Bacteria 298939
100 Ga0209051_1001124 3300025303 Bacteria 24447
101 Ga0209257_1001584 3300025304 Bacteria 26149
102 Ga0209257_1002672 3300025304 Bacteria 17103
103 Ga0207695_10000044 3300025913 Bacteria 440819
104 Ga0207695_10176576 3300025913 Bacteria 2058
105 Ga0207671_10000043 3300025914 Bacteria 206915
106 Ga0207671_10009507 3300025914 Bacteria 8121
107 Ga0207694_10055341 3300025924 Bacteria 3080
108 Ga0207694_10060702 3300025924 Bacteria 2943
109 Ga0207711_10106061 3300025941 Bacteria 2493
110 Ga0207668_10000033 3300025972 Bacteria 121080
111 Ga0207702_10008695 3300026078 Bacteria 8564
112 Ga0268266_10001055 3300028379 Bacteria 34552
113 Ga0268266_10032264 3300028379 Bacteria 4451
114 Ga0268266_10042953 3300028379 Bacteria 3862
115 Ga0268266_10200489 3300028379 Bacteria 1826
116 Ga0268265_10041591 3300028380 Bacteria 3403
117 Ga0307515_10006431 3300028794 Bacteria 23507
118 Ga0307515_10150406 3300028794 Bacteria 2437
119 Ga0373927_0000019 3300035695 Bacteria 139754
120 Ga0316582_0135129 3300036647 Bacteria 1659
121 Ga0373925_0001010 3300037068 Bacteria 25444
122 Ga0395899_0000288 3300037312 Bacteria 64881
123 Ga0395900_0000246 3300037418 Bacteria 85104
124 Ga0395900_0061311 3300037418 Bacteria 3867
125 Ga0395898_0000447 3300037466 Bacteria 85103
126 Ga0395898_0135835 3300037466 Bacteria 2355
127 Ga0395898_0150956 3300037466 Bacteria 2223
128 Ga0395905_0000228 3300037471 Bacteria 85103
129 Ga0395905_0005173 3300037471 Bacteria 13384
130 Ga0395905_0011579 3300037471 Bacteria 8520
131 Ga0395905_0014784 3300037471 Bacteria 7442
132 Ga0395905_0019857 3300037471 Bacteria 6368
133 Ga0395905_0152306 3300037471 Bacteria 2175
134 Ga0395905_0351031 3300037471 Bacteria 1367
135 Ga0436364_0281278 3300037853 Bacteria 34090
136 Ga0395901_0000167 3300038443 Bacteria 85844
137 Ga0395901_0024967 3300038443 Bacteria 6134
138 Ga0395901_0115521 3300038443 Bacteria 2819
139 Ga0395901_0185498 3300038443 Bacteria 2182
140 Ga0395901_0288723 3300038443 Bacteria 1703
141 Ga0400483_010879 3300039062 Bacteria 4564
142 Ga0400483_039567 3300039062 Bacteria 1704
143 Ga0400483_047364 3300039062 Bacteria 2638
144 Ga0400483_206413 3300039062 Bacteria 2693
145 Ga0400483_260578 3300039062 Bacteria 4633
146 Ga0436365_0085161 3300039437 Bacteria 16288
147 Ga0436363_1114875 3300039450 Bacteria 2853
148 Ga0439449_0028667 3300042007 Bacteria 2075
149 Ga0466960_0011807 3300044901 Bacteria 3669
150 Ga0495638_0002866 3300046460 Bacteria 13806
151 Ga0495638_0064354 3300046460 Bacteria 2259
152 Ga0495606_0074017 3300046507 Bacteria 2135
153 Ga0495643_0020048 3300046522 Bacteria 3862
154 Ga0495672_0000265 3300047320 Bacteria 72657
155 Ga0496116_0009992 3300048919 Bacteria 8014
156 Ga0496117_0005812 3300048920 Bacteria 12780
157 Ga0496118_0004317 3300048921 Bacteria 16959
158 Ga0496118_0039556 3300048921 Bacteria 3761
159 Ga0496119_0005207 3300048922 Bacteria 12563
160 Ga0496119_0050027 3300048922 Bacteria 2579
161 Ga0496120_0004478 3300048923 Bacteria 11697
162 Ga0496121_0101984 3300048924 Bacteria 2212
163 Ga0496122_0014398 3300048925 Bacteria 7651
164 Ga0496123_0010798 3300048926 Bacteria 8014
165 Ga0496126_0042541 3300048929 Bacteria 4195
166 Ga0496126_0078405 3300048929 Bacteria 2927
167 Ga0496126_0285208 3300048929 Bacteria 1367
168 Ga0501031_0037510 3300049568 Bacteria 3162
169 Ga0501032_0000001 3300049569 Bacteria 422097
170 Ga0501032_0043871 3300049569 Bacteria 3027
171 Ga0501033_0000077 3300049570 Bacteria 92696
172 Ga0501033_0000318 3300049570 Bacteria 45707
173 Ga0501033_0109582 3300049570 Bacteria 2010
174 Ga0501033_0129539 3300049570 Bacteria 1828
175 Ga0501034_0000023 3300049571 Bacteria 263892
176 Ga0501034_0000291 3300049571 Bacteria 89828
177 Ga0501034_0264376 3300049571 Bacteria 1662
178 Ga0501034_0268513 3300049571 Bacteria 1648
179 Ga0501036_0000482 3300049572 Bacteria 28438
180 Ga0501037_0000136 3300049573 Bacteria 68536
181 Ga0501037_0000754 3300049573 Bacteria 24464
182 Ga0501038_0000043 3300049574 Bacteria 113010
183 Ga0501039_0000022 3300049575 Bacteria 160858
184 Ga0501043_0000006 3300049579 Bacteria 234413
185 Ga0501043_0000310 3300049579 Bacteria 44324
186 Ga0501043_0053667 3300049579 Bacteria 3165
187 Ga0501047_0121048 3300049581 Bacteria 2499
188 Ga0501047_0189821 3300049581 Bacteria 1918
189 Ga0501047_0197721 3300049581 Bacteria 1872
190 Ga0501048_0146366 3300049582 Bacteria 1671
191 Ga0501067_0132915 3300049583 Bacteria 1385
192 Ga0501068_0033698 3300049584 Bacteria 3051
193 Ga0501068_0058153 3300049584 Bacteria 2346
194 Ga0501069_0000024 3300049585 Bacteria 117140
195 Ga0501069_0025509 3300049585 Bacteria 3232
196 Ga0501070_0000093 3300049586 Bacteria 76623
197 Ga0501070_0001707 3300049586 Bacteria 19484
198 Ga0501070_0085857 3300049586 Bacteria 2605
199 Ga0501073_0017899 3300049589 Bacteria 5127
200 Ga0501080_0001346 3300049742 Bacteria 20520
201 Ga0501080_0010785 3300049742 Bacteria 8362
202 Ga0501083_0000097 3300049744 Bacteria 59474
203 Ga0501035_0000068 3300049822 Bacteria 128392
204 Ga0501035_0000997 3300049822 Bacteria 29896
205 Ga0501035_0006366 3300049822 Bacteria 11103
206 Ga0501035_0008638 3300049822 Bacteria 9482
207 Ga0501035_0015071 3300049822 Bacteria 7132
208 Ga0501035_0077120 3300049822 Bacteria 2945
209 Ga0501035_0118977 3300049822 Bacteria 2311
210 Ga0501035_0222181 3300049822 Bacteria 1612
211 Ga0501044_0000096 3300049823 Bacteria 109532
212 Ga0501044_0002553 3300049823 Bacteria 20731
213 Ga0501044_0017784 3300049823 Bacteria 7625
214 Ga0501044_0017942 3300049823 Bacteria 7589
215 Ga0501044_0020541 3300049823 Bacteria 7051
216 Ga0501044_0110215 3300049823 Bacteria 2761
217 Ga0501044_0127857 3300049823 Bacteria 2537
218 Ga0501044_0142048 3300049823 Bacteria 2389
219 nmdc:mga00v17_67852_c1 3300050491 Bacteria 2204
220 nmdc:mga0yw44_622_c1 3300050492 Bacteria 12854
221 nmdc:mga0k408_8641_c1 3300050493 Bacteria 5474
222 nmdc:mga06z11_47004_c1 3300050494 Bacteria 2190
223 nmdc:mga0sz30_19563_c1 3300050516 Bacteria 2723
224 nmdc:mga0sz30_65081_c1 3300050516 Bacteria 1563
225 Ga0500610_0004729 3300053079 Bacteria 5462
226 Ga0500644_0010287 3300053088 Bacteria 2528
227 Ga0500568_0000066 3300053139 Bacteria 104826
228 Ga0500616_0000441 3300053153 Bacteria 54819
229 Ga0500616_0003486 3300053153 Bacteria 11964
230 Ga0500616_0033423 3300053153 Bacteria 2807
231 Ga0500622_0000343 3300053156 Bacteria 45668
232 Ga0501082_0091455 3300060353 Bacteria 2627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2874155637 2874159423 344
2 iso_pu_bacteria 2977843712 2977847821 344
3 3300049583 Ga0501067_0132915 Ga0501067_0132915_267_1322 351
4 3300003794 Ga0055531_10004567 Ga0055531_100045675 355
5 iso_pu_bacteria 2965102966 2965109649 358
6 3300039062 Ga0400483_039567 Ga0400483_039567_540_1664 360
7 3300039062 Ga0400483_206413 Ga0400483_206413_56_1162 367
8 3300035695 Ga0373927_0000019 Ga0373927_0000019_78538_79722 372
9 3300037068 Ga0373925_0001010 Ga0373925_0001010_23596_24780 372
10 3300028794 Ga0307515_10150406 Ga0307515_101504062 376
11 3300028794 Ga0307515_10006431 Ga0307515_1000643112 377
12 3300048929 Ga0496126_0285208 Ga0496126_0285208_84_1268 377
13 3300046460 Ga0495638_0064354 Ga0495638_0064354_422_1609 378
14 3300053088 Ga0500644_0010287 Ga0500644_0010287_170_1357 378
15 3300053156 Ga0500622_0000343 Ga0500622_0000343_3169_4356 378
16 3300006195 Ga0075366_10037308 Ga0075366_100373083 379
17 3300039062 Ga0400483_047364 Ga0400483_047364_171_1358 379
18 3300050493 nmdc:mga0k408_8641_c1 nmdc:mga0k408_8641_c1_1242_2429 379
19 3300021388 Ga0213875_10013653 Ga0213875_100136531 382
20 3300037853 Ga0436364_0281278 Ga0436364_0281278_26257_27432 382
21 3300039437 Ga0436365_0085161 Ga0436365_0085161_13327_14502 382
22 3300049585 Ga0501069_0025509 Ga0501069_0025509_1647_2834 382
23 3300053079 Ga0500610_0004729 Ga0500610_0004729_2448_3638 383
24 iso_pu_bacteria 2738541281 2738746021 386
25 iso_pu_bacteria 2738543032 2739355251 386
26 iso_pu_bacteria 3003665799 3003669138 386
27 iso_pu_bacteria 2510461069 2510840456 388
28 iso_pu_bacteria 2738541317 2738947007 388
29 iso_pu_bacteria 2775507049 2776915566 388
30 iso_pu_bacteria 2818991272 2819244558 388
31 iso_pu_bacteria 2898795034 2898798912 388
32 iso_pu_bacteria 2913308742 2913312166 388
33 iso_pu_bacteria 3000405567 3000408368 388
34 iso_pu_bacteria 8005246636 8005249328 388
35 3300047320 Ga0495672_0000265 Ga0495672_0000265_36810_37985 389
36 iso_pu_bacteria 2510917026 2511170447 389
37 iso_pu_bacteria 2585427633 2585997813 389
38 iso_pu_bacteria 2585427634 2586002400 389
39 iso_pu_bacteria 2643221558 2643813806 389
40 iso_pu_bacteria 2837651117 2837651126 389
41 iso_pu_bacteria 2840878972 2840881105 389
42 iso_pu_bacteria 2854681122 2854682012 389
43 iso_pu_bacteria 2919171160 2919175753 389
44 iso_pu_bacteria 8018150411 8018153401 389
45 3300005367 Ga0070667_100009682 Ga0070667_1000096822 390
46 3300005844 Ga0068862_100064183 Ga0068862_1000641833 390
47 3300006946 Ga0079104_1014104 Ga0079104_10141042 390
48 3300009177 Ga0105248_10100282 Ga0105248_101002824 390
49 3300021377 Ga0213874_10007136 Ga0213874_100071362 390
50 3300025924 Ga0207694_10055341 Ga0207694_100553412 390
51 3300025941 Ga0207711_10106061 Ga0207711_101060612 390
52 3300025972 Ga0207668_10000033 Ga0207668_10000033121 390
53 3300028379 Ga0268266_10001055 Ga0268266_1000105529 390
54 3300028380 Ga0268265_10041591 Ga0268265_100415913 390
55 3300037466 Ga0395898_0135835 Ga0395898_0135835_870_2045 390
56 3300037466 Ga0395898_0150956 Ga0395898_0150956_168_1343 390
57 3300039450 Ga0436363_1114875 Ga0436363_1114875_476_1651 390
58 3300042007 Ga0439449_0028667 Ga0439449_0028667_378_1550 390
59 3300049581 Ga0501047_0189821 Ga0501047_0189821_270_1445 390
60 3300049822 Ga0501035_0118977 Ga0501035_0118977_112_1287 390
61 3300053153 Ga0500616_0003486 Ga0500616_0003486_5091_6266 390
62 iso_pu_bacteria 2510917022 2511133115 390
63 iso_pu_bacteria 2516143018 2516205588 390
64 iso_pu_bacteria 2524023209 2524458637 390
65 iso_pu_bacteria 2582581307 2585271855 390
66 iso_pu_bacteria 2582581308 2585279782 390
67 iso_pu_bacteria 2582581315 2585326678 390
68 iso_pu_bacteria 2582581316 2585333843 390
69 iso_pu_bacteria 2585427527 2585531814 390
70 iso_pu_bacteria 2585427530 2585551238 390
71 iso_pu_bacteria 2585427531 2585563782 390
72 iso_pu_bacteria 2585427608 2585897021 390
73 iso_pu_bacteria 2585427609 2585907121 390
74 iso_pu_bacteria 2585428125 2587982885 390
75 iso_pu_bacteria 2599185352 2600193397 390
76 iso_pu_bacteria 2615840626 2616306573 390
77 iso_pu_bacteria 2615840698 2616551210 390
78 iso_pu_bacteria 2617270742 2617382962 390
79 iso_pu_bacteria 2643221557 2643808095 390
80 iso_pu_bacteria 2643221610 2644068716 390
81 iso_pu_bacteria 2643221618 2644110119 390
82 iso_pu_bacteria 2643221626 2644150395 390
83 iso_pu_bacteria 2643221655 2644312999 390
84 iso_pu_bacteria 2643221659 2644336547 390
85 iso_pu_bacteria 2643221668 2644379529 390
86 iso_pu_bacteria 2643221675 2644419786 390
87 iso_pu_bacteria 2643221680 2644453143 390
88 iso_pu_bacteria 2643221698 2644546193 390
89 iso_pu_bacteria 2643221712 2644618729 390
90 iso_pu_bacteria 2643221723 2644677123 390
91 iso_pu_bacteria 2643221726 2644688829 390
92 iso_pu_bacteria 2657244999 2657682475 390
93 iso_pu_bacteria 2667528174 2671113333 390
94 iso_pu_bacteria 2690316117 2692320021 390
95 iso_pu_bacteria 2751185821 2753462495 390
96 iso_pu_bacteria 2775507266 2778179058 390
97 iso_pu_bacteria 2791355091 2792621952 390
98 iso_pu_bacteria 2791355092 2792628791 390
99 iso_pu_bacteria 2802429268 2804753634 390
100 iso_pu_bacteria 2818991448 2819611653 390
101 iso_pu_bacteria 2818991453 2819638669 390
102 iso_pu_bacteria 2838029111 2838031082 390
103 iso_pu_bacteria 2838074704 2838078215 390
104 iso_pu_bacteria 2842298080 2842300101 390
105 iso_pu_bacteria 2842357229 2842359012 390
106 iso_pu_bacteria 2842475841 2842477814 390
107 iso_pu_bacteria 2842482326 2842485109 390
108 iso_pu_bacteria 2842502639 2842504314 390
109 iso_pu_bacteria 2842509118 2842511533 390
110 iso_pu_bacteria 2844163670 2844164324 390
111 iso_pu_bacteria 2847417321 2847420755 390
112 iso_pu_bacteria 2848992105 2848995583 390
113 iso_pu_bacteria 2852387548 2852391926 390
114 iso_pu_bacteria 2855872281 2855878109 390
115 iso_pu_bacteria 2896384573 2896390245 390
116 iso_pu_bacteria 2899803654 2899808014 390
117 iso_pu_bacteria 2919408235 2919411213 390
118 iso_pu_bacteria 2920760137 2920760370 390
119 iso_pu_bacteria 2920822456 2920825902 390
120 iso_pu_bacteria 2941499720 2941501320 390
121 iso_pu_bacteria 3005416602 3005421472 390
122 iso_pu_bacteria 643692032 643827349 390
123 iso_pu_bacteria 8005314921 8005319825 390
124 iso_pu_bacteria 8005484373 8005490449 390
125 iso_pu_bacteria 8005645114 8005647093 390
126 iso_pu_bacteria 8005682033 8005687023 390
127 iso_pu_bacteria 8046767195 8046767419 390
128 iso_pu_bacteria 8057575449 8057578443 390
129 3300038443 Ga0395901_0024967 Ga0395901_0024967_3059_4240 391
130 3300048924 Ga0496121_0101984 Ga0496121_0101984_528_1706 392
131 3300049571 Ga0501034_0000291 Ga0501034_0000291_50721_51902 392
132 iso_pu_bacteria 2503198000 2503199282 392
133 iso_pu_bacteria 2508501123 2509113294 392
134 iso_pu_bacteria 2508501127 2509142129 392
135 iso_pu_bacteria 2509276018 2509369823 392
136 iso_pu_bacteria 2509276022 2509394211 392
137 iso_pu_bacteria 2510065059 2510318093 392
138 iso_pu_bacteria 2512875016 2512933331 392
139 iso_pu_bacteria 2512875024 2512961436 392
140 iso_pu_bacteria 2513237090 2513610408 392
141 iso_pu_bacteria 2513237164 2514036729 392
142 iso_pu_bacteria 2513237305 2514417134 392
143 iso_pu_bacteria 2513237351 2514586937 392
144 iso_pu_bacteria 2588253730 2588519399 392
145 iso_pu_bacteria 2597489875 2597811674 392
146 iso_pu_bacteria 2599185301 2599937197 392
147 iso_pu_bacteria 2643221550 2643771190 392
148 iso_pu_bacteria 2643221551 2643777062 392
149 iso_pu_bacteria 2643221555 2643795510 392
150 iso_pu_bacteria 2643221564 2643838003 392
151 iso_pu_bacteria 2643221595 2643988874 392
152 iso_pu_bacteria 2643221627 2644154843 392
153 iso_pu_bacteria 2687453392 2688596559 392
154 iso_pu_bacteria 2693429783 2694629939 392
155 iso_pu_bacteria 2693429784 2694635751 392
156 iso_pu_bacteria 2721755686 2723573668 392
157 iso_pu_bacteria 2738543024 2739310187 392
158 iso_pu_bacteria 2756170246 2756673960 392
159 iso_pu_bacteria 2791355123 2792747820 392
160 iso_pu_bacteria 2841734538 2841736982 392
161 iso_pu_bacteria 2844002411 2844002489 392
162 iso_pu_bacteria 2844009547 2844011796 392
163 iso_pu_bacteria 2847670302 2847674334 392
164 iso_pu_bacteria 2847686936 2847690448 392
165 iso_pu_bacteria 2856314179 2856317750 392
166 iso_pu_bacteria 2856320880 2856321370 392
167 iso_pu_bacteria 2856334872 2856341026 392
168 iso_pu_bacteria 2856342000 2856342512 392
169 iso_pu_bacteria 2856349417 2856355054 392
170 iso_pu_bacteria 2856356410 2856359327 392
171 iso_pu_bacteria 2856364286 2856366432 392
172 iso_pu_bacteria 2857349434 2857356882 392
173 iso_pu_bacteria 2869162929 2869165111 392
174 iso_pu_bacteria 2869169390 2869170000 392
175 iso_pu_bacteria 2869242130 2869246546 392
176 iso_pu_bacteria 2869249662 2869253880 392
177 iso_pu_bacteria 2869256925 2869263622 392
178 iso_pu_bacteria 2869264136 2869268683 392
179 iso_pu_bacteria 2869271264 2869276102 392
180 iso_pu_bacteria 2869278585 2869285309 392
181 iso_pu_bacteria 2869285874 2869288157 392
182 iso_pu_bacteria 2871429161 2871430043 392
183 iso_pu_bacteria 2871435913 2871438030 392
184 iso_pu_bacteria 2871451962 2871453937 392
185 iso_pu_bacteria 2871459585 2871464095 392
186 iso_pu_bacteria 2871466892 2871467433 392
187 iso_pu_bacteria 2871474448 2871479563 392
188 iso_pu_bacteria 2871481445 2871482152 392
189 iso_pu_bacteria 2871488783 2871494704 392
190 iso_pu_bacteria 2871495908 2871497732 392
191 iso_pu_bacteria 2874102143 2874102388 392
192 iso_pu_bacteria 2874109183 2874113782 392
193 iso_pu_bacteria 2874116593 2874121114 392
194 iso_pu_bacteria 2874123672 2874130306 392
195 iso_pu_bacteria 2874131515 2874137904 392
196 iso_pu_bacteria 2874139085 2874146449 392
197 iso_pu_bacteria 2874146452 2874151790 392
198 iso_pu_bacteria 2874162495 2874164677 392
199 iso_pu_bacteria 2874168670 2874176602 392
200 iso_pu_bacteria 2876363079 2876364416 392
201 iso_pu_bacteria 2876369609 2876375093 392
202 iso_pu_bacteria 2876386047 2876388463 392
203 iso_pu_bacteria 2876392853 2876396550 392
204 iso_pu_bacteria 2876399893 2876402069 392
205 iso_pu_bacteria 2876406927 2876412167 392
206 iso_pu_bacteria 2876413966 2876417841 392
207 iso_pu_bacteria 2876420981 2876422736 392
208 iso_pu_bacteria 2878035449 2878038809 392
209 iso_pu_bacteria 2878730984 2878732534 392
210 iso_pu_bacteria 2878738818 2878741496 392
211 iso_pu_bacteria 2878745973 2878749668 392
212 iso_pu_bacteria 2878753008 2878759838 392
213 iso_pu_bacteria 2878760144 2878761955 392
214 iso_pu_bacteria 2878767105 2878768921 392
215 iso_pu_bacteria 2878781027 2878783794 392
216 iso_pu_bacteria 2881147464 2881149092 392
217 iso_pu_bacteria 2881155292 2881160330 392
218 iso_pu_bacteria 2881161766 2881165932 392
219 iso_pu_bacteria 2881845957 2881846589 392
220 iso_pu_bacteria 2881853255 2881853462 392
221 iso_pu_bacteria 2881861095 2881864972 392
222 iso_pu_bacteria 2882632389 2882638396 392
223 iso_pu_bacteria 2882912400 2882915722 392
224 iso_pu_bacteria 2885305155 2885307416 392
225 iso_pu_bacteria 2885312484 2885313550 392
226 iso_pu_bacteria 2885318864 2885322378 392
227 iso_pu_bacteria 2885326080 2885333943 392
228 iso_pu_bacteria 2885334103 2885335578 392
229 iso_pu_bacteria 2885342637 2885349467 392
230 iso_pu_bacteria 2885350715 2885355186 392
231 iso_pu_bacteria 2888337043 2888337621 392
232 iso_pu_bacteria 2888343758 2888344943 392
233 iso_pu_bacteria 2889010040 2889015853 392
234 iso_pu_bacteria 2889016732 2889019096 392
235 iso_pu_bacteria 2903448605 2903455059 392
236 iso_pu_bacteria 2903492973 2903493897 392
237 iso_pu_bacteria 2903492973 2903494062 392
238 iso_pu_bacteria 2903513507 2903517472 392
239 iso_pu_bacteria 2903521522 2903523401 392
240 iso_pu_bacteria 2903528002 2903531397 392
241 iso_pu_bacteria 2903540706 2903542530 392
242 iso_pu_bacteria 2904659560 2904663326 392
243 iso_pu_bacteria 2906308376 2906310706 392
244 iso_pu_bacteria 2906321335 2906324769 392
245 iso_pu_bacteria 2906363423 2906367114 392
246 iso_pu_bacteria 2906370794 2906377555 392
247 iso_pu_bacteria 2906386501 2906391095 392
248 iso_pu_bacteria 2906393657 2906399324 392
249 iso_pu_bacteria 2906401398 2906405011 392
250 iso_pu_bacteria 2906408224 2906408564 392
251 iso_pu_bacteria 2906414383 2906417815 392
252 iso_pu_bacteria 2906427513 2906428915 392
253 iso_pu_bacteria 2922151315 2922155485 392
254 iso_pu_bacteria 2922172374 2922174910 392
255 iso_pu_bacteria 2924710171 2924714031 392
256 iso_pu_bacteria 2924718760 2924726383 392
257 iso_pu_bacteria 2924733363 2924737128 392
258 iso_pu_bacteria 2924748358 2924749974 392
259 iso_pu_bacteria 2924754689 2924758179 392
260 iso_pu_bacteria 2924762789 2924766635 392
261 iso_pu_bacteria 2924776078 2924779178 392
262 iso_pu_bacteria 2924784321 2924790480 392
263 iso_pu_bacteria 2937813078 2937817533 392
264 iso_pu_bacteria 2937822353 2937828073 392
265 iso_pu_bacteria 2937836603 2937841168 392
266 iso_pu_bacteria 2937843397 2937848497 392
267 iso_pu_bacteria 2937848649 2937849454 392
268 iso_pu_bacteria 2937861824 2937865935 392
269 iso_pu_bacteria 2937877337 2937883171 392
270 iso_pu_bacteria 2937972304 2937979217 392
271 iso_pu_bacteria 2937980651 2937985881 392
272 iso_pu_bacteria 2937994558 2937996383 392
273 iso_pu_bacteria 2938014810 2938014893 392
274 iso_pu_bacteria 2958034702 2958041014 392
275 iso_pu_bacteria 2958041894 2958057508 392
276 iso_pu_bacteria 2958064165 2958070199 392
277 iso_pu_bacteria 2958084443 2958090337 392
278 iso_pu_bacteria 2958092219 2958100268 392
279 iso_pu_bacteria 2958100919 2958101200 392
280 iso_pu_bacteria 2958108152 2958108871 392
281 iso_pu_bacteria 2958115193 2958115220 392
282 iso_pu_bacteria 2958122699 2958127975 392
283 iso_pu_bacteria 2958130278 2958132559 392
284 iso_pu_bacteria 2958137437 2958140487 392
285 iso_pu_bacteria 2958144490 2958145429 392
286 iso_pu_bacteria 2958158011 2958160280 392
287 iso_pu_bacteria 2958165035 2958166853 392
288 iso_pu_bacteria 2958172287 2958174340 392
289 iso_pu_bacteria 2958179912 2958182373 392
290 iso_pu_bacteria 2961077736 2961080218 392
291 iso_pu_bacteria 2961114664 2961118353 392
292 iso_pu_bacteria 2961127735 2961129161 392
293 iso_pu_bacteria 2961136820 2961138758 392
294 iso_pu_bacteria 2961163497 2961165323 392
295 iso_pu_bacteria 2961170736 2961177713 392
296 iso_pu_bacteria 2961183825 2961187351 392
297 iso_pu_bacteria 2963644680 2963645873 392
298 iso_pu_bacteria 2965018300 2965020145 392
299 iso_pu_bacteria 2965025482 2965030821 392
300 iso_pu_bacteria 2965032056 2965039319 392
301 iso_pu_bacteria 2965040258 2965040718 392
302 iso_pu_bacteria 2965047637 2965054566 392
303 iso_pu_bacteria 2965089291 2965096315 392
304 iso_pu_bacteria 2965110997 2965117980 392
305 iso_pu_bacteria 2965119406 2965120973 392
306 iso_pu_bacteria 2967996073 2968002200 392
307 iso_pu_bacteria 2968003550 2968009434 392
308 iso_pu_bacteria 2968016561 2968022608 392
309 iso_pu_bacteria 2968083720 2968089383 392
310 iso_pu_bacteria 2968097103 2968102048 392
311 iso_pu_bacteria 2968110612 2968114414 392
312 iso_pu_bacteria 2968117919 2968123529 392
313 iso_pu_bacteria 2968138860 2968142038 392
314 iso_pu_bacteria 2968171901 2968173724 392
315 iso_pu_bacteria 2970469710 2970475192 392
316 iso_pu_bacteria 2970489779 2970491362 392
317 iso_pu_bacteria 2970503327 2970510391 392
318 iso_pu_bacteria 2970524798 2970526670 392
319 iso_pu_bacteria 2970532167 2970539217 392
320 iso_pu_bacteria 2970540015 2970543469 392
321 iso_pu_bacteria 2970547951 2970549274 392
322 iso_pu_bacteria 2970554993 2970556810 392
323 iso_pu_bacteria 2970593180 2970599925 392
324 iso_pu_bacteria 2970619444 2970623753 392
325 iso_pu_bacteria 2970627176 2970628170 392
326 iso_pu_bacteria 2977821940 2977828360 392
327 iso_pu_bacteria 2977828996 2977831702 392
328 iso_pu_bacteria 2977851361 2977857402 392
329 iso_pu_bacteria 2977864932 2977868800 392
330 iso_pu_bacteria 2977872689 2977879269 392
331 iso_pu_bacteria 2977898635 2977904313 392
332 iso_pu_bacteria 2977907340 2977910908 392
333 iso_pu_bacteria 2977915119 2977915768 392
334 iso_pu_bacteria 2977922695 2977923732 392
335 iso_pu_bacteria 2977935797 2977937946 392
336 iso_pu_bacteria 2977942078 2977950093 392
337 iso_pu_bacteria 2977950692 2977955835 392
338 iso_pu_bacteria 2977957713 2977957901 392
339 iso_pu_bacteria 2977986579 2977989594 392
340 iso_pu_bacteria 2979710463 2979713263 392
341 iso_pu_bacteria 2979764755 2979768427 392
342 iso_pu_bacteria 2979772303 2979775489 392
343 iso_pu_bacteria 2979779861 2979782570 392
344 iso_pu_bacteria 2979793036 2979793585 392
345 iso_pu_bacteria 2979808191 2979815264 392
346 iso_pu_bacteria 2987636660 2987644163 392
347 iso_pu_bacteria 2987645492 2987651620 392
348 iso_pu_bacteria 2987652177 2987654057 392
349 iso_pu_bacteria 2987659509 2987661330 392
350 iso_pu_bacteria 2987666974 2987671021 392
351 iso_pu_bacteria 2987673487 2987678086 392
352 iso_pu_bacteria 2996348954 2996353382 392
353 iso_pu_bacteria 2996386984 2996393439 392
354 iso_pu_bacteria 3000135777 3000141659 392
355 iso_pu_bacteria 3002141150 3002141392 392
356 iso_pu_bacteria 3004167301 3004173894 392
357 iso_pu_bacteria 3004188549 3004190379 392
358 iso_pu_bacteria 3004195979 3004199028 392
359 iso_pu_bacteria 3004203850 3004208312 392
360 iso_pu_bacteria 3004211236 3004212927 392
361 iso_pu_bacteria 3004218560 3004220606 392
362 iso_pu_bacteria 3004232784 3004233259 392
363 iso_pu_bacteria 3004239961 3004245986 392
364 iso_pu_bacteria 3004248173 3004249932 392
365 iso_pu_bacteria 3004268573 3004272131 392
366 iso_pu_bacteria 3004275668 3004280064 392
367 iso_pu_bacteria 3004334049 3004336577 392
368 iso_pu_bacteria 637000159 637076411 392
369 iso_pu_bacteria 649633066 649871115 392
370 iso_pu_bacteria 8004300914 8004305779 392
371 iso_pu_bacteria 8004312739 8004318764 392
372 iso_pu_bacteria 8004361976 8004368711 392
373 iso_pu_bacteria 8004374579 8004381336 392
374 iso_pu_bacteria 8004387939 8004389944 392
375 iso_pu_bacteria 8004633249 8004639522 392
376 iso_pu_bacteria 8004640170 8004645296 392
377 iso_pu_bacteria 8004695233 8004700086 392
378 iso_pu_bacteria 8004714634 8004718341 392
379 iso_pu_bacteria 8004727605 8004727747 392
380 iso_pu_bacteria 8055617313 8055618514 392
381 3300003791 Ga0055530_10009611 Ga0055530_100096112 393
382 3300003792 Ga0055540_1011658 Ga0055540_10116583 393
383 3300006038 Ga0075365_10000442 Ga0075365_1000044211 393
384 3300025292 Ga0209676_1019437 Ga0209676_10194372 393
385 3300025297 Ga0209758_1003330 Ga0209758_10033308 393
386 3300025298 Ga0209050_1002627 Ga0209050_100262711 393
387 3300025303 Ga0209051_1001124 Ga0209051_10011245 393
388 3300025304 Ga0209257_1001584 Ga0209257_100158425 393
389 3300039062 Ga0400483_010879 Ga0400483_010879_557_1741 393
390 3300039062 Ga0400483_260578 Ga0400483_260578_1488_2672 393
391 3300049823 Ga0501044_0002553 Ga0501044_0002553_18088_19269 393
392 3300050492 nmdc:mga0yw44_622_c1 nmdc:mga0yw44_622_c1_9674_10855 393
393 3300053153 Ga0500616_0000441 Ga0500616_0000441_19479_20660 393
394 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004144 394
395 3300002705 JGI25156J39149_1000014 JGI25156J39149_100001436 394
396 3300002705 JGI25156J39149_1000015 JGI25156J39149_100001560 394
397 3300002737 JGI25162J39368_1000654 JGI25162J39368_100065420 394
398 3300002737 JGI25162J39368_1000789 JGI25162J39368_100078915 394
399 3300002738 JGI25154J39366_1000026 JGI25154J39366_100002672 394
400 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005119 394
401 3300002987 JGI25159J45721_1000326 JGI25159J45721_100032619 394
402 3300002987 JGI25159J45721_1002163 JGI25159J45721_10021638 394
403 3300003187 JGI25151J46595_10033677 JGI25151J46595_100336772 394
404 3300003214 JGI25165J46597_1000633 JGI25165J46597_100063324 394
405 3300003214 JGI25165J46597_1000642 JGI25165J46597_100064223 394
406 3300003354 JGI25160J50197_1000022 JGI25160J50197_100002223 394
407 3300003354 JGI25160J50197_1000027 JGI25160J50197_100002755 394
408 3300003374 JGI25161J50226_1000024 JGI25161J50226_1000024109 394
409 3300003374 JGI25161J50226_1001541 JGI25161J50226_10015412 394
410 3300003771 Ga0055526_1000643 Ga0055526_100064313 394
411 3300003781 Ga0055536_1000540 Ga0055536_10005407 394
412 3300003794 Ga0055531_10013995 Ga0055531_100139952 394
413 3300004625 Ga0055543_1000025 Ga0055543_100002523 394
414 3300004625 Ga0055543_1000030 Ga0055543_100003063 394
415 3300005262 Ga0065165_1000133 Ga0065165_100013311 394
416 3300005262 Ga0065165_1000200 Ga0065165_100020023 394
417 3300005548 Ga0070665_100065591 Ga0070665_1000655913 394
418 3300005614 Ga0068856_100008817 Ga0068856_1000088176 394
419 3300006353 Ga0075370_10008035 Ga0075370_100080353 394
420 3300009093 Ga0105240_10000013 Ga0105240_10000013377 394
421 3300009545 Ga0105237_10002515 Ga0105237_1000251515 394
422 3300010375 Ga0105239_10000768 Ga0105239_1000076822 394
423 3300013104 Ga0157370_10001544 Ga0157370_1000154419 394
424 3300013105 Ga0157369_10060514 Ga0157369_100605144 394
425 3300013249 Ga0171463_1004 Ga0171463_1004166 394
426 3300015690 Ga0183363_1216 Ga0183363_12162 394
427 3300025206 Ga0209435_100009 Ga0209435_100009116 394
428 3300025208 Ga0209436_101843 Ga0209436_1018432 394
429 3300025208 Ga0209436_104511 Ga0209436_1045111 394
430 3300025228 Ga0209672_102687 Ga0209672_1026872 394
431 3300025233 Ga0209437_100182 Ga0209437_1001826 394
432 3300025233 Ga0209437_100204 Ga0209437_1002046 394
433 3300025245 Ga0207425_1011965 Ga0207425_10119652 394
434 3300025246 Ga0209646_1000018 Ga0209646_1000018116 394
435 3300025250 Ga0209026_1000043 Ga0209026_1000043116 394
436 3300025256 Ga0209759_1000007 Ga0209759_1000007116 394
437 3300025261 Ga0209233_1000130 Ga0209233_1000130159 394
438 3300025261 Ga0209233_1000255 Ga0209233_100025540 394
439 3300025261 Ga0209233_1000332 Ga0209233_100033222 394
440 3300025284 Ga0209130_1000027 Ga0209130_1000027189 394
441 3300025284 Ga0209130_1000164 Ga0209130_100016436 394
442 3300025292 Ga0209676_1000406 Ga0209676_100040650 394
443 3300025294 Ga0209025_1000241 Ga0209025_100024148 394
444 3300025295 Ga0209564_1000111 Ga0209564_1000111170 394
445 3300025298 Ga0209050_1001751 Ga0209050_100175112 394
446 3300025299 Ga0209256_1000773 Ga0209256_100077330 394
447 3300025299 Ga0209256_1004304 Ga0209256_10043042 394
448 3300025302 Ga0207426_1000072 Ga0207426_1000072126 394
449 3300025302 Ga0207426_1000082 Ga0207426_100008236 394
450 3300025304 Ga0209257_1002672 Ga0209257_10026724 394
451 3300025913 Ga0207695_10000044 Ga0207695_10000044334 394
452 3300025914 Ga0207671_10000043 Ga0207671_10000043154 394
453 3300026078 Ga0207702_10008695 Ga0207702_100086954 394
454 3300028379 Ga0268266_10042953 Ga0268266_100429533 394
455 3300036647 Ga0316582_0135129 Ga0316582_0135129_316_1500 394
456 3300037471 Ga0395905_0005173 Ga0395905_0005173_4052_5239 394
457 3300037471 Ga0395905_0011579 Ga0395905_0011579_3870_5057 394
458 3300037471 Ga0395905_0019857 Ga0395905_0019857_1110_2297 394
459 3300046507 Ga0495606_0074017 Ga0495606_0074017_630_1814 394
460 3300048919 Ga0496116_0009992 Ga0496116_0009992_1417_2604 394
461 3300048920 Ga0496117_0005812 Ga0496117_0005812_6605_7792 394
462 3300048921 Ga0496118_0004317 Ga0496118_0004317_9171_10358 394
463 3300048922 Ga0496119_0005207 Ga0496119_0005207_6443_7630 394
464 3300048923 Ga0496120_0004478 Ga0496120_0004478_4972_6159 394
465 3300048925 Ga0496122_0014398 Ga0496122_0014398_6385_7572 394
466 3300048926 Ga0496123_0010798 Ga0496123_0010798_6308_7495 394
467 3300048929 Ga0496126_0042541 Ga0496126_0042541_709_1896 394
468 3300049570 Ga0501033_0109582 Ga0501033_0109582_476_1663 395
469 3300049823 Ga0501044_0127857 Ga0501044_0127857_1003_2190 395
470 3300001979 JGI24740J21852_10023545 JGI24740J21852_100235453 396
471 3300002741 JGI25157J39369_1001877 JGI25157J39369_10018776 396
472 3300003203 JGI25406J46586_10004253 JGI25406J46586_100042536 396
473 3300003214 JGI25165J46597_1000026 JGI25165J46597_1000026186 396
474 3300003762 Ga0055542_1000838 Ga0055542_100083815 396
475 3300003763 Ga0055529_1002018 Ga0055529_10020183 396
476 3300005539 Ga0068853_100014335 Ga0068853_1000143353 396
477 3300005577 Ga0068857_100074412 Ga0068857_1000744122 396
478 3300005985 Ga0081539_10002121 Ga0081539_1000212120 396
479 3300006038 Ga0075365_10006071 Ga0075365_100060716 396
480 3300006038 Ga0075365_10009573 Ga0075365_100095735 396
481 3300006038 Ga0075365_10137933 Ga0075365_101379332 396
482 3300006051 Ga0075364_10073184 Ga0075364_100731842 396
483 3300006178 Ga0075367_10040065 Ga0075367_100400653 396
484 3300006178 Ga0075367_10044839 Ga0075367_100448393 396
485 3300006353 Ga0075370_10018368 Ga0075370_100183681 396
486 3300009093 Ga0105240_10095775 Ga0105240_100957753 396
487 3300009093 Ga0105240_10153740 Ga0105240_101537403 396
488 3300009545 Ga0105237_10085078 Ga0105237_100850783 396
489 3300009551 Ga0105238_10014332 Ga0105238_1001433210 396
490 3300013104 Ga0157370_10207289 Ga0157370_102072892 396
491 3300025250 Ga0209026_1000032 Ga0209026_1000032312 396
492 3300025254 Ga0209148_1000317 Ga0209148_100031715 396
493 3300025254 Ga0209148_1007586 Ga0209148_10075861 396
494 3300025256 Ga0209759_1000168 Ga0209759_100016865 396
495 3300025261 Ga0209233_1000030 Ga0209233_1000030210 396
496 3300025261 Ga0209233_1015697 Ga0209233_10156973 396
497 3300025272 Ga0209455_1000152 Ga0209455_100015222 396
498 3300025297 Ga0209758_1017148 Ga0209758_10171482 396
499 3300025913 Ga0207695_10176576 Ga0207695_101765762 396
500 3300025914 Ga0207671_10009507 Ga0207671_1000950710 396
501 3300025924 Ga0207694_10060702 Ga0207694_100607023 396
502 3300028379 Ga0268266_10032264 Ga0268266_100322642 396
503 3300028379 Ga0268266_10200489 Ga0268266_102004891 396
504 3300037312 Ga0395899_0000288 Ga0395899_0000288_17591_18784 396
505 3300037418 Ga0395900_0000246 Ga0395900_0000246_17590_18783 396
506 3300037418 Ga0395900_0061311 Ga0395900_0061311_730_1920 396
507 3300037466 Ga0395898_0000447 Ga0395898_0000447_17589_18782 396
508 3300037471 Ga0395905_0000228 Ga0395905_0000228_66322_67515 396
509 3300037471 Ga0395905_0014784 Ga0395905_0014784_1813_3003 396
510 3300037471 Ga0395905_0152306 Ga0395905_0152306_96_1286 396
511 3300037471 Ga0395905_0351031 Ga0395905_0351031_17_1207 396
512 3300038443 Ga0395901_0000167 Ga0395901_0000167_67062_68255 396
513 3300038443 Ga0395901_0115521 Ga0395901_0115521_743_1933 396
514 3300038443 Ga0395901_0185498 Ga0395901_0185498_627_1817 396
515 3300038443 Ga0395901_0288723 Ga0395901_0288723_299_1489 396
516 3300044901 Ga0466960_0011807 Ga0466960_0011807_917_2107 396
517 3300046460 Ga0495638_0002866 Ga0495638_0002866_10986_12176 396
518 3300046522 Ga0495643_0020048 Ga0495643_0020048_1353_2543 396
519 3300048921 Ga0496118_0039556 Ga0496118_0039556_2554_3744 396
520 3300048922 Ga0496119_0050027 Ga0496119_0050027_653_1843 396
521 3300048929 Ga0496126_0078405 Ga0496126_0078405_675_1865 396
522 3300049568 Ga0501031_0037510 Ga0501031_0037510_768_1958 396
523 3300049569 Ga0501032_0000001 Ga0501032_0000001_52786_53976 396
524 3300049569 Ga0501032_0043871 Ga0501032_0043871_700_1890 396
525 3300049570 Ga0501033_0000077 Ga0501033_0000077_26038_27228 396
526 3300049570 Ga0501033_0000318 Ga0501033_0000318_35916_37106 396
527 3300049570 Ga0501033_0129539 Ga0501033_0129539_73_1263 396
528 3300049571 Ga0501034_0000023 Ga0501034_0000023_93114_94304 396
529 3300049571 Ga0501034_0264376 Ga0501034_0264376_125_1315 396
530 3300049571 Ga0501034_0268513 Ga0501034_0268513_353_1543 396
531 3300049572 Ga0501036_0000482 Ga0501036_0000482_455_1645 396
532 3300049573 Ga0501037_0000136 Ga0501037_0000136_33349_34539 396
533 3300049573 Ga0501037_0000754 Ga0501037_0000754_586_1776 396
534 3300049574 Ga0501038_0000043 Ga0501038_0000043_48539_49729 396
535 3300049575 Ga0501039_0000022 Ga0501039_0000022_124585_125775 396
536 3300049579 Ga0501043_0000006 Ga0501043_0000006_85869_87059 396
537 3300049579 Ga0501043_0000310 Ga0501043_0000310_38939_40129 396
538 3300049579 Ga0501043_0053667 Ga0501043_0053667_1124_2314 396
539 3300049581 Ga0501047_0121048 Ga0501047_0121048_420_1610 396
540 3300049581 Ga0501047_0197721 Ga0501047_0197721_150_1340 396
541 3300049582 Ga0501048_0146366 Ga0501048_0146366_222_1412 396
542 3300049584 Ga0501068_0033698 Ga0501068_0033698_570_1760 396
543 3300049584 Ga0501068_0058153 Ga0501068_0058153_69_1259 396
544 3300049585 Ga0501069_0000024 Ga0501069_0000024_32427_33617 396
545 3300049586 Ga0501070_0000093 Ga0501070_0000093_13227_14417 396
546 3300049586 Ga0501070_0001707 Ga0501070_0001707_7548_8738 396
547 3300049586 Ga0501070_0085857 Ga0501070_0085857_989_2179 396
548 3300049589 Ga0501073_0017899 Ga0501073_0017899_2365_3555 396
549 3300049742 Ga0501080_0001346 Ga0501080_0001346_10708_11898 396
550 3300049742 Ga0501080_0010785 Ga0501080_0010785_709_1899 396
551 3300049744 Ga0501083_0000097 Ga0501083_0000097_34917_36107 396
552 3300049822 Ga0501035_0000068 Ga0501035_0000068_65124_66314 396
553 3300049822 Ga0501035_0000997 Ga0501035_0000997_999_2189 396
554 3300049822 Ga0501035_0006366 Ga0501035_0006366_198_1388 396
555 3300049822 Ga0501035_0008638 Ga0501035_0008638_5273_6463 396
556 3300049822 Ga0501035_0015071 Ga0501035_0015071_5708_6898 396
557 3300049822 Ga0501035_0077120 Ga0501035_0077120_528_1790 396
558 3300049822 Ga0501035_0222181 Ga0501035_0222181_292_1482 396
559 3300049823 Ga0501044_0000096 Ga0501044_0000096_75916_77106 396
560 3300049823 Ga0501044_0017784 Ga0501044_0017784_991_2181 396
561 3300049823 Ga0501044_0017942 Ga0501044_0017942_5066_6256 396
562 3300049823 Ga0501044_0020541 Ga0501044_0020541_514_1704 396
563 3300049823 Ga0501044_0110215 Ga0501044_0110215_1423_2613 396
564 3300049823 Ga0501044_0142048 Ga0501044_0142048_59_1249 396
565 3300050491 nmdc:mga00v17_67852_c1 nmdc:mga00v17_67852_c1_189_1379 396
566 3300050494 nmdc:mga06z11_47004_c1 nmdc:mga06z11_47004_c1_472_1662 396
567 3300050516 nmdc:mga0sz30_19563_c1 nmdc:mga0sz30_19563_c1_1020_2210 396
568 3300050516 nmdc:mga0sz30_65081_c1 nmdc:mga0sz30_65081_c1_73_1263 396
569 3300053139 Ga0500568_0000066 Ga0500568_0000066_38863_40053 396
570 3300053153 Ga0500616_0033423 Ga0500616_0033423_1419_2609 396
571 3300060353 Ga0501082_0091455 Ga0501082_0091455_408_1598 396
572 iso_pu_bacteria 2906328253 2906333567 396
573 iso_pu_bacteria 2922158528 2922159604 396
574 iso_pu_bacteria 2924726620 2924732295 396
575 iso_pu_bacteria 2937891427 2937893062 396
576 iso_pu_bacteria 2965062239 2965064491 396
577 iso_pu_bacteria 2968091066 2968091717 396
578 iso_pu_bacteria 2968128360 2968133313 396
579 iso_pu_bacteria 2977858184 2977861120 396
580 iso_pu_bacteria 2996310559 2996315522 396
581 iso_pu_bacteria 2996341866 2996341911 396
582 iso_pu_bacteria 8002285264 8002290443 396
583 iso_pu_bacteria 8004445564 8004450981 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05762

VWA_CoxE

VWA domain containing CoxE-like protein

183

279

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wrr-assembly1.cif.gz_B a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.5515 235 314
3lyh-assembly1.cif.gz_A crystal structure of putative cobalamin (vitamin b12) biosynthesis cbix protein (yp_958415.1) from marinobacter aquaeolei vt8 at 1.60 a resolution 0.5446 235 309
4rad-assembly1.cif.gz_A aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents 0.5415 184 353
5brn-assembly1.cif.gz_B human hgprt in complex with (s)-hpephx, an acyclic nucleoside phosphonate 0.5396 185 353
4rad-assembly2.cif.gz_G aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents 0.531 185 353
ID Description Score Start End Superfamily
af_A0A0G2K7L7_66_197_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6947 234 272 3.40.50.410
af_P20702_20_252_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6392 222 274 3.40.50.410
af_Q54DB3_435_724_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.613 234 280 3.40.50.410
af_K7URV3_217_339_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.6019 234 269 3.40.190.80
2p11B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5435 308 379 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A530NHH5-F1-model_v4 deleted 0.9908 299 396
AF-A0A659YHS6-F1-model_v4 deleted 0.9841 1 66
AF-A0A5C7YLX1-F1-model_v4 VWA domain-containing protein 0.9836 304 394
AF-A0A520EI00-F1-model_v4 deleted 0.9834 295 396
AF-A0A352V4F5-F1-model_v4 VWA domain-containing protein 0.9804 293 392

Feature Viewer

pLDDT pTM Quality
66.76 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map