F466148

General Info

Members Datasets Scaffolds Average Seq Length
582 265 1164 88

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100000297|Ga0070696_10000029732
Length 94
Sequence MPTRTVTIGGKTWRVFPSGRVTQYDRDEFAVLFVADAGKGGKGESQREVRVTRYSPLGARSREQSLAEMTDTDLAALFQTSQPGDTSPEADYTS

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
247 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 18.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100000297 3300005546 Bacteria 29960
2 JGI25406J46586_10011762 3300003203 Bacteria 3821
3 Ga0058863_11318712 3300004799 Unclassified 958
4 Ga0070658_11224722 3300005327 Unclassified 652
5 Ga0070676_10131194 3300005328 Bacteria 1585
6 Ga0070683_100006430 3300005329 Bacteria 9857
7 Ga0070683_100009220 3300005329 Bacteria 8431
8 Ga0070683_100114184 3300005329 Bacteria 2549
9 Ga0070683_101456689 3300005329 Bacteria 658
10 Ga0070683_101985292 3300005329 Unclassified 559
11 Ga0070670_100006704 3300005331 Bacteria 9758
12 Ga0070670_100481481 3300005331 Unclassified 1102
13 Ga0068869_100025469 3300005334 Bacteria 4108
14 Ga0070666_10103323 3300005335 Bacteria 1966
15 Ga0070680_100000205 3300005336 Bacteria 38716
16 Ga0070680_100008185 3300005336 Bacteria 7991
17 Ga0070680_100014532 3300005336 Bacteria 6160
18 Ga0070680_100020836 3300005336 Bacteria 5204
19 Ga0070680_100342091 3300005336 Bacteria 1271
20 Ga0070680_100558073 3300005336 Bacteria 982
21 Ga0070682_100004677 3300005337 Bacteria 7605
22 Ga0070682_100693407 3300005337 Unclassified 816
23 Ga0068868_100021328 3300005338 Bacteria 4879
24 Ga0070660_100024848 3300005339 Bacteria 4450
25 Ga0070660_100801451 3300005339 Bacteria 792
26 Ga0070689_100356289 3300005340 Unclassified 1228
27 Ga0070691_10132541 3300005341 Bacteria 1264
28 Ga0070691_10227738 3300005341 Bacteria 991
29 Ga0070687_100372436 3300005343 Bacteria 928
30 Ga0070687_100503142 3300005343 Unclassified 816
31 Ga0070661_100001869 3300005344 Bacteria 14563
32 Ga0070661_100065970 3300005344 Bacteria 2659
33 Ga0070661_101581455 3300005344 Unclassified 554
34 Ga0070669_100323557 3300005353 Bacteria 1246
35 Ga0070675_100045083 3300005354 Bacteria 3608
36 Ga0070675_100317786 3300005354 Bacteria 1375
37 Ga0070671_100585760 3300005355 Bacteria 963
38 Ga0070673_100029908 3300005364 Bacteria 4067
39 Ga0070688_100081970 3300005365 Bacteria 2090
40 Ga0070659_100001294 3300005366 Bacteria 18141
41 Ga0070659_101217809 3300005366 Bacteria 666
42 Ga0070667_101325004 3300005367 Bacteria 675
43 Ga0070703_10030011 3300005406 Bacteria 1635
44 Ga0070709_10009933 3300005434 Bacteria 5261
45 Ga0070709_10569400 3300005434 Bacteria 869
46 Ga0070714_100003766 3300005435 Bacteria 11381
47 Ga0070714_100176741 3300005435 Unclassified 1940
48 Ga0070713_100053520 3300005436 Bacteria 3345
49 Ga0070713_100077329 3300005436 Bacteria 2829
50 Ga0070713_100722919 3300005436 Archaea 951
51 Ga0070710_10127459 3300005437 Bacteria 1548
52 Ga0070701_10239417 3300005438 Bacteria 1091
53 Ga0070701_10502563 3300005438 Bacteria 787
54 Ga0070711_100028286 3300005439 Bacteria 3688
55 Ga0070705_101501314 3300005440 Bacteria 564
56 Ga0070700_100667688 3300005441 Unclassified 822
57 Ga0070708_100000058 3300005445 Bacteria 72705
58 Ga0070708_100461018 3300005445 Unclassified 1199
59 Ga0070708_100622649 3300005445 Unclassified 1017
60 Ga0070663_100213119 3300005455 Bacteria 1513
61 Ga0070662_100037037 3300005457 Bacteria 3456
62 Ga0070681_10004453 3300005458 Bacteria 13341
63 Ga0070681_10005356 3300005458 Bacteria 12383
64 Ga0070681_10005653 3300005458 Bacteria 12086
65 Ga0070681_10174629 3300005458 Bacteria 2070
66 Ga0070681_10695482 3300005458 Unclassified 932
67 Ga0070706_100105543 3300005467 Bacteria 2621
68 Ga0070706_100172874 3300005467 Bacteria 2017
69 Ga0070706_100874075 3300005467 Unclassified 831
70 Ga0070707_100540779 3300005468 Bacteria 1127
71 Ga0070698_100063280 3300005471 Bacteria 3731
72 Ga0070698_100152826 3300005471 Bacteria 2255
73 Ga0070679_100003101 3300005530 Bacteria 15187
74 Ga0070679_100010061 3300005530 Bacteria 8959
75 Ga0070679_100153886 3300005530 Bacteria 2275
76 Ga0070679_100232894 3300005530 Bacteria 1801
77 Ga0070679_100875130 3300005530 Bacteria 842
78 Ga0070684_100005633 3300005535 Bacteria 9625
79 Ga0070684_100028926 3300005535 Bacteria 4691
80 Ga0070684_100083365 3300005535 Bacteria 2833
81 Ga0070684_100160559 3300005535 Unclassified 2039
82 Ga0070684_100495740 3300005535 Unclassified 1131
83 Ga0070684_101597082 3300005535 Bacteria 615
84 Ga0068853_100112434 3300005539 Bacteria 2420
85 Ga0068853_100418483 3300005539 Bacteria 1256
86 Ga0068853_101100172 3300005539 Unclassified 766
87 Ga0068853_101233506 3300005539 Bacteria 722
88 Ga0070672_100284115 3300005543 Bacteria 1400
89 Ga0070672_100704732 3300005543 Bacteria 884
90 Ga0070686_100126541 3300005544 Bacteria 1761
91 Ga0070686_100205303 3300005544 Bacteria 1415
92 Ga0070686_100702920 3300005544 Unclassified 806
93 Ga0070695_100017296 3300005545 Bacteria 4371
94 Ga0070695_101700512 3300005545 Unclassified 528
95 Ga0070693_100019863 3300005547 Bacteria 3532
96 Ga0070693_100027663 3300005547 Unclassified 3076
97 Ga0068855_100004833 3300005563 Bacteria 16449
98 Ga0068855_100040039 3300005563 Bacteria 5563
99 Ga0068855_100584964 3300005563 Unclassified 1205
100 Ga0070664_100003596 3300005564 Bacteria 12500
101 Ga0070664_100778201 3300005564 Unclassified 894
102 Ga0068857_100003020 3300005577 Bacteria 13899
103 Ga0068857_100218801 3300005577 Bacteria 1739
104 Ga0068854_100018926 3300005578 Bacteria 4630
105 Ga0068854_100532023 3300005578 Bacteria 994
106 Ga0068854_100906341 3300005578 Bacteria 775
107 Ga0068856_100024253 3300005614 Bacteria 5902
108 Ga0068856_100138082 3300005614 Unclassified 2444
109 Ga0068856_100327401 3300005614 Bacteria 1550
110 Ga0068856_100479240 3300005614 Bacteria 1265
111 Ga0068856_100535635 3300005614 Unclassified 1192
112 Ga0068856_101397141 3300005614 Unclassified 715
113 Ga0070702_100000340 3300005615 Bacteria 16257
114 Ga0068852_100024868 3300005616 Bacteria 4845
115 Ga0068852_100049486 3300005616 Bacteria 3596
116 Ga0068852_101294857 3300005616 Unclassified 750
117 Ga0068859_100002158 3300005617 Bacteria 19987
118 Ga0068864_100005274 3300005618 Bacteria 10590
119 Ga0068864_100186915 3300005618 Bacteria 1897
120 Ga0068870_10058668 3300005840 Bacteria 2061
121 Ga0068863_100028849 3300005841 Bacteria 5299
122 Ga0068863_101283958 3300005841 Bacteria 739
123 Ga0068863_102543895 3300005841 Unclassified 521
124 Ga0068858_100290897 3300005842 Bacteria 1557
125 Ga0068858_100696817 3300005842 Bacteria 988
126 Ga0068860_100031912 3300005843 Bacteria 5064
127 Ga0081455_10088128 3300005937 Bacteria 2523
128 Ga0081539_10000104 3300005985 Bacteria 197478
129 Ga0070712_100200875 3300006175 Bacteria 1566
130 Ga0070712_100437987 3300006175 Bacteria 1086
131 Ga0097621_100093499 3300006237 Bacteria 2520
132 Ga0097621_100558878 3300006237 Bacteria 1042
133 Ga0097621_101553125 3300006237 Bacteria 629
134 Ga0068871_100052307 3300006358 Bacteria 3307
135 Ga0075431_100010809 3300006847 Bacteria 9181
136 Ga0075431_101083399 3300006847 Bacteria 766
137 Ga0075434_100588749 3300006871 Bacteria 1132
138 Ga0075434_101868423 3300006871 Unclassified 607
139 Ga0075429_100414121 3300006880 Bacteria 1180
140 Ga0075436_100010293 3300006914 Bacteria 6404
141 Ga0075436_100033388 3300006914 Bacteria 3547
142 Ga0075436_100588271 3300006914 Bacteria 819
143 Ga0097620_100002158 3300006931 Bacteria 19987
144 Ga0075435_100309266 3300007076 Unclassified 1352
145 Ga0075435_100756619 3300007076 Bacteria 845
146 Ga0105240_10124679 3300009093 Unclassified 3097
147 Ga0105240_10303165 3300009093 Bacteria 1827
148 Ga0105240_10379557 3300009093 Unclassified 1596
149 Ga0105240_10740509 3300009093 Bacteria 1069
150 Ga0105240_11711249 3300009093 Unclassified 656
151 Ga0111539_12169214 3300009094 Unclassified 644
152 Ga0105245_10003912 3300009098 Bacteria 13240
153 Ga0105245_10046234 3300009098 Bacteria 3890
154 Ga0114129_10094538 3300009147 Bacteria 4140
155 Ga0114129_10790253 3300009147 Bacteria 1212
156 Ga0114129_11500531 3300009147 Bacteria 828
157 Ga0105243_10086419 3300009148 Bacteria 2572
158 Ga0105241_10031783 3300009174 Bacteria 3953
159 Ga0105241_10038596 3300009174 Bacteria 3600
160 Ga0105241_10207085 3300009174 Bacteria 1642
161 Ga0105241_10524269 3300009174 Unclassified 1060
162 Ga0105241_10556011 3300009174 Bacteria 1031
163 Ga0105242_10005905 3300009176 Bacteria 9441
164 Ga0105248_10010873 3300009177 Bacteria 10048
165 Ga0105248_10114366 3300009177 Bacteria 3044
166 Ga0105237_10087741 3300009545 Bacteria 3100
167 Ga0105237_10201677 3300009545 Bacteria 1989
168 Ga0105237_10265777 3300009545 Unclassified 1718
169 Ga0105237_10401457 3300009545 Bacteria 1375
170 Ga0105238_10023014 3300009551 Bacteria 6353
171 Ga0105238_10050173 3300009551 Bacteria 4201
172 Ga0105238_10194357 3300009551 Bacteria 2005
173 Ga0105249_10105268 3300009553 Bacteria 2660
174 Ga0105239_10020205 3300010375 Bacteria 7347
175 Ga0105246_10007048 3300011119 Bacteria 6881
176 Ga0105246_11099894 3300011119 Unclassified 726
177 Ga0157373_10033044 3300013100 Bacteria 3724
178 Ga0157373_10210528 3300013100 Bacteria 1371
179 Ga0157373_11194272 3300013100 Bacteria 573
180 Ga0157371_10221408 3300013102 Bacteria 1359
181 Ga0157371_10730163 3300013102 Bacteria 743
182 Ga0157370_10029924 3300013104 Bacteria 5338
183 Ga0157370_10075257 3300013104 Bacteria 3184
184 Ga0157370_10097267 3300013104 Bacteria 2761
185 Ga0157370_10143067 3300013104 Bacteria 2228
186 Ga0157370_10446277 3300013104 Bacteria 1189
187 Ga0157370_10871713 3300013104 Unclassified 818
188 Ga0157369_10018679 3300013105 Bacteria 7773
189 Ga0157369_10082373 3300013105 Bacteria 3442
190 Ga0157369_10714081 3300013105 Bacteria 1032
191 Ga0157369_11150259 3300013105 Bacteria 793
192 Ga0157369_11817267 3300013105 Bacteria 619
193 Ga0157374_10113088 3300013296 Bacteria 2613
194 Ga0163162_10397838 3300013306 Bacteria 1510
195 Ga0163162_11550531 3300013306 Bacteria 755
196 Ga0157372_10015410 3300013307 Bacteria 8193
197 Ga0157372_10023987 3300013307 Bacteria 6618
198 Ga0157372_10053048 3300013307 Bacteria 4518
199 Ga0157372_10060732 3300013307 Bacteria 4230
200 Ga0157372_10062052 3300013307 Bacteria 4186
201 Ga0157372_10089718 3300013307 Bacteria 3493
202 Ga0157372_10190789 3300013307 Unclassified 2374
203 Ga0157372_10391530 3300013307 Bacteria 1619
204 Ga0157372_10439510 3300013307 Bacteria 1521
205 Ga0157375_10010796 3300013308 Bacteria 8046
206 Ga0157375_10107474 3300013308 Bacteria 2884
207 Ga0157375_10630124 3300013308 Bacteria 1230
208 Ga0157375_11584105 3300013308 Bacteria 774
209 Ga0163163_10029323 3300014325 Bacteria 5293
210 Ga0163163_10394263 3300014325 Bacteria 1442
211 Ga0157377_10001895 3300014745 Bacteria 9165
212 Ga0157379_11708655 3300014968 Unclassified 617
213 Ga0157376_10007107 3300014969 Bacteria 7949
214 Ga0157376_10188349 3300014969 Bacteria 1890
215 Ga0182007_10091075 3300015262 Bacteria 1004
216 Ga0182005_1042766 3300015265 Bacteria 1232
217 Ga0206356_10095531 3300020070 Unclassified 1461
218 Ga0206356_11276463 3300020070 Bacteria 1104
219 Ga0206356_11666155 3300020070 Bacteria 628
220 Ga0206352_11250380 3300020078 Bacteria 637
221 Ga0206353_10033506 3300020082 Bacteria 983
222 Ga0207697_10186601 3300025315 Unclassified 910
223 Ga0207692_10076951 3300025898 Bacteria 1774
224 Ga0207688_10796081 3300025901 Unclassified 599
225 Ga0207680_10227247 3300025903 Bacteria 1281
226 Ga0207699_10009189 3300025906 Bacteria 4910
227 Ga0207699_10112415 3300025906 Unclassified 1748
228 Ga0207699_10266038 3300025906 Unclassified 1187
229 Ga0207645_10359173 3300025907 Unclassified 976
230 Ga0207643_10027832 3300025908 Bacteria 3136
231 Ga0207684_10066893 3300025910 Bacteria 3052
232 Ga0207684_10531785 3300025910 Bacteria 1006
233 Ga0207654_10203516 3300025911 Bacteria 1305
234 Ga0207654_10906296 3300025911 Unclassified 639
235 Ga0207654_11166589 3300025911 Bacteria 561
236 Ga0207707_10005392 3300025912 Bacteria 11181
237 Ga0207707_10015754 3300025912 Bacteria 6590
238 Ga0207707_10092411 3300025912 Bacteria 2644
239 Ga0207707_10136538 3300025912 Bacteria 2144
240 Ga0207707_11510689 3300025912 Unclassified 532
241 Ga0207695_10004023 3300025913 Bacteria 20236
242 Ga0207695_10029655 3300025913 Bacteria 6039
243 Ga0207695_10048031 3300025913 Bacteria 4511
244 Ga0207695_10054010 3300025913 Bacteria 4199
245 Ga0207695_10463843 3300025913 Unclassified 1150
246 Ga0207695_10860600 3300025913 Bacteria 786
247 Ga0207671_10079862 3300025914 Bacteria 2451
248 Ga0207671_10858105 3300025914 Unclassified 719
249 Ga0207671_11179518 3300025914 Bacteria 600
250 Ga0207693_10136291 3300025915 Bacteria 1930
251 Ga0207693_10540436 3300025915 Unclassified 909
252 Ga0207663_10109054 3300025916 Bacteria 1875
253 Ga0207660_10003275 3300025917 Bacteria 10588
254 Ga0207660_10279605 3300025917 Unclassified 1324
255 Ga0207660_10327043 3300025917 Unclassified 1225
256 Ga0207660_10897058 3300025917 Unclassified 723
257 Ga0207662_10509367 3300025918 Bacteria 830
258 Ga0207662_11256524 3300025918 Unclassified 526
259 Ga0207649_10002885 3300025920 Bacteria 9461
260 Ga0207649_10019889 3300025920 Bacteria 3844
261 Ga0207649_11366940 3300025920 Bacteria 560
262 Ga0207652_10063563 3300025921 Bacteria 3192
263 Ga0207652_10182897 3300025921 Bacteria 1884
264 Ga0207652_10200229 3300025921 Unclassified 1797
265 Ga0207652_10294615 3300025921 Bacteria 1464
266 Ga0207652_11892532 3300025921 Unclassified 502
267 Ga0207646_10422065 3300025922 Bacteria 1204
268 Ga0207646_11333901 3300025922 Unclassified 626
269 Ga0207681_10433600 3300025923 Bacteria 1067
270 Ga0207681_10519508 3300025923 Bacteria 977
271 Ga0207694_10012671 3300025924 Bacteria 6353
272 Ga0207694_10207659 3300025924 Bacteria 1595
273 Ga0207694_10533391 3300025924 Bacteria 984
274 Ga0207694_10815426 3300025924 Bacteria 788
275 Ga0207650_10003720 3300025925 Bacteria 10433
276 Ga0207650_10443284 3300025925 Unclassified 1080
277 Ga0207659_10386130 3300025926 Bacteria 1168
278 Ga0207687_10045876 3300025927 Bacteria 3023
279 Ga0207700_10218991 3300025928 Bacteria 1613
280 Ga0207700_10561427 3300025928 Bacteria 1014
281 Ga0207664_10155610 3300025929 Unclassified 1946
282 Ga0207664_10583920 3300025929 Unclassified 1003
283 Ga0207644_10985135 3300025931 Bacteria 707
284 Ga0207690_10013625 3300025932 Bacteria 4889
285 Ga0207690_10547437 3300025932 Unclassified 940
286 Ga0207706_10013924 3300025933 Bacteria 7293
287 Ga0207706_10607332 3300025933 Unclassified 939
288 Ga0207686_10066303 3300025934 Bacteria 2305
289 Ga0207670_11094306 3300025936 Bacteria 673
290 Ga0207691_10508545 3300025940 Bacteria 1023
291 Ga0207691_11680165 3300025940 Unclassified 514
292 Ga0207711_10307910 3300025941 Bacteria 1462
293 Ga0207711_10996749 3300025941 Bacteria 777
294 Ga0207689_10002425 3300025942 Bacteria 17353
295 Ga0207661_10004063 3300025944 Bacteria 10222
296 Ga0207661_10007938 3300025944 Bacteria 7568
297 Ga0207661_10030634 3300025944 Bacteria 4146
298 Ga0207661_10035877 3300025944 Bacteria 3867
299 Ga0207661_10185431 3300025944 Unclassified 1820
300 Ga0207661_10468252 3300025944 Unclassified 1149
301 Ga0207661_10511773 3300025944 Bacteria 1097
302 Ga0207679_10000708 3300025945 Bacteria 22232
303 Ga0207679_10482201 3300025945 Unclassified 1104
304 Ga0207667_10039414 3300025949 Bacteria 5036
305 Ga0207667_10277701 3300025949 Bacteria 1712
306 Ga0207667_10357938 3300025949 Bacteria 1488
307 Ga0207667_10681073 3300025949 Bacteria 1032
308 Ga0207651_10150058 3300025960 Bacteria 1813
309 Ga0207651_11821533 3300025960 Bacteria 548
310 Ga0207712_11998613 3300025961 Bacteria 519
311 Ga0207668_12068303 3300025972 Bacteria 513
312 Ga0207640_10031341 3300025981 Bacteria 3284
313 Ga0207640_10487490 3300025981 Bacteria 1024
314 Ga0207640_10535254 3300025981 Bacteria 982
315 Ga0207658_11575520 3300025986 Unclassified 601
316 Ga0207703_11310874 3300026035 Bacteria 696
317 Ga0207703_11406105 3300026035 Unclassified 671
318 Ga0207639_10684896 3300026041 Bacteria 950
319 Ga0207639_10928577 3300026041 Unclassified 814
320 Ga0207639_11080449 3300026041 Bacteria 752
321 Ga0207639_11494618 3300026041 Bacteria 634
322 Ga0207639_12303065 3300026041 Unclassified 500
323 Ga0207678_10304187 3300026067 Bacteria 1370
324 Ga0207702_10148170 3300026078 Bacteria 2132
325 Ga0207702_10272986 3300026078 Bacteria 1595
326 Ga0207702_10388229 3300026078 Bacteria 1344
327 Ga0207702_10956601 3300026078 Unclassified 849
328 Ga0207702_11061132 3300026078 Unclassified 804
329 Ga0207702_11521688 3300026078 Unclassified 662
330 Ga0207641_10117058 3300026088 Bacteria 2372
331 Ga0207676_10002358 3300026095 Bacteria 13496
332 Ga0207676_10317796 3300026095 Bacteria 1428
333 Ga0207674_10001391 3300026116 Bacteria 31161
334 Ga0207674_10059127 3300026116 Bacteria 3880
335 Ga0207698_10985306 3300026142 Unclassified 853
336 Ga0207698_11436075 3300026142 Bacteria 705
337 Ga0268264_10020943 3300028381 Bacteria 5342
338 Ga0268264_10635408 3300028381 Bacteria 1055
339 Ga0268264_11203647 3300028381 Unclassified 767
340 Ga0265325_10333510 3300031241 Bacteria 672
341 Ga0265331_10132348 3300031250 Bacteria 1137
342 Ga0265327_10061141 3300031251 Bacteria 1923
343 Ga0307408_101790340 3300031548 Bacteria 587
344 Ga0265314_10102915 3300031711 Bacteria 1831
345 Ga0307413_10011964 3300031824 Bacteria 4295
346 Ga0307410_10000322 3300031852 Bacteria 18620
347 Ga0307406_10034571 3300031901 Bacteria 3101
348 Ga0307407_10033848 3300031903 Bacteria 2791
349 Ga0307412_10122706 3300031911 Bacteria 1873
350 Ga0307409_100029455 3300031995 Bacteria 3929
351 Ga0307416_100015562 3300032002 Bacteria 5258
352 Ga0307416_101306159 3300032002 Bacteria 831
353 Ga0307414_10489283 3300032004 Bacteria 1086
354 Ga0307411_10002888 3300032005 Bacteria 7773
355 Ga0307415_100014728 3300032126 Bacteria 4608
356 Ga0307415_101153207 3300032126 Bacteria 728
357 Ga0373926_0048736 3300035083 Bacteria 1524
358 Ga0373934_0000462 3300035086 Bacteria 14216
359 Ga0373934_0003322 3300035086 Bacteria 5890
360 Ga0373934_0033324 3300035086 Bacteria 2021
361 Ga0373923_0007126 3300035111 Bacteria 3915
362 Ga0373939_0361200 3300035114 Bacteria 593
363 Ga0373953_0045816 3300035117 Bacteria 1754
364 Ga0373953_0090720 3300035117 Bacteria 1278
365 Ga0373954_0097818 3300035118 Bacteria 1414
366 Ga0373956_0000644 3300035119 Bacteria 14364
367 Ga0373956_0020281 3300035119 Bacteria 2827
368 Ga0373956_0161080 3300035119 Unclassified 1057
369 Ga0373957_0092527 3300035120 Bacteria 1203
370 Ga0373957_0150096 3300035120 Bacteria 956
371 Ga0373960_0292123 3300035121 Bacteria 604
372 Ga0373943_0035790 3300035170 Bacteria 2375
373 Ga0373955_0007582 3300035172 Bacteria 4996
374 Ga0373955_0014944 3300035172 Bacteria 3790
375 Ga0373955_0080050 3300035172 Bacteria 1844
376 Ga0373955_0347549 3300035172 Unclassified 898
377 Ga0373924_0053639 3300035410 Bacteria 1675
378 Ga0373931_0153222 3300035691 Bacteria 1345
379 Ga0373931_0998264 3300035691 Bacteria 566
380 Ga0373935_0050896 3300035692 Bacteria 2630
381 Ga0373927_0009685 3300035695 Bacteria 6461
382 Ga0373927_0752263 3300035695 Bacteria 644
383 Ga0373927_1180040 3300035695 Unclassified 505
384 Ga0373933_0000613 3300035724 Bacteria 22271
385 Ga0373933_0043698 3300035724 Bacteria 2652
386 Ga0373933_0044845 3300035724 Bacteria 2620
387 Ga0373933_0539897 3300035724 Bacteria 765
388 Ga0373947_0015218 3300035725 Bacteria 4416
389 Ga0373937_0000142 3300036401 Bacteria 69511
390 Ga0373937_0057899 3300036401 Bacteria 3560
391 Ga0373937_1099959 3300036401 Bacteria 743
392 Ga0373925_0047415 3300037068 Bacteria 3198
393 Ga0373925_0528587 3300037068 Bacteria 969
394 Ga0373925_1318193 3300037068 Bacteria 592
395 Ga0395905_1532487 3300037471 Unclassified 571
396 Ga0451577_0000016 3300042876 Bacteria 531002
397 Ga0451577_0090393 3300042876 Bacteria 2732
398 Ga0453684_0087079 3300044712 Bacteria 3872
399 Ga0466967_0068667 3300045976 Bacteria 3166
400 Ga0495592_0001570 3300046454 Bacteria 15958
401 Ga0495592_0503406 3300046454 Unclassified 751
402 Ga0495603_0389658 3300046455 Bacteria 799
403 Ga0495603_0784340 3300046455 Unclassified 544
404 Ga0495629_0018735 3300046459 Bacteria 4948
405 Ga0495629_0043534 3300046459 Bacteria 3152
406 Ga0495629_0051808 3300046459 Bacteria 2872
407 Ga0495629_0141940 3300046459 Bacteria 1671
408 Ga0495651_0000714 3300046462 Bacteria 25773
409 Ga0495651_0009911 3300046462 Bacteria 7327
410 Ga0495653_0000814 3300046463 Bacteria 23936
411 Ga0495653_0002139 3300046463 Bacteria 15584
412 Ga0495653_0864392 3300046463 Unclassified 540
413 Ga0495580_0005901 3300046472 Bacteria 10048
414 Ga0495580_0020058 3300046472 Bacteria 4955
415 Ga0495580_0264780 3300046472 Unclassified 1175
416 Ga0495582_0240110 3300046473 Bacteria 1038
417 Ga0495582_0255803 3300046473 Bacteria 1004
418 Ga0495582_0298834 3300046473 Bacteria 925
419 Ga0495582_0389364 3300046473 Bacteria 803
420 Ga0495639_0014645 3300046475 Bacteria 3397
421 Ga0495639_0159138 3300046475 Unclassified 1092
422 Ga0495662_0022958 3300046476 Bacteria 3012
423 Ga0495662_0141598 3300046476 Bacteria 1184
424 Ga0495662_0235161 3300046476 Bacteria 903
425 Ga0495664_0040889 3300046477 Bacteria 2742
426 Ga0495664_0131120 3300046477 Archaea 1518
427 Ga0495664_0532025 3300046477 Unclassified 701
428 Ga0495594_0014896 3300046499 Bacteria 4081
429 Ga0495594_0036212 3300046499 Bacteria 2690
430 Ga0495594_0152293 3300046499 Unclassified 1313
431 Ga0495594_0247176 3300046499 Unclassified 1016
432 Ga0495594_0317886 3300046499 Bacteria 887
433 Ga0495594_0704290 3300046499 Bacteria 571
434 Ga0495608_0000447 3300046511 Bacteria 28746
435 Ga0495608_0004032 3300046511 Bacteria 10542
436 Ga0495618_0087751 3300046514 Bacteria 1989
437 Ga0495628_0000674 3300046516 Bacteria 31380
438 Ga0495628_0031707 3300046516 Bacteria 4274
439 Ga0495628_0262357 3300046516 Bacteria 1287
440 Ga0495628_0570648 3300046516 Unclassified 811
441 Ga0495630_0027321 3300046517 Bacteria 4232
442 Ga0495630_0092067 3300046517 Bacteria 2291
443 Ga0495630_0206711 3300046517 Bacteria 1499
444 Ga0495666_0082328 3300046526 Bacteria 1522
445 Ga0495652_0001899 3300046529 Bacteria 22213
446 Ga0495652_0082747 3300046529 Bacteria 2644
447 Ga0495665_0017335 3300046531 Bacteria 3874
448 Ga0495665_0099291 3300046531 Bacteria 1528
449 Ga0495665_0144978 3300046531 Bacteria 1240
450 Ga0495665_0187685 3300046531 Archaea 1073
451 Ga0495665_0199162 3300046531 Unclassified 1038
452 Ga0495665_0284207 3300046531 Bacteria 848
453 Ga0495665_0311181 3300046531 Bacteria 805
454 Ga0495640_0142068 3300046533 Bacteria 1547
455 Ga0495640_0574051 3300046533 Bacteria 683
456 Ga0495586_0014458 3300046535 Bacteria 4192
457 Ga0495586_0036247 3300046535 Bacteria 2647
458 Ga0495586_0079542 3300046535 Bacteria 1800
459 Ga0495586_0291691 3300046535 Unclassified 934
460 Ga0495586_0567544 3300046535 Bacteria 655
461 Ga0495587_0000260 3300046536 Bacteria 37943
462 Ga0495587_0000908 3300046536 Bacteria 19559
463 Ga0495587_0014388 3300046536 Bacteria 4965
464 Ga0495587_0145681 3300046536 Bacteria 1351
465 Ga0495587_0216343 3300046536 Bacteria 1081
466 Ga0495598_0093774 3300046537 Bacteria 983
467 Ga0495645_0000095 3300046543 Bacteria 61733
468 Ga0495645_0003394 3300046543 Bacteria 10797
469 Ga0495645_0226309 3300046543 Bacteria 1255
470 Ga0495645_0286428 3300046543 Bacteria 1081
471 Ga0495667_0033004 3300046559 Bacteria 3464
472 Ga0495667_0075213 3300046559 Bacteria 2198
473 Ga0495667_0322568 3300046559 Unclassified 977
474 Ga0495667_0357418 3300046559 Bacteria 922
475 Ga0495635_0009109 3300046663 Bacteria 6930
476 Ga0495635_0028466 3300046663 Bacteria 3884
477 Ga0495635_0171829 3300046663 Bacteria 1474
478 Ga0495635_0585204 3300046663 Bacteria 730
479 Ga0495635_1047855 3300046663 Bacteria 518
480 Ga0495659_0065330 3300046664 Unclassified 1353
481 Ga0495659_0426118 3300046664 Unclassified 575
482 Ga0495657_0004019 3300046675 Bacteria 11795
483 Ga0495657_0065247 3300046675 Bacteria 2395
484 Ga0495599_0000524 3300046678 Bacteria 22058
485 Ga0495599_0005254 3300046678 Bacteria 7725
486 Ga0495599_0019295 3300046678 Bacteria 4250
487 Ga0495623_0015703 3300046679 Bacteria 4893
488 Ga0495623_0031563 3300046679 Bacteria 3405
489 Ga0495646_0031109 3300046680 Bacteria 3329
490 Ga0495646_0059165 3300046680 Bacteria 2289
491 Ga0495658_0121166 3300046683 Bacteria 1582
492 Ga0495658_0312874 3300046683 Bacteria 994
493 Ga0495613_0039338 3300046689 Bacteria 3506
494 Ga0495613_0090726 3300046689 Bacteria 2213
495 Ga0495613_0091962 3300046689 Bacteria 2197
496 Ga0495613_0247161 3300046689 Bacteria 1246
497 Ga0495600_0000452 3300046809 Bacteria 21257
498 Ga0495600_0057584 3300046809 Bacteria 2538
499 Ga0495581_0020670 3300047315 Bacteria 3817
500 Ga0495581_0040739 3300047315 Bacteria 2687
501 Ga0495581_0276581 3300047315 Bacteria 982
502 Ga0495581_0305688 3300047315 Unclassified 929
503 Ga0495604_0003664 3300047317 Bacteria 12245
504 Ga0495604_0074275 3300047317 Bacteria 2563
505 Ga0495604_0137722 3300047317 Bacteria 1748
506 Ga0495604_0167591 3300047317 Bacteria 1548
507 Ga0495636_0126322 3300047318 Bacteria 1135
508 Ga0495636_0357627 3300047318 Bacteria 690
509 Ga0495674_0038336 3300047319 Bacteria 4302
510 Ga0495674_0040829 3300047319 Bacteria 4147
511 Ga0495674_0051100 3300047319 Bacteria 3645
512 Ga0495674_0548256 3300047319 Bacteria 921
513 Ga0495674_0571529 3300047319 Unclassified 898
514 Ga0495674_0831562 3300047319 Unclassified 716
515 Ga0495672_0005400 3300047320 Bacteria 10149
516 Ga0495680_0001760 3300047322 Bacteria 22952
517 Ga0495675_0008401 3300047444 Bacteria 6393
518 Ga0495675_0012890 3300047444 Bacteria 5267
519 Ga0495675_0085820 3300047444 Bacteria 1979
520 Ga0495675_0185359 3300047444 Bacteria 1272
521 Ga0495677_0088282 3300047445 Unclassified 1167
522 Ga0495684_0007377 3300047471 Bacteria 8523
523 Ga0495684_0010377 3300047471 Bacteria 7202
524 Ga0495684_0039066 3300047471 Bacteria 3638
525 Ga0495684_0071505 3300047471 Bacteria 2636
526 Ga0495684_0625427 3300047471 Bacteria 723
527 Ga0495593_0238404 3300047673 Bacteria 911
528 Ga0495593_0306326 3300047673 Bacteria 794
529 Ga0495602_0001539 3300048088 Bacteria 22950
530 Ga0495602_0055672 3300048088 Bacteria 3482
531 Ga0495602_0416924 3300048088 Bacteria 954
532 Ga0495614_0289821 3300048089 Bacteria 755
533 Ga0495614_0351893 3300048089 Bacteria 687
534 Ga0495614_0466830 3300048089 Bacteria 598
535 Ga0496101_0507123 3300048904 Unclassified 953
536 Ga0496102_1635912 3300048905 Bacteria 562
537 Ga0496104_0368621 3300048907 Bacteria 1349
538 Ga0496104_0674181 3300048907 Bacteria 942
539 Ga0496104_1633893 3300048907 Bacteria 547
540 Ga0496105_0508155 3300048908 Bacteria 945
541 Ga0496105_0776749 3300048908 Bacteria 730
542 Ga0496109_0076133 3300048912 Bacteria 3086
543 Ga0496110_0738774 3300048913 Bacteria 887
544 Ga0496112_0584287 3300048915 Bacteria 1049
545 Ga0496112_1846909 3300048915 Unclassified 516
546 Ga0496113_0043862 3300048916 Bacteria 3311
547 Ga0496114_0485534 3300048917 Bacteria 1093
548 Ga0496114_0874847 3300048917 Bacteria 779
549 Ga0496115_0016245 3300048918 Bacteria 5664
550 Ga0496115_0482123 3300048918 Bacteria 998
551 Ga0496115_0505042 3300048918 Unclassified 971
552 Ga0501295_145460 3300049518 Bacteria 583
553 Ga0501299_044505 3300049522 Bacteria 901
554 Ga0501033_0071571 3300049570 Bacteria 2547
555 Ga0501036_0628229 3300049572 Bacteria 890
556 Ga0501043_0336404 3300049579 Bacteria 1149
557 Ga0501070_0018719 3300049586 Bacteria 5810
558 Ga0501071_0772578 3300049587 Bacteria 740
559 Ga0501074_0751091 3300049590 Bacteria 688
560 Ga0501225_0027800 3300049705 Bacteria 1555
561 Ga0501225_0326121 3300049705 Bacteria 526
562 Ga0501035_0198701 3300049822 Bacteria 1721
563 nmdc:mga05p37_1140364_c1 3300050507 Bacteria 812
564 nmdc:mga05p37_1704176_c1 3300050507 Bacteria 614
565 nmdc:mga09592_399975_c1 3300050508 Bacteria 1187
566 nmdc:mga0n895_1522561_c1 3300050512 Unclassified 635
567 nmdc:mga0n895_664446_c1 3300050512 Bacteria 1040
568 nmdc:mga0rr50_1611464_c1 3300050513 Bacteria 548
569 nmdc:mga0rr50_371937_c1 3300050513 Unclassified 1204
570 nmdc:mga08x19_1224284_c1 3300050514 Unclassified 532
571 nmdc:mga08x19_18204_c1 3300050514 Bacteria 4304
572 nmdc:mga08x19_81025_c1 3300050514 Bacteria 2131
573 Ga0495601_0006950 3300053077 Bacteria 6628
574 Ga0495601_0634954 3300053077 Bacteria 684
575 Ga0495601_1049129 3300053077 Bacteria 511
576 Ga0495612_0000583 3300053078 Bacteria 14687
577 Ga0495612_0015097 3300053078 Bacteria 3096
578 Ga0495612_0336665 3300053078 Bacteria 680
579 Ga0495595_0139803 3300053084 Unclassified 1187
580 Ga0495619_0003561 3300053085 Bacteria 10046
581 Ga0495619_0144934 3300053085 Bacteria 1637
582 Ga0590075_108639 3300059424 Unclassified 724
583 Ga0070696_100000297
584 JGI25406J46586_10011762
585 Ga0058863_11318712
586 Ga0070658_11224722
587 Ga0070676_10131194
588 Ga0070683_100006430
589 Ga0070683_100009220
590 Ga0070683_100114184
591 Ga0070683_101456689
592 Ga0070683_101985292
593 Ga0070670_100006704
594 Ga0070670_100481481
595 Ga0068869_100025469
596 Ga0070666_10103323
597 Ga0070680_100000205
598 Ga0070680_100008185
599 Ga0070680_100014532
600 Ga0070680_100020836
601 Ga0070680_100342091
602 Ga0070680_100558073
603 Ga0070682_100004677
604 Ga0070682_100693407
605 Ga0068868_100021328
606 Ga0070660_100024848
607 Ga0070660_100801451
608 Ga0070689_100356289
609 Ga0070691_10132541
610 Ga0070691_10227738
611 Ga0070687_100372436
612 Ga0070687_100503142
613 Ga0070661_100001869
614 Ga0070661_100065970
615 Ga0070661_101581455
616 Ga0070669_100323557
617 Ga0070675_100045083
618 Ga0070675_100317786
619 Ga0070671_100585760
620 Ga0070673_100029908
621 Ga0070688_100081970
622 Ga0070659_100001294
623 Ga0070659_101217809
624 Ga0070667_101325004
625 Ga0070703_10030011
626 Ga0070709_10009933
627 Ga0070709_10569400
628 Ga0070714_100003766
629 Ga0070714_100176741
630 Ga0070713_100053520
631 Ga0070713_100077329
632 Ga0070713_100722919
633 Ga0070710_10127459
634 Ga0070701_10239417
635 Ga0070701_10502563
636 Ga0070711_100028286
637 Ga0070705_101501314
638 Ga0070700_100667688
639 Ga0070708_100000058
640 Ga0070708_100461018
641 Ga0070708_100622649
642 Ga0070663_100213119
643 Ga0070662_100037037
644 Ga0070681_10004453
645 Ga0070681_10005356
646 Ga0070681_10005653
647 Ga0070681_10174629
648 Ga0070681_10695482
649 Ga0070706_100105543
650 Ga0070706_100172874
651 Ga0070706_100874075
652 Ga0070707_100540779
653 Ga0070698_100063280
654 Ga0070698_100152826
655 Ga0070679_100003101
656 Ga0070679_100010061
657 Ga0070679_100153886
658 Ga0070679_100232894
659 Ga0070679_100875130
660 Ga0070684_100005633
661 Ga0070684_100028926
662 Ga0070684_100083365
663 Ga0070684_100160559
664 Ga0070684_100495740
665 Ga0070684_101597082
666 Ga0068853_100112434
667 Ga0068853_100418483
668 Ga0068853_101100172
669 Ga0068853_101233506
670 Ga0070672_100284115
671 Ga0070672_100704732
672 Ga0070686_100126541
673 Ga0070686_100205303
674 Ga0070686_100702920
675 Ga0070695_100017296
676 Ga0070695_101700512
677 Ga0070693_100019863
678 Ga0070693_100027663
679 Ga0068855_100004833
680 Ga0068855_100040039
681 Ga0068855_100584964
682 Ga0070664_100003596
683 Ga0070664_100778201
684 Ga0068857_100003020
685 Ga0068857_100218801
686 Ga0068854_100018926
687 Ga0068854_100532023
688 Ga0068854_100906341
689 Ga0068856_100024253
690 Ga0068856_100138082
691 Ga0068856_100327401
692 Ga0068856_100479240
693 Ga0068856_100535635
694 Ga0068856_101397141
695 Ga0070702_100000340
696 Ga0068852_100024868
697 Ga0068852_100049486
698 Ga0068852_101294857
699 Ga0068859_100002158
700 Ga0068864_100005274
701 Ga0068864_100186915
702 Ga0068870_10058668
703 Ga0068863_100028849
704 Ga0068863_101283958
705 Ga0068863_102543895
706 Ga0068858_100290897
707 Ga0068858_100696817
708 Ga0068860_100031912
709 Ga0081455_10088128
710 Ga0081539_10000104
711 Ga0070712_100200875
712 Ga0070712_100437987
713 Ga0097621_100093499
714 Ga0097621_100558878
715 Ga0097621_101553125
716 Ga0068871_100052307
717 Ga0075431_100010809
718 Ga0075431_101083399
719 Ga0075434_100588749
720 Ga0075434_101868423
721 Ga0075429_100414121
722 Ga0075436_100010293
723 Ga0075436_100033388
724 Ga0075436_100588271
725 Ga0097620_100002158
726 Ga0075435_100309266
727 Ga0075435_100756619
728 Ga0105240_10124679
729 Ga0105240_10303165
730 Ga0105240_10379557
731 Ga0105240_10740509
732 Ga0105240_11711249
733 Ga0111539_12169214
734 Ga0105245_10003912
735 Ga0105245_10046234
736 Ga0114129_10094538
737 Ga0114129_10790253
738 Ga0114129_11500531
739 Ga0105243_10086419
740 Ga0105241_10031783
741 Ga0105241_10038596
742 Ga0105241_10207085
743 Ga0105241_10524269
744 Ga0105241_10556011
745 Ga0105242_10005905
746 Ga0105248_10010873
747 Ga0105248_10114366
748 Ga0105237_10087741
749 Ga0105237_10201677
750 Ga0105237_10265777
751 Ga0105237_10401457
752 Ga0105238_10023014
753 Ga0105238_10050173
754 Ga0105238_10194357
755 Ga0105249_10105268
756 Ga0105239_10020205
757 Ga0105246_10007048
758 Ga0105246_11099894
759 Ga0157373_10033044
760 Ga0157373_10210528
761 Ga0157373_11194272
762 Ga0157371_10221408
763 Ga0157371_10730163
764 Ga0157370_10029924
765 Ga0157370_10075257
766 Ga0157370_10097267
767 Ga0157370_10143067
768 Ga0157370_10446277
769 Ga0157370_10871713
770 Ga0157369_10018679
771 Ga0157369_10082373
772 Ga0157369_10714081
773 Ga0157369_11150259
774 Ga0157369_11817267
775 Ga0157374_10113088
776 Ga0163162_10397838
777 Ga0163162_11550531
778 Ga0157372_10015410
779 Ga0157372_10023987
780 Ga0157372_10053048
781 Ga0157372_10060732
782 Ga0157372_10062052
783 Ga0157372_10089718
784 Ga0157372_10190789
785 Ga0157372_10391530
786 Ga0157372_10439510
787 Ga0157375_10010796
788 Ga0157375_10107474
789 Ga0157375_10630124
790 Ga0157375_11584105
791 Ga0163163_10029323
792 Ga0163163_10394263
793 Ga0157377_10001895
794 Ga0157379_11708655
795 Ga0157376_10007107
796 Ga0157376_10188349
797 Ga0182007_10091075
798 Ga0182005_1042766
799 Ga0206356_10095531
800 Ga0206356_11276463
801 Ga0206356_11666155
802 Ga0206352_11250380
803 Ga0206353_10033506
804 Ga0207697_10186601
805 Ga0207692_10076951
806 Ga0207688_10796081
807 Ga0207680_10227247
808 Ga0207699_10009189
809 Ga0207699_10112415
810 Ga0207699_10266038
811 Ga0207645_10359173
812 Ga0207643_10027832
813 Ga0207684_10066893
814 Ga0207684_10531785
815 Ga0207654_10203516
816 Ga0207654_10906296
817 Ga0207654_11166589
818 Ga0207707_10005392
819 Ga0207707_10015754
820 Ga0207707_10092411
821 Ga0207707_10136538
822 Ga0207707_11510689
823 Ga0207695_10004023
824 Ga0207695_10029655
825 Ga0207695_10048031
826 Ga0207695_10054010
827 Ga0207695_10463843
828 Ga0207695_10860600
829 Ga0207671_10079862
830 Ga0207671_10858105
831 Ga0207671_11179518
832 Ga0207693_10136291
833 Ga0207693_10540436
834 Ga0207663_10109054
835 Ga0207660_10003275
836 Ga0207660_10279605
837 Ga0207660_10327043
838 Ga0207660_10897058
839 Ga0207662_10509367
840 Ga0207662_11256524
841 Ga0207649_10002885
842 Ga0207649_10019889
843 Ga0207649_11366940
844 Ga0207652_10063563
845 Ga0207652_10182897
846 Ga0207652_10200229
847 Ga0207652_10294615
848 Ga0207652_11892532
849 Ga0207646_10422065
850 Ga0207646_11333901
851 Ga0207681_10433600
852 Ga0207681_10519508
853 Ga0207694_10012671
854 Ga0207694_10207659
855 Ga0207694_10533391
856 Ga0207694_10815426
857 Ga0207650_10003720
858 Ga0207650_10443284
859 Ga0207659_10386130
860 Ga0207687_10045876
861 Ga0207700_10218991
862 Ga0207700_10561427
863 Ga0207664_10155610
864 Ga0207664_10583920
865 Ga0207644_10985135
866 Ga0207690_10013625
867 Ga0207690_10547437
868 Ga0207706_10013924
869 Ga0207706_10607332
870 Ga0207686_10066303
871 Ga0207670_11094306
872 Ga0207691_10508545
873 Ga0207691_11680165
874 Ga0207711_10307910
875 Ga0207711_10996749
876 Ga0207689_10002425
877 Ga0207661_10004063
878 Ga0207661_10007938
879 Ga0207661_10030634
880 Ga0207661_10035877
881 Ga0207661_10185431
882 Ga0207661_10468252
883 Ga0207661_10511773
884 Ga0207679_10000708
885 Ga0207679_10482201
886 Ga0207667_10039414
887 Ga0207667_10277701
888 Ga0207667_10357938
889 Ga0207667_10681073
890 Ga0207651_10150058
891 Ga0207651_11821533
892 Ga0207712_11998613
893 Ga0207668_12068303
894 Ga0207640_10031341
895 Ga0207640_10487490
896 Ga0207640_10535254
897 Ga0207658_11575520
898 Ga0207703_11310874
899 Ga0207703_11406105
900 Ga0207639_10684896
901 Ga0207639_10928577
902 Ga0207639_11080449
903 Ga0207639_11494618
904 Ga0207639_12303065
905 Ga0207678_10304187
906 Ga0207702_10148170
907 Ga0207702_10272986
908 Ga0207702_10388229
909 Ga0207702_10956601
910 Ga0207702_11061132
911 Ga0207702_11521688
912 Ga0207641_10117058
913 Ga0207676_10002358
914 Ga0207676_10317796
915 Ga0207674_10001391
916 Ga0207674_10059127
917 Ga0207698_10985306
918 Ga0207698_11436075
919 Ga0268264_10020943
920 Ga0268264_10635408
921 Ga0268264_11203647
922 Ga0265325_10333510
923 Ga0265331_10132348
924 Ga0265327_10061141
925 Ga0307408_101790340
926 Ga0265314_10102915
927 Ga0307413_10011964
928 Ga0307410_10000322
929 Ga0307406_10034571
930 Ga0307407_10033848
931 Ga0307412_10122706
932 Ga0307409_100029455
933 Ga0307416_100015562
934 Ga0307416_101306159
935 Ga0307414_10489283
936 Ga0307411_10002888
937 Ga0307415_100014728
938 Ga0307415_101153207
939 Ga0373926_0048736
940 Ga0373934_0000462
941 Ga0373934_0003322
942 Ga0373934_0033324
943 Ga0373923_0007126
944 Ga0373939_0361200
945 Ga0373953_0045816
946 Ga0373953_0090720
947 Ga0373954_0097818
948 Ga0373956_0000644
949 Ga0373956_0020281
950 Ga0373956_0161080
951 Ga0373957_0092527
952 Ga0373957_0150096
953 Ga0373960_0292123
954 Ga0373943_0035790
955 Ga0373955_0007582
956 Ga0373955_0014944
957 Ga0373955_0080050
958 Ga0373955_0347549
959 Ga0373924_0053639
960 Ga0373931_0153222
961 Ga0373931_0998264
962 Ga0373935_0050896
963 Ga0373927_0009685
964 Ga0373927_0752263
965 Ga0373927_1180040
966 Ga0373933_0000613
967 Ga0373933_0043698
968 Ga0373933_0044845
969 Ga0373933_0539897
970 Ga0373947_0015218
971 Ga0373937_0000142
972 Ga0373937_0057899
973 Ga0373937_1099959
974 Ga0373925_0047415
975 Ga0373925_0528587
976 Ga0373925_1318193
977 Ga0395905_1532487
978 Ga0451577_0000016
979 Ga0451577_0090393
980 Ga0453684_0087079
981 Ga0466967_0068667
982 Ga0495592_0001570
983 Ga0495592_0503406
984 Ga0495603_0389658
985 Ga0495603_0784340
986 Ga0495629_0018735
987 Ga0495629_0043534
988 Ga0495629_0051808
989 Ga0495629_0141940
990 Ga0495651_0000714
991 Ga0495651_0009911
992 Ga0495653_0000814
993 Ga0495653_0002139
994 Ga0495653_0864392
995 Ga0495580_0005901
996 Ga0495580_0020058
997 Ga0495580_0264780
998 Ga0495582_0240110
999 Ga0495582_0255803
1000 Ga0495582_0298834
1001 Ga0495582_0389364
1002 Ga0495639_0014645
1003 Ga0495639_0159138
1004 Ga0495662_0022958
1005 Ga0495662_0141598
1006 Ga0495662_0235161
1007 Ga0495664_0040889
1008 Ga0495664_0131120
1009 Ga0495664_0532025
1010 Ga0495594_0014896
1011 Ga0495594_0036212
1012 Ga0495594_0152293
1013 Ga0495594_0247176
1014 Ga0495594_0317886
1015 Ga0495594_0704290
1016 Ga0495608_0000447
1017 Ga0495608_0004032
1018 Ga0495618_0087751
1019 Ga0495628_0000674
1020 Ga0495628_0031707
1021 Ga0495628_0262357
1022 Ga0495628_0570648
1023 Ga0495630_0027321
1024 Ga0495630_0092067
1025 Ga0495630_0206711
1026 Ga0495666_0082328
1027 Ga0495652_0001899
1028 Ga0495652_0082747
1029 Ga0495665_0017335
1030 Ga0495665_0099291
1031 Ga0495665_0144978
1032 Ga0495665_0187685
1033 Ga0495665_0199162
1034 Ga0495665_0284207
1035 Ga0495665_0311181
1036 Ga0495640_0142068
1037 Ga0495640_0574051
1038 Ga0495586_0014458
1039 Ga0495586_0036247
1040 Ga0495586_0079542
1041 Ga0495586_0291691
1042 Ga0495586_0567544
1043 Ga0495587_0000260
1044 Ga0495587_0000908
1045 Ga0495587_0014388
1046 Ga0495587_0145681
1047 Ga0495587_0216343
1048 Ga0495598_0093774
1049 Ga0495645_0000095
1050 Ga0495645_0003394
1051 Ga0495645_0226309
1052 Ga0495645_0286428
1053 Ga0495667_0033004
1054 Ga0495667_0075213
1055 Ga0495667_0322568
1056 Ga0495667_0357418
1057 Ga0495635_0009109
1058 Ga0495635_0028466
1059 Ga0495635_0171829
1060 Ga0495635_0585204
1061 Ga0495635_1047855
1062 Ga0495659_0065330
1063 Ga0495659_0426118
1064 Ga0495657_0004019
1065 Ga0495657_0065247
1066 Ga0495599_0000524
1067 Ga0495599_0005254
1068 Ga0495599_0019295
1069 Ga0495623_0015703
1070 Ga0495623_0031563
1071 Ga0495646_0031109
1072 Ga0495646_0059165
1073 Ga0495658_0121166
1074 Ga0495658_0312874
1075 Ga0495613_0039338
1076 Ga0495613_0090726
1077 Ga0495613_0091962
1078 Ga0495613_0247161
1079 Ga0495600_0000452
1080 Ga0495600_0057584
1081 Ga0495581_0020670
1082 Ga0495581_0040739
1083 Ga0495581_0276581
1084 Ga0495581_0305688
1085 Ga0495604_0003664
1086 Ga0495604_0074275
1087 Ga0495604_0137722
1088 Ga0495604_0167591
1089 Ga0495636_0126322
1090 Ga0495636_0357627
1091 Ga0495674_0038336
1092 Ga0495674_0040829
1093 Ga0495674_0051100
1094 Ga0495674_0548256
1095 Ga0495674_0571529
1096 Ga0495674_0831562
1097 Ga0495672_0005400
1098 Ga0495680_0001760
1099 Ga0495675_0008401
1100 Ga0495675_0012890
1101 Ga0495675_0085820
1102 Ga0495675_0185359
1103 Ga0495677_0088282
1104 Ga0495684_0007377
1105 Ga0495684_0010377
1106 Ga0495684_0039066
1107 Ga0495684_0071505
1108 Ga0495684_0625427
1109 Ga0495593_0238404
1110 Ga0495593_0306326
1111 Ga0495602_0001539
1112 Ga0495602_0055672
1113 Ga0495602_0416924
1114 Ga0495614_0289821
1115 Ga0495614_0351893
1116 Ga0495614_0466830
1117 Ga0496101_0507123
1118 Ga0496102_1635912
1119 Ga0496104_0368621
1120 Ga0496104_0674181
1121 Ga0496104_1633893
1122 Ga0496105_0508155
1123 Ga0496105_0776749
1124 Ga0496109_0076133
1125 Ga0496110_0738774
1126 Ga0496112_0584287
1127 Ga0496112_1846909
1128 Ga0496113_0043862
1129 Ga0496114_0485534
1130 Ga0496114_0874847
1131 Ga0496115_0016245
1132 Ga0496115_0482123
1133 Ga0496115_0505042
1134 Ga0501295_145460
1135 Ga0501299_044505
1136 Ga0501033_0071571
1137 Ga0501036_0628229
1138 Ga0501043_0336404
1139 Ga0501070_0018719
1140 Ga0501071_0772578
1141 Ga0501074_0751091
1142 Ga0501225_0027800
1143 Ga0501225_0326121
1144 Ga0501035_0198701
1145 nmdc:mga05p37_1140364_c1
1146 nmdc:mga05p37_1704176_c1
1147 nmdc:mga09592_399975_c1
1148 nmdc:mga0n895_1522561_c1
1149 nmdc:mga0n895_664446_c1
1150 nmdc:mga0rr50_1611464_c1
1151 nmdc:mga0rr50_371937_c1
1152 nmdc:mga08x19_1224284_c1
1153 nmdc:mga08x19_18204_c1
1154 nmdc:mga08x19_81025_c1
1155 Ga0495601_0006950
1156 Ga0495601_0634954
1157 Ga0495601_1049129
1158 Ga0495612_0000583
1159 Ga0495612_0015097
1160 Ga0495612_0336665
1161 Ga0495595_0139803
1162 Ga0495619_0003561
1163 Ga0495619_0144934
1164 Ga0590075_108639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qvf-assembly2.cif.gz_C tt_c0855 competence pilin from thermus thermophilus hb27 0.6208 1 52
5hfu-assembly1.cif.gz_A crystal structure of human hexokinase 2 with cmpd 27, a 2-amido-6-benzenesulfonamide glucosamine 0.5894 27 52
5hex-assembly1.cif.gz_A crystal structure of human hexokinase 2 with cmpd 30, a 2-amino-6-benzenesulfonamide glucosamine 0.5814 28 52
2w36-assembly1.cif.gz_A structures of endonuclease v with dna reveal initiation of deaminated adenine repair 0.5789 15 77
6gri-assembly1.cif.gz_D-2 e. coli microcin synthetase mcbbcd complex 0.5683 11 51
ID Description Score Start End Superfamily
af_Q9LER9_38_144_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7227 3 56 2.60.120.200
af_Q9MAP2_147_257_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7177 3 56 2.60.120.200
af_O80608_342_478_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6611 1 53 2.60.120.200
af_Q9SA02_134_259_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6551 2 56 2.60.120.200
af_Q0V7S0_244_365_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6518 2 66 2.60.120.200
ID Description Score Start End GO Terms
AF-W0RLC3-F1-model_v4 Uncharacterized protein 0.8538 1 91
AF-A0A7W0JWY7-F1-model_v4 Uncharacterized protein 0.8296 1 91
AF-A0A7Y4VVQ9-F1-model_v4 Uncharacterized protein 0.8289 1 91
AF-A0A7Y4VVQ9-F1-model_v4 Uncharacterized protein 0.8202 1 91
AF-W0RLC3-F1-model_v4 Uncharacterized protein 0.8194 1 91

Map