F466134

General Info

Members Datasets Scaffolds Average Seq Length
582 243 1164 257

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100018057|Ga0070683_1000180573
Length 288
Sequence MGTQQYIPSSSCPHVNDCKQCIVGCTGTLQDSFSSMRTLKIILAYDGSEFSGWQIQPDSPSIQATLASAIGRVTGEKVLPQGSGRTDAGVHALGQVASFRLESAIPAGNLVIALNDVLPSSIRVLDCVEMAADFHARKSALAKTYRYRMYRRDICPPFLARYVWHYPYPLDFDAMKKAVVLVEGEHDFTSFAAVDPERGKEQKSSNVRTVFSSCLSEGEGEFVYEIRGNGFLHHMVRNLVGTFLLVGKKTIAPDDVLRILADRNRSSAGATAPASGLYLVGVEYGKGL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.84
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 23.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100018057 3300005329 Bacteria 6241
2 LJNas_1000441 3300000546 Bacteria 7312
3 JGI24737J22298_10014354 3300001990 Unclassified 2571
4 JGI24034J26672_10004068 3300002239 Unclassified 2061
5 JGI24751J29686_10003177 3300002459 Unclassified 3311
6 Ga0065715_10215109 3300005293 Unclassified 1296
7 Ga0070676_10110164 3300005328 Bacteria 1713
8 Ga0070683_100007284 3300005329 Bacteria 9332
9 Ga0070683_100056008 3300005329 Unclassified 3661
10 Ga0070690_100023350 3300005330 Bacteria 3793
11 Ga0070670_100010385 3300005331 Bacteria 7945
12 Ga0070670_100012675 3300005331 Bacteria 7218
13 Ga0070670_100074948 3300005331 Unclassified 2908
14 Ga0070677_10042194 3300005333 Unclassified 1805
15 Ga0068869_100011893 3300005334 Bacteria 5724
16 Ga0068869_100019443 3300005334 Bacteria 4641
17 Ga0068869_100049290 3300005334 Bacteria 3048
18 Ga0070680_100168205 3300005336 Unclassified 1844
19 Ga0070680_100232161 3300005336 Unclassified 1558
20 Ga0070682_100007498 3300005337 Bacteria 6150
21 Ga0070682_100043906 3300005337 Bacteria 2765
22 Ga0068868_100028354 3300005338 Bacteria 4280
23 Ga0068868_100030361 3300005338 Bacteria 4144
24 Ga0068868_100068938 3300005338 Unclassified 2817
25 Ga0070660_100018382 3300005339 Bacteria 5108
26 Ga0070660_100031261 3300005339 Bacteria 3997
27 Ga0070689_100020651 3300005340 Bacteria 4890
28 Ga0070689_100043878 3300005340 Unclassified 3439
29 Ga0070689_100566093 3300005340 Bacteria 981
30 Ga0070691_10028683 3300005341 Bacteria 2602
31 Ga0070687_100027821 3300005343 Unclassified 2736
32 Ga0070687_100091707 3300005343 Bacteria 1682
33 Ga0070661_100003844 3300005344 Bacteria 10334
34 Ga0070661_100015105 3300005344 Bacteria 5448
35 Ga0070661_100021727 3300005344 Bacteria 4588
36 Ga0070668_100031445 3300005347 Bacteria 4039
37 Ga0070668_100040718 3300005347 Bacteria 3556
38 Ga0070669_100012053 3300005353 Bacteria 6133
39 Ga0070675_100071721 3300005354 Bacteria 2874
40 Ga0070671_100147683 3300005355 Bacteria 1985
41 Ga0070671_100726156 3300005355 Unclassified 863
42 Ga0070674_100008898 3300005356 Bacteria 5994
43 Ga0070673_100015460 3300005364 Bacteria 5361
44 Ga0070673_100290657 3300005364 Bacteria 1436
45 Ga0070688_100006877 3300005365 Bacteria 6105
46 Ga0070659_100032396 3300005366 Bacteria 4053
47 Ga0070659_100037597 3300005366 Unclassified 3774
48 Ga0070667_100013832 3300005367 Bacteria 6670
49 Ga0070667_100070406 3300005367 Unclassified 2977
50 Ga0070709_10001213 3300005434 Bacteria 14138
51 Ga0070709_10025866 3300005434 Bacteria 3471
52 Ga0070709_10047333 3300005434 Unclassified 2679
53 Ga0070714_100001161 3300005435 Bacteria 18973
54 Ga0070714_100008314 3300005435 Bacteria 8099
55 Ga0070714_100086123 3300005435 Bacteria 2745
56 Ga0070714_100154419 3300005435 Bacteria 2071
57 Ga0070714_100294088 3300005435 Bacteria 1512
58 Ga0070714_100630213 3300005435 Bacteria 1031
59 Ga0070713_100000421 3300005436 Bacteria 27054
60 Ga0070713_100019519 3300005436 Bacteria 5179
61 Ga0070713_100027060 3300005436 Bacteria 4512
62 Ga0070713_100049463 3300005436 Unclassified 3468
63 Ga0070713_100262758 3300005436 Unclassified 1578
64 Ga0070710_10005462 3300005437 Bacteria 6039
65 Ga0070710_10010310 3300005437 Bacteria 4589
66 Ga0070711_100006171 3300005439 Bacteria 7207
67 Ga0070711_100079715 3300005439 Unclassified 2329
68 Ga0070711_100272091 3300005439 Bacteria 1337
69 Ga0070700_100052107 3300005441 Bacteria 2550
70 Ga0070694_100122181 3300005444 Bacteria 1870
71 Ga0070708_100001001 3300005445 Bacteria 21596
72 Ga0070708_100187596 3300005445 Bacteria 1934
73 Ga0070663_100008558 3300005455 Bacteria 6302
74 Ga0070663_100344859 3300005455 Bacteria 1204
75 Ga0070662_100002659 3300005457 Bacteria 11024
76 Ga0070662_100044713 3300005457 Unclassified 3173
77 Ga0070681_10000055 3300005458 Bacteria 80179
78 Ga0070681_10061238 3300005458 Bacteria 3739
79 Ga0068867_100079525 3300005459 Bacteria 2468
80 Ga0070685_10000730 3300005466 Bacteria 17916
81 Ga0070685_10248538 3300005466 Bacteria 1177
82 Ga0070706_100001647 3300005467 Bacteria 23233
83 Ga0070706_100028367 3300005467 Bacteria 5154
84 Ga0070707_100001854 3300005468 Bacteria 20311
85 Ga0070707_100038431 3300005468 Unclassified 4572
86 Ga0070698_100000411 3300005471 Bacteria 45572
87 Ga0070699_100000032 3300005518 Bacteria 136937
88 Ga0070679_100047079 3300005530 Bacteria 4300
89 Ga0070679_100081560 3300005530 Unclassified 3224
90 Ga0070679_100200229 3300005530 Bacteria 1963
91 Ga0070684_100007024 3300005535 Bacteria 8750
92 Ga0070684_100021109 3300005535 Bacteria 5412
93 Ga0070684_100054550 3300005535 Bacteria 3482
94 Ga0070684_100311219 3300005535 Unclassified 1446
95 Ga0070697_100000138 3300005536 Bacteria 58927
96 Ga0070697_100000166 3300005536 Bacteria 53539
97 Ga0070697_100003351 3300005536 Bacteria 12309
98 Ga0068853_100025667 3300005539 Unclassified 4945
99 Ga0068853_100045590 3300005539 Unclassified 3756
100 Ga0068853_100061155 3300005539 Unclassified 3257
101 Ga0068853_100066764 3300005539 Unclassified 3124
102 Ga0068853_100115978 3300005539 Bacteria 2384
103 Ga0070672_100006124 3300005543 Bacteria 8051
104 Ga0070686_100029359 3300005544 Bacteria 3344
105 Ga0070686_100044425 3300005544 Bacteria 2792
106 Ga0070693_100022831 3300005547 Bacteria 3334
107 Ga0070693_100073933 3300005547 Unclassified 2015
108 Ga0070693_100149643 3300005547 Unclassified 1477
109 Ga0070665_100016654 3300005548 Bacteria 7366
110 Ga0070704_100377144 3300005549 Bacteria 1204
111 Ga0068855_100002871 3300005563 Bacteria 21140
112 Ga0068855_100005054 3300005563 Bacteria 16100
113 Ga0068855_100017861 3300005563 Bacteria 8526
114 Ga0068855_100039167 3300005563 Bacteria 5627
115 Ga0068855_100066016 3300005563 Unclassified 4218
116 Ga0068855_100479428 3300005563 Bacteria 1354
117 Ga0068855_100485448 3300005563 Bacteria 1344
118 Ga0070664_100001796 3300005564 Bacteria 17205
119 Ga0070664_100019845 3300005564 Bacteria 5533
120 Ga0070664_100103337 3300005564 Bacteria 2480
121 Ga0070664_100127136 3300005564 Unclassified 2237
122 Ga0068857_100000041 3300005577 Bacteria 70173
123 Ga0068857_100006556 3300005577 Bacteria 9991
124 Ga0068857_100019541 3300005577 Bacteria 5950
125 Ga0068857_100068970 3300005577 Bacteria 3148
126 Ga0068857_100141350 3300005577 Bacteria 2176
127 Ga0068857_100580209 3300005577 Bacteria 1058
128 Ga0068854_100001461 3300005578 Bacteria 14306
129 Ga0068854_100005254 3300005578 Bacteria 8168
130 Ga0068854_100009154 3300005578 Bacteria 6387
131 Ga0068854_100038080 3300005578 Bacteria 3380
132 Ga0068856_100000355 3300005614 Bacteria 49986
133 Ga0068856_100001245 3300005614 Bacteria 26739
134 Ga0068856_100001397 3300005614 Bacteria 25289
135 Ga0068856_100003871 3300005614 Bacteria 15025
136 Ga0068856_100019308 3300005614 Bacteria 6616
137 Ga0068856_100023581 3300005614 Bacteria 5983
138 Ga0068856_100026392 3300005614 Bacteria 5664
139 Ga0068856_100205403 3300005614 Unclassified 1985
140 Ga0068856_100250571 3300005614 Bacteria 1786
141 Ga0070702_100013989 3300005615 Bacteria 4063
142 Ga0068852_100034832 3300005616 Unclassified 4193
143 Ga0068852_100049809 3300005616 Unclassified 3585
144 Ga0068852_100263754 3300005616 Bacteria 1655
145 Ga0068859_100000959 3300005617 Bacteria 29530
146 Ga0068859_100032500 3300005617 Bacteria 5241
147 Ga0068859_100032862 3300005617 Bacteria 5212
148 Ga0068864_100020486 3300005618 Bacteria 5533
149 Ga0068864_100025428 3300005618 Bacteria 4985
150 Ga0068864_100060038 3300005618 Bacteria 3292
151 Ga0068864_100200870 3300005618 Unclassified 1831
152 Ga0068866_10002844 3300005718 Bacteria 7135
153 Ga0068861_100074611 3300005719 Unclassified 2638
154 Ga0068851_10003443 3300005834 Bacteria 7043
155 Ga0068851_10056271 3300005834 Unclassified 2005
156 Ga0068870_10009491 3300005840 Bacteria 4431
157 Ga0068870_10158394 3300005840 Bacteria 1340
158 Ga0068863_100020580 3300005841 Bacteria 6306
159 Ga0068863_100051896 3300005841 Unclassified 3887
160 Ga0068863_100105843 3300005841 Bacteria 2676
161 Ga0068858_100025619 3300005842 Bacteria 5488
162 Ga0068858_100030244 3300005842 Bacteria 5029
163 Ga0068860_100105772 3300005843 Bacteria 2687
164 Ga0068860_100368117 3300005843 Unclassified 1417
165 Ga0068862_100024636 3300005844 Bacteria 5050
166 Ga0068862_100058121 3300005844 Bacteria 3317
167 Ga0070717_10000618 3300006028 Bacteria 22826
168 Ga0070717_10003199 3300006028 Bacteria 11700
169 Ga0070717_10027043 3300006028 Bacteria 4583
170 Ga0070717_10048229 3300006028 Unclassified 3493
171 Ga0070717_10288259 3300006028 Bacteria 1457
172 Ga0070715_10031475 3300006163 Bacteria 2154
173 Ga0070715_10058845 3300006163 Unclassified 1679
174 Ga0070716_100001991 3300006173 Bacteria 9310
175 Ga0070716_100126202 3300006173 Bacteria 1610
176 Ga0070716_100184340 3300006173 Unclassified 1373
177 Ga0070716_100289466 3300006173 Bacteria 1134
178 Ga0070716_100434928 3300006173 Unclassified 952
179 Ga0070712_100001480 3300006175 Bacteria 14328
180 Ga0070712_100004747 3300006175 Bacteria 8402
181 Ga0070712_100006613 3300006175 Bacteria 7203
182 Ga0097621_100000533 3300006237 Bacteria 26715
183 Ga0097621_100000581 3300006237 Bacteria 25739
184 Ga0097621_100023399 3300006237 Bacteria 4811
185 Ga0097621_100037650 3300006237 Bacteria 3878
186 Ga0097621_100356238 3300006237 Unclassified 1302
187 Ga0097621_100626134 3300006237 Unclassified 985
188 Ga0068871_100000221 3300006358 Bacteria 40089
189 Ga0068871_100000664 3300006358 Bacteria 23618
190 Ga0068871_100070334 3300006358 Bacteria 2876
191 Ga0068871_100091544 3300006358 Bacteria 2535
192 Ga0068871_100516007 3300006358 Unclassified 1079
193 Ga0075434_100017276 3300006871 Bacteria 6948
194 Ga0075434_100044621 3300006871 Unclassified 4397
195 Ga0075434_100439791 3300006871 Unclassified 1325
196 Ga0068865_100018958 3300006881 Bacteria 4447
197 Ga0068865_100262258 3300006881 Bacteria 1368
198 Ga0075436_100008378 3300006914 Bacteria 7070
199 Ga0097620_100000959 3300006931 Bacteria 29530
200 Ga0097620_100032499 3300006931 Bacteria 5241
201 Ga0097620_100032861 3300006931 Bacteria 5212
202 Ga0075435_100005304 3300007076 Bacteria 8979
203 Ga0075435_100079996 3300007076 Bacteria 2683
204 Ga0099794_10007866 3300007265 Bacteria 4404
205 Ga0099795_10009077 3300007788 Bacteria 2870
206 Ga0105240_10032699 3300009093 Bacteria 6732
207 Ga0105240_10081651 3300009093 Bacteria 3972
208 Ga0105240_10122041 3300009093 Bacteria 3136
209 Ga0105240_10457342 3300009093 Unclassified 1427
210 Ga0105245_10010608 3300009098 Bacteria 8016
211 Ga0105245_10363168 3300009098 Bacteria 1437
212 Ga0105247_10005783 3300009101 Bacteria 7745
213 Ga0105247_10103529 3300009101 Bacteria 1823
214 Ga0114129_10027887 3300009147 Bacteria 7996
215 Ga0114129_10139441 3300009147 Bacteria 3325
216 Ga0105243_10034924 3300009148 Bacteria 3896
217 Ga0105241_10005728 3300009174 Bacteria 9172
218 Ga0105241_10006237 3300009174 Bacteria 8789
219 Ga0105241_10006483 3300009174 Bacteria 8629
220 Ga0105241_10018875 3300009174 Bacteria 5081
221 Ga0105241_10027658 3300009174 Bacteria 4224
222 Ga0105241_10059392 3300009174 Bacteria 2940
223 Ga0105242_10007955 3300009176 Bacteria 8167
224 Ga0105242_10075732 3300009176 Bacteria 2803
225 Ga0105242_10158237 3300009176 Unclassified 1981
226 Ga0105248_10015991 3300009177 Bacteria 8260
227 Ga0105248_10024446 3300009177 Bacteria 6716
228 Ga0105248_10060019 3300009177 Bacteria 4271
229 Ga0105248_10085617 3300009177 Unclassified 3546
230 Ga0105248_10244030 3300009177 Bacteria 2022
231 Ga0105248_10369778 3300009177 Bacteria 1614
232 Ga0105248_10481333 3300009177 Unclassified 1399
233 Ga0105237_10090451 3300009545 Bacteria 3050
234 Ga0105237_10482633 3300009545 Unclassified 1246
235 Ga0105238_10000533 3300009551 Bacteria 39822
236 Ga0105238_10040743 3300009551 Bacteria 4706
237 Ga0105238_10082056 3300009551 Unclassified 3214
238 Ga0105238_10098520 3300009551 Bacteria 2907
239 Ga0105238_10102996 3300009551 Bacteria 2836
240 Ga0105238_10176164 3300009551 Bacteria 2115
241 Ga0105238_10251989 3300009551 Unclassified 1744
242 Ga0105249_10003055 3300009553 Bacteria 14445
243 Ga0105249_10011640 3300009553 Bacteria 7736
244 Ga0105239_10021576 3300010375 Bacteria 7102
245 Ga0105239_10081075 3300010375 Bacteria 3571
246 Ga0105239_10627861 3300010375 Bacteria 1226
247 Ga0105246_10005741 3300011119 Bacteria 7575
248 Ga0105246_10115243 3300011119 Bacteria 1982
249 Ga0157373_10001055 3300013100 Bacteria 21221
250 Ga0157373_10006123 3300013100 Bacteria 8996
251 Ga0157371_10005072 3300013102 Bacteria 11245
252 Ga0157371_10009784 3300013102 Bacteria 7518
253 Ga0157371_10019817 3300013102 Unclassified 4955
254 Ga0157371_10044229 3300013102 Bacteria 3171
255 Ga0157371_10131532 3300013102 Unclassified 1780
256 Ga0157371_10158244 3300013102 Bacteria 1617
257 Ga0157370_10050679 3300013104 Bacteria 3968
258 Ga0157369_10000170 3300013105 Bacteria 91583
259 Ga0157369_10025031 3300013105 Bacteria 6629
260 Ga0157369_10026627 3300013105 Bacteria 6413
261 Ga0157369_10029190 3300013105 Bacteria 6098
262 Ga0157369_10063569 3300013105 Bacteria 3976
263 Ga0157369_10068278 3300013105 Bacteria 3819
264 Ga0157369_10086378 3300013105 Bacteria 3350
265 Ga0157369_10115095 3300013105 Unclassified 2856
266 Ga0157374_10000316 3300013296 Bacteria 44946
267 Ga0157374_10000330 3300013296 Bacteria 43615
268 Ga0157374_10000533 3300013296 Bacteria 34093
269 Ga0157374_10149465 3300013296 Bacteria 2270
270 Ga0157374_10160261 3300013296 Unclassified 2191
271 Ga0157374_10424552 3300013296 Bacteria 1328
272 Ga0157378_10000085 3300013297 Bacteria 87651
273 Ga0157378_10000182 3300013297 Bacteria 60024
274 Ga0157378_10005797 3300013297 Bacteria 10826
275 Ga0157378_10066033 3300013297 Unclassified 3239
276 Ga0157378_10072840 3300013297 Unclassified 3088
277 Ga0163162_10017771 3300013306 Bacteria 6958
278 Ga0163162_10036292 3300013306 Bacteria 4912
279 Ga0163162_10105540 3300013306 Bacteria 2912
280 Ga0157372_10000620 3300013307 Bacteria 38778
281 Ga0157372_10001563 3300013307 Bacteria 24933
282 Ga0157372_10001829 3300013307 Bacteria 23049
283 Ga0157372_10002374 3300013307 Bacteria 20377
284 Ga0157372_10005653 3300013307 Bacteria 13296
285 Ga0157372_10011673 3300013307 Bacteria 9352
286 Ga0157372_10017860 3300013307 Bacteria 7621
287 Ga0157372_10023041 3300013307 Bacteria 6748
288 Ga0157372_10049523 3300013307 Bacteria 4671
289 Ga0157372_10078687 3300013307 Unclassified 3726
290 Ga0157372_10097993 3300013307 Unclassified 3344
291 Ga0157372_10258064 3300013307 Bacteria 2024
292 Ga0157375_10042971 3300013308 Bacteria 4379
293 Ga0163163_10010447 3300014325 Bacteria 8353
294 Ga0163163_10026114 3300014325 Bacteria 5577
295 Ga0163163_10047287 3300014325 Bacteria 4229
296 Ga0163163_10094601 3300014325 Bacteria 3006
297 Ga0157380_10036781 3300014326 Bacteria 3790
298 Ga0157380_10225129 3300014326 Bacteria 1681
299 Ga0182008_10066014 3300014497 Unclassified 1780
300 Ga0157377_10007628 3300014745 Bacteria 5236
301 Ga0157379_10020914 3300014968 Bacteria 5790
302 Ga0157379_10030429 3300014968 Bacteria 4806
303 Ga0157379_10051544 3300014968 Bacteria 3676
304 Ga0157376_10016984 3300014969 Bacteria 5540
305 Ga0157376_10042810 3300014969 Unclassified 3713
306 Ga0157376_10059850 3300014969 Unclassified 3195
307 Ga0157376_10144172 3300014969 Bacteria 2140
308 Ga0157376_10185998 3300014969 Bacteria 1902
309 Ga0157376_10225855 3300014969 Bacteria 1737
310 Ga0157376_10243426 3300014969 Bacteria 1676
311 Ga0182007_10005271 3300015262 Bacteria 5706
312 Ga0182005_1011141 3300015265 Unclassified 2570
313 Ga0224572_1000992 3300024225 Bacteria 3916
314 Ga0228598_1000565 3300024227 Bacteria 7747
315 Ga0228598_1022235 3300024227 Bacteria 1247
316 Ga0207656_10001883 3300025321 Bacteria 6984
317 Ga0207656_10118627 3300025321 Unclassified 1229
318 Ga0207682_10030508 3300025893 Unclassified 2160
319 Ga0207692_10015705 3300025898 Unclassified 3339
320 Ga0207642_10012475 3300025899 Bacteria 3069
321 Ga0207642_10122409 3300025899 Unclassified 1344
322 Ga0207710_10007071 3300025900 Bacteria 4763
323 Ga0207688_10050967 3300025901 Bacteria 2318
324 Ga0207647_10006395 3300025904 Bacteria 8567
325 Ga0207699_10023687 3300025906 Bacteria 3344
326 Ga0207699_10061456 3300025906 Bacteria 2260
327 Ga0207645_10000939 3300025907 Bacteria 24219
328 Ga0207645_10083009 3300025907 Bacteria 2054
329 Ga0207643_10000795 3300025908 Bacteria 19216
330 Ga0207684_10002498 3300025910 Bacteria 18498
331 Ga0207684_10171918 3300025910 Unclassified 1868
332 Ga0207654_10002282 3300025911 Bacteria 9829
333 Ga0207654_10009508 3300025911 Bacteria 4938
334 Ga0207654_10049764 3300025911 Bacteria 2405
335 Ga0207707_10000739 3300025912 Bacteria 32307
336 Ga0207695_10011014 3300025913 Bacteria 10987
337 Ga0207695_10056534 3300025913 Bacteria 4082
338 Ga0207695_10094017 3300025913 Unclassified 3006
339 Ga0207671_10150548 3300025914 Bacteria 1797
340 Ga0207693_10002268 3300025915 Bacteria 16728
341 Ga0207693_10005312 3300025915 Bacteria 10761
342 Ga0207693_10008009 3300025915 Bacteria 8677
343 Ga0207693_10172386 3300025915 Bacteria 1703
344 Ga0207663_10001322 3300025916 Bacteria 11454
345 Ga0207663_10079913 3300025916 Bacteria 2137
346 Ga0207663_10129276 3300025916 Unclassified 1743
347 Ga0207660_10060772 3300025917 Unclassified 2718
348 Ga0207662_10002843 3300025918 Bacteria 8753
349 Ga0207657_10000766 3300025919 Bacteria 34045
350 Ga0207657_10003847 3300025919 Bacteria 15937
351 Ga0207657_10013260 3300025919 Bacteria 8086
352 Ga0207649_10000355 3300025920 Bacteria 34488
353 Ga0207649_10024891 3300025920 Bacteria 3484
354 Ga0207649_10034300 3300025920 Bacteria 3039
355 Ga0207652_10057423 3300025921 Unclassified 3351
356 Ga0207652_10060235 3300025921 Unclassified 3275
357 Ga0207652_10071716 3300025921 Bacteria 3010
358 Ga0207646_10000073 3300025922 Bacteria 140267
359 Ga0207646_10200030 3300025922 Bacteria 1805
360 Ga0207694_10001172 3300025924 Bacteria 22716
361 Ga0207694_10061810 3300025924 Bacteria 2915
362 Ga0207694_10124172 3300025924 Bacteria 2063
363 Ga0207694_10196222 3300025924 Unclassified 1641
364 Ga0207650_10000406 3300025925 Bacteria 38605
365 Ga0207650_10027319 3300025925 Bacteria 4084
366 Ga0207659_10353304 3300025926 Unclassified 1220
367 Ga0207687_10102123 3300025927 Unclassified 2112
368 Ga0207687_10381801 3300025927 Unclassified 1154
369 Ga0207700_10000187 3300025928 Bacteria 37186
370 Ga0207700_10042508 3300025928 Unclassified 3332
371 Ga0207700_10158894 3300025928 Bacteria 1875
372 Ga0207700_10237599 3300025928 Unclassified 1552
373 Ga0207664_10015343 3300025929 Bacteria 5555
374 Ga0207664_10042950 3300025929 Unclassified 3533
375 Ga0207664_10091354 3300025929 Bacteria 2497
376 Ga0207664_10142599 3300025929 Unclassified 2028
377 Ga0207664_10442053 3300025929 Bacteria 1160
378 Ga0207644_10110364 3300025931 Unclassified 2079
379 Ga0207690_10071256 3300025932 Unclassified 2396
380 Ga0207706_10000956 3300025933 Bacteria 29545
381 Ga0207706_10001504 3300025933 Bacteria 23141
382 Ga0207686_10009939 3300025934 Bacteria 5171
383 Ga0207686_10021289 3300025934 Unclassified 3719
384 Ga0207709_10065376 3300025935 Bacteria 2287
385 Ga0207670_10044980 3300025936 Bacteria 2924
386 Ga0207670_10453451 3300025936 Bacteria 1034
387 Ga0207669_10499886 3300025937 Bacteria 973
388 Ga0207704_10013191 3300025938 Bacteria 4128
389 Ga0207704_10016214 3300025938 Bacteria 3823
390 Ga0207665_10002774 3300025939 Bacteria 11737
391 Ga0207665_10043706 3300025939 Unclassified 2996
392 Ga0207665_10098548 3300025939 Unclassified 2037
393 Ga0207665_10102139 3300025939 Bacteria 2003
394 Ga0207665_10416937 3300025939 Bacteria 1025
395 Ga0207691_10043892 3300025940 Bacteria 4118
396 Ga0207711_10019121 3300025941 Bacteria 5700
397 Ga0207711_10039448 3300025941 Bacteria 4017
398 Ga0207711_10046820 3300025941 Bacteria 3696
399 Ga0207711_10127680 3300025941 Unclassified 2276
400 Ga0207711_10334943 3300025941 Unclassified 1400
401 Ga0207689_10000442 3300025942 Bacteria 38930
402 Ga0207689_10051172 3300025942 Bacteria 3405
403 Ga0207689_10130624 3300025942 Bacteria 2067
404 Ga0207661_10000913 3300025944 Bacteria 19396
405 Ga0207661_10018075 3300025944 Bacteria 5234
406 Ga0207661_10048392 3300025944 Unclassified 3379
407 Ga0207661_10060327 3300025944 Bacteria 3060
408 Ga0207661_10091710 3300025944 Bacteria 2532
409 Ga0207679_10000065 3300025945 Bacteria 97825
410 Ga0207679_10004660 3300025945 Bacteria 8540
411 Ga0207667_10000785 3300025949 Bacteria 41249
412 Ga0207667_10003707 3300025949 Bacteria 18846
413 Ga0207667_10014399 3300025949 Bacteria 9021
414 Ga0207667_10172812 3300025949 Bacteria 2221
415 Ga0207651_10255922 3300025960 Unclassified 1435
416 Ga0207712_10125623 3300025961 Bacteria 1947
417 Ga0207640_10004082 3300025981 Bacteria 7892
418 Ga0207640_10009339 3300025981 Bacteria 5487
419 Ga0207658_10012223 3300025986 Bacteria 5859
420 Ga0207658_10099700 3300025986 Bacteria 2273
421 Ga0207658_10124673 3300025986 Bacteria 2059
422 Ga0207677_10008337 3300026023 Bacteria 5783
423 Ga0207677_10161431 3300026023 Unclassified 1742
424 Ga0207703_10015558 3300026035 Bacteria 5932
425 Ga0207703_10036111 3300026035 Bacteria 3931
426 Ga0207703_10048937 3300026035 Unclassified 3415
427 Ga0207639_10025088 3300026041 Bacteria 4321
428 Ga0207639_10029019 3300026041 Unclassified 4046
429 Ga0207639_10086349 3300026041 Unclassified 2498
430 Ga0207639_10167658 3300026041 Bacteria 1857
431 Ga0207678_10000887 3300026067 Bacteria 27526
432 Ga0207678_10006307 3300026067 Bacteria 10532
433 Ga0207678_10089706 3300026067 Unclassified 2628
434 Ga0207702_10000089 3300026078 Bacteria 105440
435 Ga0207702_10000759 3300026078 Bacteria 34304
436 Ga0207702_10025099 3300026078 Unclassified 4944
437 Ga0207702_10129811 3300026078 Bacteria 2266
438 Ga0207641_10001133 3300026088 Bacteria 26765
439 Ga0207641_10119730 3300026088 Bacteria 2347
440 Ga0207641_10389959 3300026088 Bacteria 1336
441 Ga0207641_10630543 3300026088 Bacteria 1051
442 Ga0207648_10000946 3300026089 Bacteria 32833
443 Ga0207648_10023453 3300026089 Bacteria 5527
444 Ga0207648_10293689 3300026089 Bacteria 1456
445 Ga0207676_10001385 3300026095 Bacteria 18052
446 Ga0207676_10003547 3300026095 Bacteria 11036
447 Ga0207676_10201208 3300026095 Unclassified 1760
448 Ga0207674_10000309 3300026116 Bacteria 62067
449 Ga0207674_10000404 3300026116 Bacteria 56025
450 Ga0207674_10005897 3300026116 Bacteria 14522
451 Ga0207674_10014181 3300026116 Bacteria 8809
452 Ga0207674_10021037 3300026116 Bacteria 7036
453 Ga0207674_10365815 3300026116 Bacteria 1394
454 Ga0207675_100054398 3300026118 Bacteria 3733
455 Ga0207683_10000706 3300026121 Bacteria 30425
456 Ga0207698_10005557 3300026142 Bacteria 7793
457 Ga0207698_10009603 3300026142 Bacteria 6178
458 Ga0209588_1042838 3300027671 Bacteria 1462
459 Ga0268266_10070776 3300028379 Unclassified 3022
460 Ga0268266_10166188 3300028379 Bacteria 1999
461 Ga0268265_10009573 3300028380 Bacteria 6543
462 Ga0268265_10218350 3300028380 Bacteria 1666
463 Ga0268264_10041451 3300028381 Unclassified 3808
464 Ga0268264_10336211 3300028381 Unclassified 1433
465 Ga0265338_10133908 3300028800 Bacteria 1952
466 Ga0265762_1000240 3300030760 Bacteria 8904
467 Ga0265762_1002887 3300030760 Unclassified 3068
468 Ga0265762_1006438 3300030760 Bacteria 2100
469 Ga0265760_10002759 3300031090 Bacteria 5138
470 Ga0265760_10005797 3300031090 Unclassified 3532
471 Ga0265760_10014014 3300031090 Unclassified 2294
472 Ga0265316_10003399 3300031344 Bacteria 16107
473 Ga0307516_10004733 3300031730 Bacteria 16636
474 Ga0373926_0005749 3300035083 Bacteria 4096
475 Ga0373928_0022612 3300035084 Unclassified 1335
476 Ga0373923_0029088 3300035111 Bacteria 2214
477 Ga0373932_0024667 3300035112 Unclassified 1621
478 Ga0373936_0019979 3300035113 Bacteria 2599
479 Ga0373939_0120403 3300035114 Bacteria 925
480 Ga0373945_0010604 3300035116 Bacteria 3037
481 Ga0373960_0042425 3300035121 Unclassified 1321
482 Ga0373943_0023730 3300035170 Bacteria 2854
483 Ga0373943_0024399 3300035170 Bacteria 2819
484 Ga0373961_0053532 3300035241 Bacteria 1205
485 Ga0373931_0030978 3300035691 Bacteria 2757
486 Ga0373931_0073252 3300035691 Unclassified 1874
487 Ga0373931_0193507 3300035691 Bacteria 1211
488 Ga0373935_0004009 3300035692 Bacteria 8603
489 Ga0373927_0008808 3300035695 Bacteria 6781
490 Ga0373927_0014218 3300035695 Bacteria 5278
491 Ga0373927_0200545 3300035695 Bacteria 1310
492 Ga0373927_0215289 3300035695 Bacteria 1262
493 Ga0373933_0172101 3300035724 Unclassified 1378
494 Ga0373947_0027953 3300035725 Bacteria 3303
495 Ga0373947_0108268 3300035725 Bacteria 1753
496 Ga0373937_0013791 3300036401 Bacteria 7121
497 Ga0373937_0036835 3300036401 Bacteria 4457
498 Ga0373937_0283726 3300036401 Bacteria 1564
499 Ga0373937_0389752 3300036401 Unclassified 1321
500 Ga0372808_035101 3300036459 Bacteria 719
501 Ga0373925_0050279 3300037068 Bacteria 3109
502 Ga0373925_0104268 3300037068 Unclassified 2183
503 Ga0373925_0126207 3300037068 Bacteria 1991
504 Ga0436365_0003450 3300039437 Bacteria 1469
505 Ga0436365_1816396 3300039437 Bacteria 1842
506 Ga0436363_0980743 3300039450 Bacteria 3986
507 Ga0436362_0734751 3300039453 Bacteria 2216
508 Ga0451577_0002324 3300042876 Bacteria 22929
509 Ga0466966_0170182 3300044684 Bacteria 1324
510 Ga0466963_0011564 3300044694 Bacteria 5374
511 Ga0466963_0295006 3300044694 Unclassified 1140
512 Ga0453684_0000480 3300044712 Bacteria 158630
513 Ga0466959_0127765 3300045049 Bacteria 1803
514 Ga0451576_0002875 3300045051 Bacteria 24636
515 Ga0451576_0172590 3300045051 Bacteria 2257
516 Ga0451576_0210014 3300045051 Unclassified 2033
517 Ga0451576_0846838 3300045051 Bacteria 960
518 Ga0495629_0220746 3300046459 Unclassified 1307
519 Ga0495651_0213202 3300046462 Bacteria 1342
520 Ga0495580_0001336 3300046472 Bacteria 21734
521 Ga0495580_0002375 3300046472 Bacteria 16435
522 Ga0495580_0004333 3300046472 Bacteria 11913
523 Ga0495580_0148335 3300046472 Bacteria 1625
524 Ga0495582_0000143 3300046473 Bacteria 38449
525 Ga0495582_0002689 3300046473 Bacteria 9924
526 Ga0495662_0061262 3300046476 Unclassified 1818
527 Ga0495630_0068160 3300046517 Bacteria 2675
528 Ga0495630_0351262 3300046517 Bacteria 1128
529 Ga0495666_0064464 3300046526 Unclassified 1749
530 Ga0495665_0001194 3300046531 Bacteria 13831
531 Ga0495586_0101930 3300046535 Bacteria 1593
532 Ga0495599_0206179 3300046678 Bacteria 1207
533 Ga0495658_0043033 3300046683 Unclassified 2524
534 Ga0495658_0052814 3300046683 Unclassified 2306
535 Ga0495674_0003157 3300047319 Bacteria 16005
536 Ga0495674_0075853 3300047319 Bacteria 2893
537 Ga0495602_0052012 3300048088 Bacteria 3642
538 Ga0495602_0228718 3300048088 Bacteria 1399
539 Ga0495602_0439006 3300048088 Unclassified 923
540 Ga0496100_0031264 3300048903 Bacteria 3308
541 Ga0496100_0062293 3300048903 Unclassified 2461
542 Ga0496101_0105989 3300048904 Bacteria 2110
543 Ga0496101_0172018 3300048904 Unclassified 1665
544 Ga0496102_0054436 3300048905 Bacteria 3648
545 Ga0496102_0085823 3300048905 Unclassified 2907
546 Ga0496102_0647487 3300048905 Unclassified 980
547 Ga0496104_0045248 3300048907 Bacteria 4138
548 Ga0496104_0064649 3300048907 Bacteria 3470
549 Ga0496104_0130481 3300048907 Unclassified 2414
550 Ga0496104_0517574 3300048907 Unclassified 1104
551 Ga0496104_0618045 3300048907 Unclassified 993
552 Ga0496104_0627574 3300048907 Bacteria 984
553 Ga0496105_0264291 3300048908 Unclassified 1391
554 Ga0496105_0463983 3300048908 Bacteria 998
555 Ga0496106_0058517 3300048909 Bacteria 2918
556 Ga0496108_0000459 3300048911 Bacteria 32612
557 Ga0496108_0770521 3300048911 Bacteria 831
558 Ga0496109_0000336 3300048912 Bacteria 43748
559 Ga0496109_0416091 3300048912 Unclassified 1270
560 Ga0496111_0006201 3300048914 Bacteria 7745
561 Ga0496111_0008420 3300048914 Bacteria 6825
562 Ga0496112_0000176 3300048915 Bacteria 40747
563 Ga0496112_0007175 3300048915 Bacteria 9869
564 Ga0496112_0008578 3300048915 Bacteria 9161
565 Ga0496112_0023044 3300048915 Bacteria 5942
566 Ga0496112_0142402 3300048915 Bacteria 2367
567 Ga0496112_0209997 3300048915 Bacteria 1904
568 Ga0496114_0018112 3300048917 Bacteria 5691
569 Ga0496114_0021626 3300048917 Bacteria 5235
570 Ga0496115_0028171 3300048918 Bacteria 4401
571 Ga0496115_0100591 3300048918 Bacteria 2370
572 Ga0496115_0257432 3300048918 Unclassified 1436
573 Ga0496115_0261183 3300048918 Unclassified 1424
574 nmdc:mga05p37_331042_c1 3300050507 Bacteria 1799
575 nmdc:mga0n895_19907_c1 3300050512 Bacteria 6247
576 nmdc:mga0n895_34219_c1 3300050512 Bacteria 4889
577 nmdc:mga0rr50_3575_c1 3300050513 Bacteria 8979
578 nmdc:mga0rr50_542221_c1 3300050513 Bacteria 990
579 nmdc:mga0rr50_82002_c1 3300050513 Bacteria 2490
580 nmdc:mga08x19_19497_c1 3300050514 Bacteria 4163
581 Ga0495601_0021865 3300053077 Unclassified 3922
582 Ga0501084_0113188 3300054114 Bacteria 2281
583 Ga0070683_100018057
584 LJNas_1000441
585 JGI24737J22298_10014354
586 JGI24034J26672_10004068
587 JGI24751J29686_10003177
588 Ga0065715_10215109
589 Ga0070676_10110164
590 Ga0070683_100007284
591 Ga0070683_100056008
592 Ga0070690_100023350
593 Ga0070670_100010385
594 Ga0070670_100012675
595 Ga0070670_100074948
596 Ga0070677_10042194
597 Ga0068869_100011893
598 Ga0068869_100019443
599 Ga0068869_100049290
600 Ga0070680_100168205
601 Ga0070680_100232161
602 Ga0070682_100007498
603 Ga0070682_100043906
604 Ga0068868_100028354
605 Ga0068868_100030361
606 Ga0068868_100068938
607 Ga0070660_100018382
608 Ga0070660_100031261
609 Ga0070689_100020651
610 Ga0070689_100043878
611 Ga0070689_100566093
612 Ga0070691_10028683
613 Ga0070687_100027821
614 Ga0070687_100091707
615 Ga0070661_100003844
616 Ga0070661_100015105
617 Ga0070661_100021727
618 Ga0070668_100031445
619 Ga0070668_100040718
620 Ga0070669_100012053
621 Ga0070675_100071721
622 Ga0070671_100147683
623 Ga0070671_100726156
624 Ga0070674_100008898
625 Ga0070673_100015460
626 Ga0070673_100290657
627 Ga0070688_100006877
628 Ga0070659_100032396
629 Ga0070659_100037597
630 Ga0070667_100013832
631 Ga0070667_100070406
632 Ga0070709_10001213
633 Ga0070709_10025866
634 Ga0070709_10047333
635 Ga0070714_100001161
636 Ga0070714_100008314
637 Ga0070714_100086123
638 Ga0070714_100154419
639 Ga0070714_100294088
640 Ga0070714_100630213
641 Ga0070713_100000421
642 Ga0070713_100019519
643 Ga0070713_100027060
644 Ga0070713_100049463
645 Ga0070713_100262758
646 Ga0070710_10005462
647 Ga0070710_10010310
648 Ga0070711_100006171
649 Ga0070711_100079715
650 Ga0070711_100272091
651 Ga0070700_100052107
652 Ga0070694_100122181
653 Ga0070708_100001001
654 Ga0070708_100187596
655 Ga0070663_100008558
656 Ga0070663_100344859
657 Ga0070662_100002659
658 Ga0070662_100044713
659 Ga0070681_10000055
660 Ga0070681_10061238
661 Ga0068867_100079525
662 Ga0070685_10000730
663 Ga0070685_10248538
664 Ga0070706_100001647
665 Ga0070706_100028367
666 Ga0070707_100001854
667 Ga0070707_100038431
668 Ga0070698_100000411
669 Ga0070699_100000032
670 Ga0070679_100047079
671 Ga0070679_100081560
672 Ga0070679_100200229
673 Ga0070684_100007024
674 Ga0070684_100021109
675 Ga0070684_100054550
676 Ga0070684_100311219
677 Ga0070697_100000138
678 Ga0070697_100000166
679 Ga0070697_100003351
680 Ga0068853_100025667
681 Ga0068853_100045590
682 Ga0068853_100061155
683 Ga0068853_100066764
684 Ga0068853_100115978
685 Ga0070672_100006124
686 Ga0070686_100029359
687 Ga0070686_100044425
688 Ga0070693_100022831
689 Ga0070693_100073933
690 Ga0070693_100149643
691 Ga0070665_100016654
692 Ga0070704_100377144
693 Ga0068855_100002871
694 Ga0068855_100005054
695 Ga0068855_100017861
696 Ga0068855_100039167
697 Ga0068855_100066016
698 Ga0068855_100479428
699 Ga0068855_100485448
700 Ga0070664_100001796
701 Ga0070664_100019845
702 Ga0070664_100103337
703 Ga0070664_100127136
704 Ga0068857_100000041
705 Ga0068857_100006556
706 Ga0068857_100019541
707 Ga0068857_100068970
708 Ga0068857_100141350
709 Ga0068857_100580209
710 Ga0068854_100001461
711 Ga0068854_100005254
712 Ga0068854_100009154
713 Ga0068854_100038080
714 Ga0068856_100000355
715 Ga0068856_100001245
716 Ga0068856_100001397
717 Ga0068856_100003871
718 Ga0068856_100019308
719 Ga0068856_100023581
720 Ga0068856_100026392
721 Ga0068856_100205403
722 Ga0068856_100250571
723 Ga0070702_100013989
724 Ga0068852_100034832
725 Ga0068852_100049809
726 Ga0068852_100263754
727 Ga0068859_100000959
728 Ga0068859_100032500
729 Ga0068859_100032862
730 Ga0068864_100020486
731 Ga0068864_100025428
732 Ga0068864_100060038
733 Ga0068864_100200870
734 Ga0068866_10002844
735 Ga0068861_100074611
736 Ga0068851_10003443
737 Ga0068851_10056271
738 Ga0068870_10009491
739 Ga0068870_10158394
740 Ga0068863_100020580
741 Ga0068863_100051896
742 Ga0068863_100105843
743 Ga0068858_100025619
744 Ga0068858_100030244
745 Ga0068860_100105772
746 Ga0068860_100368117
747 Ga0068862_100024636
748 Ga0068862_100058121
749 Ga0070717_10000618
750 Ga0070717_10003199
751 Ga0070717_10027043
752 Ga0070717_10048229
753 Ga0070717_10288259
754 Ga0070715_10031475
755 Ga0070715_10058845
756 Ga0070716_100001991
757 Ga0070716_100126202
758 Ga0070716_100184340
759 Ga0070716_100289466
760 Ga0070716_100434928
761 Ga0070712_100001480
762 Ga0070712_100004747
763 Ga0070712_100006613
764 Ga0097621_100000533
765 Ga0097621_100000581
766 Ga0097621_100023399
767 Ga0097621_100037650
768 Ga0097621_100356238
769 Ga0097621_100626134
770 Ga0068871_100000221
771 Ga0068871_100000664
772 Ga0068871_100070334
773 Ga0068871_100091544
774 Ga0068871_100516007
775 Ga0075434_100017276
776 Ga0075434_100044621
777 Ga0075434_100439791
778 Ga0068865_100018958
779 Ga0068865_100262258
780 Ga0075436_100008378
781 Ga0097620_100000959
782 Ga0097620_100032499
783 Ga0097620_100032861
784 Ga0075435_100005304
785 Ga0075435_100079996
786 Ga0099794_10007866
787 Ga0099795_10009077
788 Ga0105240_10032699
789 Ga0105240_10081651
790 Ga0105240_10122041
791 Ga0105240_10457342
792 Ga0105245_10010608
793 Ga0105245_10363168
794 Ga0105247_10005783
795 Ga0105247_10103529
796 Ga0114129_10027887
797 Ga0114129_10139441
798 Ga0105243_10034924
799 Ga0105241_10005728
800 Ga0105241_10006237
801 Ga0105241_10006483
802 Ga0105241_10018875
803 Ga0105241_10027658
804 Ga0105241_10059392
805 Ga0105242_10007955
806 Ga0105242_10075732
807 Ga0105242_10158237
808 Ga0105248_10015991
809 Ga0105248_10024446
810 Ga0105248_10060019
811 Ga0105248_10085617
812 Ga0105248_10244030
813 Ga0105248_10369778
814 Ga0105248_10481333
815 Ga0105237_10090451
816 Ga0105237_10482633
817 Ga0105238_10000533
818 Ga0105238_10040743
819 Ga0105238_10082056
820 Ga0105238_10098520
821 Ga0105238_10102996
822 Ga0105238_10176164
823 Ga0105238_10251989
824 Ga0105249_10003055
825 Ga0105249_10011640
826 Ga0105239_10021576
827 Ga0105239_10081075
828 Ga0105239_10627861
829 Ga0105246_10005741
830 Ga0105246_10115243
831 Ga0157373_10001055
832 Ga0157373_10006123
833 Ga0157371_10005072
834 Ga0157371_10009784
835 Ga0157371_10019817
836 Ga0157371_10044229
837 Ga0157371_10131532
838 Ga0157371_10158244
839 Ga0157370_10050679
840 Ga0157369_10000170
841 Ga0157369_10025031
842 Ga0157369_10026627
843 Ga0157369_10029190
844 Ga0157369_10063569
845 Ga0157369_10068278
846 Ga0157369_10086378
847 Ga0157369_10115095
848 Ga0157374_10000316
849 Ga0157374_10000330
850 Ga0157374_10000533
851 Ga0157374_10149465
852 Ga0157374_10160261
853 Ga0157374_10424552
854 Ga0157378_10000085
855 Ga0157378_10000182
856 Ga0157378_10005797
857 Ga0157378_10066033
858 Ga0157378_10072840
859 Ga0163162_10017771
860 Ga0163162_10036292
861 Ga0163162_10105540
862 Ga0157372_10000620
863 Ga0157372_10001563
864 Ga0157372_10001829
865 Ga0157372_10002374
866 Ga0157372_10005653
867 Ga0157372_10011673
868 Ga0157372_10017860
869 Ga0157372_10023041
870 Ga0157372_10049523
871 Ga0157372_10078687
872 Ga0157372_10097993
873 Ga0157372_10258064
874 Ga0157375_10042971
875 Ga0163163_10010447
876 Ga0163163_10026114
877 Ga0163163_10047287
878 Ga0163163_10094601
879 Ga0157380_10036781
880 Ga0157380_10225129
881 Ga0182008_10066014
882 Ga0157377_10007628
883 Ga0157379_10020914
884 Ga0157379_10030429
885 Ga0157379_10051544
886 Ga0157376_10016984
887 Ga0157376_10042810
888 Ga0157376_10059850
889 Ga0157376_10144172
890 Ga0157376_10185998
891 Ga0157376_10225855
892 Ga0157376_10243426
893 Ga0182007_10005271
894 Ga0182005_1011141
895 Ga0224572_1000992
896 Ga0228598_1000565
897 Ga0228598_1022235
898 Ga0207656_10001883
899 Ga0207656_10118627
900 Ga0207682_10030508
901 Ga0207692_10015705
902 Ga0207642_10012475
903 Ga0207642_10122409
904 Ga0207710_10007071
905 Ga0207688_10050967
906 Ga0207647_10006395
907 Ga0207699_10023687
908 Ga0207699_10061456
909 Ga0207645_10000939
910 Ga0207645_10083009
911 Ga0207643_10000795
912 Ga0207684_10002498
913 Ga0207684_10171918
914 Ga0207654_10002282
915 Ga0207654_10009508
916 Ga0207654_10049764
917 Ga0207707_10000739
918 Ga0207695_10011014
919 Ga0207695_10056534
920 Ga0207695_10094017
921 Ga0207671_10150548
922 Ga0207693_10002268
923 Ga0207693_10005312
924 Ga0207693_10008009
925 Ga0207693_10172386
926 Ga0207663_10001322
927 Ga0207663_10079913
928 Ga0207663_10129276
929 Ga0207660_10060772
930 Ga0207662_10002843
931 Ga0207657_10000766
932 Ga0207657_10003847
933 Ga0207657_10013260
934 Ga0207649_10000355
935 Ga0207649_10024891
936 Ga0207649_10034300
937 Ga0207652_10057423
938 Ga0207652_10060235
939 Ga0207652_10071716
940 Ga0207646_10000073
941 Ga0207646_10200030
942 Ga0207694_10001172
943 Ga0207694_10061810
944 Ga0207694_10124172
945 Ga0207694_10196222
946 Ga0207650_10000406
947 Ga0207650_10027319
948 Ga0207659_10353304
949 Ga0207687_10102123
950 Ga0207687_10381801
951 Ga0207700_10000187
952 Ga0207700_10042508
953 Ga0207700_10158894
954 Ga0207700_10237599
955 Ga0207664_10015343
956 Ga0207664_10042950
957 Ga0207664_10091354
958 Ga0207664_10142599
959 Ga0207664_10442053
960 Ga0207644_10110364
961 Ga0207690_10071256
962 Ga0207706_10000956
963 Ga0207706_10001504
964 Ga0207686_10009939
965 Ga0207686_10021289
966 Ga0207709_10065376
967 Ga0207670_10044980
968 Ga0207670_10453451
969 Ga0207669_10499886
970 Ga0207704_10013191
971 Ga0207704_10016214
972 Ga0207665_10002774
973 Ga0207665_10043706
974 Ga0207665_10098548
975 Ga0207665_10102139
976 Ga0207665_10416937
977 Ga0207691_10043892
978 Ga0207711_10019121
979 Ga0207711_10039448
980 Ga0207711_10046820
981 Ga0207711_10127680
982 Ga0207711_10334943
983 Ga0207689_10000442
984 Ga0207689_10051172
985 Ga0207689_10130624
986 Ga0207661_10000913
987 Ga0207661_10018075
988 Ga0207661_10048392
989 Ga0207661_10060327
990 Ga0207661_10091710
991 Ga0207679_10000065
992 Ga0207679_10004660
993 Ga0207667_10000785
994 Ga0207667_10003707
995 Ga0207667_10014399
996 Ga0207667_10172812
997 Ga0207651_10255922
998 Ga0207712_10125623
999 Ga0207640_10004082
1000 Ga0207640_10009339
1001 Ga0207658_10012223
1002 Ga0207658_10099700
1003 Ga0207658_10124673
1004 Ga0207677_10008337
1005 Ga0207677_10161431
1006 Ga0207703_10015558
1007 Ga0207703_10036111
1008 Ga0207703_10048937
1009 Ga0207639_10025088
1010 Ga0207639_10029019
1011 Ga0207639_10086349
1012 Ga0207639_10167658
1013 Ga0207678_10000887
1014 Ga0207678_10006307
1015 Ga0207678_10089706
1016 Ga0207702_10000089
1017 Ga0207702_10000759
1018 Ga0207702_10025099
1019 Ga0207702_10129811
1020 Ga0207641_10001133
1021 Ga0207641_10119730
1022 Ga0207641_10389959
1023 Ga0207641_10630543
1024 Ga0207648_10000946
1025 Ga0207648_10023453
1026 Ga0207648_10293689
1027 Ga0207676_10001385
1028 Ga0207676_10003547
1029 Ga0207676_10201208
1030 Ga0207674_10000309
1031 Ga0207674_10000404
1032 Ga0207674_10005897
1033 Ga0207674_10014181
1034 Ga0207674_10021037
1035 Ga0207674_10365815
1036 Ga0207675_100054398
1037 Ga0207683_10000706
1038 Ga0207698_10005557
1039 Ga0207698_10009603
1040 Ga0209588_1042838
1041 Ga0268266_10070776
1042 Ga0268266_10166188
1043 Ga0268265_10009573
1044 Ga0268265_10218350
1045 Ga0268264_10041451
1046 Ga0268264_10336211
1047 Ga0265338_10133908
1048 Ga0265762_1000240
1049 Ga0265762_1002887
1050 Ga0265762_1006438
1051 Ga0265760_10002759
1052 Ga0265760_10005797
1053 Ga0265760_10014014
1054 Ga0265316_10003399
1055 Ga0307516_10004733
1056 Ga0373926_0005749
1057 Ga0373928_0022612
1058 Ga0373923_0029088
1059 Ga0373932_0024667
1060 Ga0373936_0019979
1061 Ga0373939_0120403
1062 Ga0373945_0010604
1063 Ga0373960_0042425
1064 Ga0373943_0023730
1065 Ga0373943_0024399
1066 Ga0373961_0053532
1067 Ga0373931_0030978
1068 Ga0373931_0073252
1069 Ga0373931_0193507
1070 Ga0373935_0004009
1071 Ga0373927_0008808
1072 Ga0373927_0014218
1073 Ga0373927_0200545
1074 Ga0373927_0215289
1075 Ga0373933_0172101
1076 Ga0373947_0027953
1077 Ga0373947_0108268
1078 Ga0373937_0013791
1079 Ga0373937_0036835
1080 Ga0373937_0283726
1081 Ga0373937_0389752
1082 Ga0372808_035101
1083 Ga0373925_0050279
1084 Ga0373925_0104268
1085 Ga0373925_0126207
1086 Ga0436365_0003450
1087 Ga0436365_1816396
1088 Ga0436363_0980743
1089 Ga0436362_0734751
1090 Ga0451577_0002324
1091 Ga0466966_0170182
1092 Ga0466963_0011564
1093 Ga0466963_0295006
1094 Ga0453684_0000480
1095 Ga0466959_0127765
1096 Ga0451576_0002875
1097 Ga0451576_0172590
1098 Ga0451576_0210014
1099 Ga0451576_0846838
1100 Ga0495629_0220746
1101 Ga0495651_0213202
1102 Ga0495580_0001336
1103 Ga0495580_0002375
1104 Ga0495580_0004333
1105 Ga0495580_0148335
1106 Ga0495582_0000143
1107 Ga0495582_0002689
1108 Ga0495662_0061262
1109 Ga0495630_0068160
1110 Ga0495630_0351262
1111 Ga0495666_0064464
1112 Ga0495665_0001194
1113 Ga0495586_0101930
1114 Ga0495599_0206179
1115 Ga0495658_0043033
1116 Ga0495658_0052814
1117 Ga0495674_0003157
1118 Ga0495674_0075853
1119 Ga0495602_0052012
1120 Ga0495602_0228718
1121 Ga0495602_0439006
1122 Ga0496100_0031264
1123 Ga0496100_0062293
1124 Ga0496101_0105989
1125 Ga0496101_0172018
1126 Ga0496102_0054436
1127 Ga0496102_0085823
1128 Ga0496102_0647487
1129 Ga0496104_0045248
1130 Ga0496104_0064649
1131 Ga0496104_0130481
1132 Ga0496104_0517574
1133 Ga0496104_0618045
1134 Ga0496104_0627574
1135 Ga0496105_0264291
1136 Ga0496105_0463983
1137 Ga0496106_0058517
1138 Ga0496108_0000459
1139 Ga0496108_0770521
1140 Ga0496109_0000336
1141 Ga0496109_0416091
1142 Ga0496111_0006201
1143 Ga0496111_0008420
1144 Ga0496112_0000176
1145 Ga0496112_0007175
1146 Ga0496112_0008578
1147 Ga0496112_0023044
1148 Ga0496112_0142402
1149 Ga0496112_0209997
1150 Ga0496114_0018112
1151 Ga0496114_0021626
1152 Ga0496115_0028171
1153 Ga0496115_0100591
1154 Ga0496115_0257432
1155 Ga0496115_0261183
1156 nmdc:mga05p37_331042_c1
1157 nmdc:mga0n895_19907_c1
1158 nmdc:mga0n895_34219_c1
1159 nmdc:mga0rr50_3575_c1
1160 nmdc:mga0rr50_542221_c1
1161 nmdc:mga0rr50_82002_c1
1162 nmdc:mga08x19_19497_c1
1163 Ga0495601_0021865
1164 Ga0501084_0113188

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

41

137

0.9

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

178

285

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9483 8 256
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9377 8 256
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.924 9 256
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.906 9 256
8q70-assembly1.cif.gz_A-2 trna pseudouridine synthase a homodimer 0.9048 10 256
ID Description Score Start End Superfamily
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9745 8 112 3.30.70.580
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9733 10 110 3.30.70.580
af_C7J2E5_59_129_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9563 10 71 3.30.70.580
af_Q2QWH9_69_188_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9523 7 112 3.30.70.580
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.948 8 112 3.30.70.580
ID Description Score Start End GO Terms
AF-A0A533YIS0-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9948 9 113 GO:0003723
GO:0031119
GO:0160147
AF-A0A660YTS7-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.993 9 112 GO:0003723
GO:0031119
GO:0160147
AF-A0A7V3S244-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9918 8 113 GO:0003723
GO:0009982
GO:0031119
GO:0140098
AF-A0A7C3Y351-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9917 7 113 GO:0003723
GO:0031119
GO:0160147
AF-A0A2V9C5G8-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9903 9 113 GO:0003723
GO:0031119
GO:0160147

Map