F465970

General Info

Members Datasets Scaffolds Average Seq Length
580 212 580 133

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0527738|Ga0373943_0527738_232_648
Length 138
Sequence MIVFDLQCREAGCAWGDTFEAWFRSSADYEEQSAAGLVQCPVCQSANIGKAPMAPNVPRKAGDAAPLAKLAAMQAELLKDSRWVGDQFTETARAMHSGEVESAPVHGNATLEQAKSLAEDGVPFAPLPLPVTPPTQVN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
174 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
175 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
176 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
177 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.21
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007440 3300001979 Bacteria 4453
2 JGI24739J22299_10005700 3300001989 Bacteria 4719
3 JGI24737J22298_10011335 3300001990 Bacteria 2923
4 JGI24737J22298_10026324 3300001990 Bacteria 1836
5 JGI24735J21928_10011514 3300002067 Bacteria 2803
6 JGI24738J21930_10004349 3300002075 Bacteria 3483
7 JGI24738J21930_10011443 3300002075 Bacteria 1951
8 JGI24744J21845_10097393 3300002077 Bacteria 542
9 rootH2_10038505 3300003320 Bacteria 1541
10 Ga0070658_10002122 3300005327 Bacteria 16648
11 Ga0070658_10006601 3300005327 Bacteria 9405
12 Ga0070658_10051114 3300005327 Bacteria 3349
13 Ga0070658_10099453 3300005327 Bacteria 2403
14 Ga0070658_10286233 3300005327 Bacteria 1404
15 Ga0070658_10375796 3300005327 Bacteria 1219
16 Ga0070676_10053129 3300005328 Bacteria 2385
17 Ga0070683_100002586 3300005329 Bacteria 14474
18 Ga0070683_100502172 3300005329 Bacteria 1159
19 Ga0070690_100001887 3300005330 Bacteria 11122
20 Ga0070690_100148893 3300005330 Bacteria 1595
21 Ga0070670_100008751 3300005331 Bacteria 8644
22 Ga0070670_100197496 3300005331 Bacteria 1748
23 Ga0070666_10001159 3300005335 Bacteria 16007
24 Ga0070666_10003944 3300005335 Bacteria 9012
25 Ga0070666_10174972 3300005335 Bacteria 1504
26 Ga0070666_10312245 3300005335 Bacteria 1121
27 Ga0070666_11078985 3300005335 Bacteria 597
28 Ga0070680_101202409 3300005336 Bacteria 656
29 Ga0070682_100177055 3300005337 Bacteria 1487
30 Ga0070682_101518428 3300005337 Bacteria 577
31 Ga0068868_100054055 3300005338 Bacteria 3164
32 Ga0068868_100268183 3300005338 Bacteria 1442
33 Ga0068868_101001028 3300005338 Bacteria 765
34 Ga0070660_100000877 3300005339 Bacteria 20087
35 Ga0070660_100005831 3300005339 Bacteria 8530
36 Ga0070660_100041969 3300005339 Bacteria 3489
37 Ga0070660_100113515 3300005339 Bacteria 2157
38 Ga0070660_100142349 3300005339 Bacteria 1924
39 Ga0070660_100459743 3300005339 Bacteria 1057
40 Ga0070660_100468144 3300005339 Bacteria 1047
41 Ga0070660_100639520 3300005339 Bacteria 891
42 Ga0070660_101054171 3300005339 Bacteria 688
43 Ga0070689_100628142 3300005340 Bacteria 933
44 Ga0070691_10040093 3300005341 Bacteria 2213
45 Ga0070691_10976395 3300005341 Bacteria 527
46 Ga0070687_100169690 3300005343 Bacteria 1298
47 Ga0070661_100000033 3300005344 Bacteria 111757
48 Ga0070661_100084271 3300005344 Bacteria 2348
49 Ga0070661_100090640 3300005344 Bacteria 2264
50 Ga0070661_100696434 3300005344 Bacteria 827
51 Ga0070661_101255753 3300005344 Bacteria 620
52 Ga0070692_10077747 3300005345 Bacteria 1780
53 Ga0070692_10080769 3300005345 Bacteria 1751
54 Ga0070692_10347424 3300005345 Bacteria 920
55 Ga0070692_10444761 3300005345 Bacteria 828
56 Ga0070668_100313068 3300005347 Bacteria 1320
57 Ga0070668_100318506 3300005347 Bacteria 1309
58 Ga0070668_100743607 3300005347 Bacteria 868
59 Ga0070675_100547198 3300005354 Bacteria 1046
60 Ga0070671_100002272 3300005355 Bacteria 14832
61 Ga0070671_100003128 3300005355 Bacteria 12891
62 Ga0070671_100005357 3300005355 Bacteria 10229
63 Ga0070671_100020497 3300005355 Bacteria 5392
64 Ga0070671_100049049 3300005355 Bacteria 3513
65 Ga0070671_100084596 3300005355 Bacteria 2653
66 Ga0070671_100328478 3300005355 Bacteria 1304
67 Ga0070674_100042885 3300005356 Bacteria 3075
68 Ga0070673_100018258 3300005364 Bacteria 5007
69 Ga0070673_100025433 3300005364 Bacteria 4357
70 Ga0070673_100305031 3300005364 Bacteria 1403
71 Ga0070673_101385187 3300005364 Bacteria 662
72 Ga0070659_100000142 3300005366 Bacteria 55216
73 Ga0070659_100038725 3300005366 Bacteria 3719
74 Ga0070659_100057254 3300005366 Bacteria 3073
75 Ga0070659_100094190 3300005366 Bacteria 2405
76 Ga0070659_100134846 3300005366 Bacteria 2007
77 Ga0070659_100163700 3300005366 Bacteria 1820
78 Ga0070659_100246736 3300005366 Bacteria 1479
79 Ga0070659_100724699 3300005366 Bacteria 861
80 Ga0070659_100910426 3300005366 Bacteria 769
81 Ga0070667_100014827 3300005367 Bacteria 6438
82 Ga0070667_100021410 3300005367 Bacteria 5370
83 Ga0070667_100070579 3300005367 Bacteria 2973
84 Ga0070667_100218114 3300005367 Bacteria 1697
85 Ga0070667_100312529 3300005367 Bacteria 1417
86 Ga0070667_100453724 3300005367 Bacteria 1172
87 Ga0070667_100457577 3300005367 Bacteria 1166
88 Ga0070667_100474462 3300005367 Bacteria 1145
89 Ga0070667_100967675 3300005367 Bacteria 794
90 Ga0070667_100984211 3300005367 Bacteria 787
91 Ga0070667_101115220 3300005367 Bacteria 738
92 Ga0070667_101564489 3300005367 Bacteria 620
93 Ga0070714_100061398 3300005435 Bacteria 3228
94 Ga0070714_100104675 3300005435 Bacteria 2497
95 Ga0070714_100154950 3300005435 Bacteria 2068
96 Ga0070713_100025122 3300005436 Bacteria 4653
97 Ga0070713_100219958 3300005436 Bacteria 1722
98 Ga0070663_100000230 3300005455 Bacteria 28169
99 Ga0070663_100272312 3300005455 Bacteria 1346
100 Ga0070678_100005530 3300005456 Bacteria 7321
101 Ga0070678_100711870 3300005456 Bacteria 905
102 Ga0070678_100869137 3300005456 Bacteria 823
103 Ga0070678_102275497 3300005456 Unclassified 514
104 Ga0070662_100000021 3300005457 Bacteria 93909
105 Ga0070662_100024772 3300005457 Bacteria 4138
106 Ga0070662_100046693 3300005457 Bacteria 3112
107 Ga0070662_100059642 3300005457 Bacteria 2780
108 Ga0070662_100420425 3300005457 Bacteria 1105
109 Ga0070681_10027150 3300005458 Bacteria 5756
110 Ga0070681_10105659 3300005458 Bacteria 2758
111 Ga0070681_10148966 3300005458 Bacteria 2268
112 Ga0070681_10305744 3300005458 Bacteria 1500
113 Ga0070681_10368599 3300005458 Bacteria 1346
114 Ga0070681_10542463 3300005458 Bacteria 1077
115 Ga0070681_11270954 3300005458 Bacteria 659
116 Ga0068867_100086774 3300005459 Bacteria 2368
117 Ga0068867_100129071 3300005459 Bacteria 1963
118 Ga0070679_100059366 3300005530 Bacteria 3813
119 Ga0070679_100420585 3300005530 Bacteria 1282
120 Ga0070679_100660021 3300005530 Bacteria 988
121 Ga0070679_100691531 3300005530 Bacteria 962
122 Ga0070679_101109615 3300005530 Bacteria 736
123 Ga0070679_101225670 3300005530 Bacteria 696
124 Ga0070679_101265431 3300005530 Bacteria 683
125 Ga0070684_100165260 3300005535 Bacteria 2009
126 Ga0068853_100000220 3300005539 Bacteria 40376
127 Ga0068853_100010496 3300005539 Bacteria 7490
128 Ga0068853_100061430 3300005539 Bacteria 3250
129 Ga0068853_101364043 3300005539 Bacteria 685
130 Ga0068853_101398474 3300005539 Bacteria 677
131 Ga0068853_101778203 3300005539 Bacteria 597
132 Ga0070672_100024392 3300005543 Bacteria 4469
133 Ga0070686_100049311 3300005544 Bacteria 2671
134 Ga0070696_100003539 3300005546 Bacteria 10396
135 Ga0070693_100011000 3300005547 Bacteria 4548
136 Ga0070693_100201077 3300005547 Bacteria 1294
137 Ga0070693_100615619 3300005547 Bacteria 786
138 Ga0070693_101380006 3300005547 Unclassified 547
139 Ga0070665_100001858 3300005548 Bacteria 23957
140 Ga0070665_100018293 3300005548 Bacteria 7026
141 Ga0070665_100024933 3300005548 Bacteria 6028
142 Ga0070665_100374530 3300005548 Bacteria 1431
143 Ga0070665_100918869 3300005548 Bacteria 888
144 Ga0068855_100001017 3300005563 Bacteria 34928
145 Ga0068855_100119162 3300005563 Bacteria 3022
146 Ga0068855_100390037 3300005563 Bacteria 1527
147 Ga0068855_100548517 3300005563 Bacteria 1252
148 Ga0068855_100556843 3300005563 Bacteria 1241
149 Ga0068855_101740727 3300005563 Bacteria 635
150 Ga0068855_102040314 3300005563 Bacteria 579
151 Ga0070664_100000127 3300005564 Bacteria 51101
152 Ga0070664_100001413 3300005564 Bacteria 19196
153 Ga0070664_100003436 3300005564 Bacteria 12801
154 Ga0070664_100013142 3300005564 Bacteria 6740
155 Ga0070664_100101573 3300005564 Bacteria 2501
156 Ga0070664_100301343 3300005564 Bacteria 1448
157 Ga0070664_100690009 3300005564 Bacteria 951
158 Ga0070664_101644074 3300005564 Bacteria 608
159 Ga0068857_100066010 3300005577 Bacteria 3219
160 Ga0068857_100360408 3300005577 Bacteria 1348
161 Ga0068857_100472241 3300005577 Bacteria 1175
162 Ga0068857_101543388 3300005577 Bacteria 648
163 Ga0068854_100046149 3300005578 Bacteria 3101
164 Ga0068854_100171074 3300005578 Bacteria 1690
165 Ga0068854_100473360 3300005578 Bacteria 1050
166 Ga0068854_100663320 3300005578 Bacteria 897
167 Ga0068856_100000177 3300005614 Bacteria 66207
168 Ga0068856_100020942 3300005614 Bacteria 6355
169 Ga0068856_100139348 3300005614 Bacteria 2432
170 Ga0068856_100139922 3300005614 Bacteria 2427
171 Ga0070702_101311782 3300005615 Bacteria 588
172 Ga0068852_100005050 3300005616 Bacteria 9387
173 Ga0068852_100005634 3300005616 Bacteria 8984
174 Ga0068852_100023663 3300005616 Bacteria 4948
175 Ga0068852_100062116 3300005616 Bacteria 3248
176 Ga0068852_100101672 3300005616 Bacteria 2596
177 Ga0068859_100003970 3300005617 Bacteria 15093
178 Ga0068859_100046030 3300005617 Bacteria 4383
179 Ga0068859_101261034 3300005617 Bacteria 814
180 Ga0068864_100000768 3300005618 Bacteria 26958
181 Ga0068864_100124037 3300005618 Bacteria 2313
182 Ga0068864_100175110 3300005618 Bacteria 1958
183 Ga0068864_101463556 3300005618 Bacteria 686
184 Ga0068866_10276686 3300005718 Bacteria 1038
185 Ga0068851_10015160 3300005834 Bacteria 3668
186 Ga0068851_10036599 3300005834 Bacteria 2458
187 Ga0068851_10761410 3300005834 Bacteria 600
188 Ga0068863_100016307 3300005841 Bacteria 7130
189 Ga0068863_100023899 3300005841 Bacteria 5833
190 Ga0068863_100161097 3300005841 Bacteria 2150
191 Ga0068863_100846841 3300005841 Bacteria 913
192 Ga0068863_101462045 3300005841 Unclassified 692
193 Ga0068858_100008562 3300005842 Bacteria 9828
194 Ga0068858_100064701 3300005842 Bacteria 3385
195 Ga0068858_100145275 3300005842 Bacteria 2227
196 Ga0068858_100316155 3300005842 Bacteria 1492
197 Ga0068858_100717681 3300005842 Bacteria 973
198 Ga0068860_100051565 3300005843 Bacteria 3915
199 Ga0068860_100091899 3300005843 Bacteria 2892
200 Ga0068860_102360546 3300005843 Unclassified 552
201 Ga0068862_101806145 3300005844 Bacteria 621
202 Ga0070717_10227620 3300006028 Bacteria 1641
203 Ga0070716_100187513 3300006173 Bacteria 1364
204 Ga0070712_100035069 3300006175 Bacteria 3404
205 Ga0070712_100942012 3300006175 Bacteria 746
206 Ga0097621_100018095 3300006237 Bacteria 5373
207 Ga0097621_100086766 3300006237 Bacteria 2612
208 Ga0097621_100087568 3300006237 Bacteria 2601
209 Ga0097621_100253523 3300006237 Bacteria 1542
210 Ga0068871_100008583 3300006358 Bacteria 7345
211 Ga0075428_101105712 3300006844 Bacteria 837
212 Ga0075429_101629925 3300006880 Bacteria 561
213 Ga0075436_100583305 3300006914 Bacteria 823
214 Ga0097620_100003970 3300006931 Bacteria 15093
215 Ga0097620_100017045 3300006931 Bacteria 7294
216 Ga0097620_100046031 3300006931 Bacteria 4383
217 Ga0097620_101260855 3300006931 Bacteria 814
218 Ga0105240_10442452 3300009093 Bacteria 1456
219 Ga0111539_10023431 3300009094 Bacteria 7586
220 Ga0105245_10052595 3300009098 Bacteria 3653
221 Ga0105247_10254181 3300009101 Bacteria 1202
222 Ga0114129_10383745 3300009147 Bacteria 1855
223 Ga0114129_13463640 3300009147 Bacteria 505
224 Ga0105243_10226656 3300009148 Bacteria 1655
225 Ga0105243_10332756 3300009148 Bacteria 1388
226 Ga0105241_10302290 3300009174 Bacteria 1374
227 Ga0105242_10003949 3300009176 Bacteria 11520
228 Ga0105248_10001601 3300009177 Bacteria 25161
229 Ga0105248_10001721 3300009177 Bacteria 24322
230 Ga0105248_10007133 3300009177 Bacteria 12250
231 Ga0105248_10008243 3300009177 Bacteria 11448
232 Ga0105248_10035921 3300009177 Bacteria 5543
233 Ga0105248_10046658 3300009177 Bacteria 4856
234 Ga0105248_10109675 3300009177 Bacteria 3112
235 Ga0105248_10312956 3300009177 Bacteria 1768
236 Ga0105237_10117463 3300009545 Bacteria 2654
237 Ga0105238_10015109 3300009551 Bacteria 7821
238 Ga0105238_10020145 3300009551 Bacteria 6788
239 Ga0105238_10036786 3300009551 Bacteria 4978
240 Ga0105249_11504905 3300009553 Bacteria 745
241 Ga0105239_10021054 3300010375 Bacteria 7196
242 Ga0157327_1005245 3300012512 Bacteria 1041
243 Ga0157373_10065022 3300013100 Bacteria 2581
244 Ga0157373_10076020 3300013100 Bacteria 2370
245 Ga0157373_10181626 3300013100 Bacteria 1481
246 Ga0157373_10541564 3300013100 Bacteria 843
247 Ga0157373_11480093 3300013100 Bacteria 518
248 Ga0157371_10000934 3300013102 Bacteria 32706
249 Ga0157371_10009947 3300013102 Bacteria 7443
250 Ga0157371_10016130 3300013102 Bacteria 5585
251 Ga0157371_10034365 3300013102 Bacteria 3637
252 Ga0157371_10541568 3300013102 Bacteria 862
253 Ga0157371_11280722 3300013102 Bacteria 567
254 Ga0157370_10053638 3300013104 Bacteria 3844
255 Ga0157370_10136000 3300013104 Bacteria 2291
256 Ga0157370_10803985 3300013104 Bacteria 855
257 Ga0157370_11376015 3300013104 Bacteria 635
258 Ga0157369_10034534 3300013105 Bacteria 5549
259 Ga0157369_10190765 3300013105 Bacteria 2153
260 Ga0157369_10386136 3300013105 Bacteria 1453
261 Ga0157369_11917024 3300013105 Bacteria 601
262 Ga0157369_12633268 3300013105 Bacteria 508
263 Ga0157374_10026226 3300013296 Bacteria 5243
264 Ga0157374_10503390 3300013296 Bacteria 1216
265 Ga0157374_10613492 3300013296 Bacteria 1098
266 Ga0157374_11428597 3300013296 Bacteria 715
267 Ga0157378_10044962 3300013297 Bacteria 3922
268 Ga0157378_10170564 3300013297 Bacteria 2040
269 Ga0163162_10184748 3300013306 Bacteria 2211
270 Ga0163162_10842588 3300013306 Bacteria 1032
271 Ga0157372_10809312 3300013307 Bacteria 1088
272 Ga0157375_10462353 3300013308 Bacteria 1434
273 Ga0163163_10000587 3300014325 Bacteria 32106
274 Ga0163163_10220643 3300014325 Bacteria 1944
275 Ga0163163_10588849 3300014325 Bacteria 1175
276 Ga0157377_10149510 3300014745 Bacteria 1443
277 Ga0157379_10028970 3300014968 Bacteria 4924
278 Ga0157379_10030156 3300014968 Bacteria 4825
279 Ga0157379_11384885 3300014968 Bacteria 681
280 Ga0157376_10007200 3300014969 Bacteria 7912
281 Ga0157376_12109474 3300014969 Bacteria 602
282 Ga0163161_10081950 3300017792 Bacteria 2377
283 Ga0163161_10421406 3300017792 Bacteria 1074
284 Ga0207697_10155984 3300025315 Bacteria 994
285 Ga0207656_10002771 3300025321 Bacteria 5952
286 Ga0207656_10011010 3300025321 Bacteria 3405
287 Ga0207656_10197491 3300025321 Bacteria 971
288 Ga0207642_10115347 3300025899 Bacteria 1375
289 Ga0207688_10031655 3300025901 Bacteria 2922
290 Ga0207688_10185356 3300025901 Bacteria 1243
291 Ga0207680_10104446 3300025903 Bacteria 1826
292 Ga0207680_10174742 3300025903 Bacteria 1449
293 Ga0207680_10353007 3300025903 Bacteria 1033
294 Ga0207680_10662400 3300025903 Bacteria 748
295 Ga0207647_10003169 3300025904 Bacteria 12341
296 Ga0207647_10030317 3300025904 Bacteria 3490
297 Ga0207699_10026306 3300025906 Bacteria 3205
298 Ga0207645_10017801 3300025907 Bacteria 4684
299 Ga0207645_10071300 3300025907 Bacteria 2223
300 Ga0207645_10101209 3300025907 Bacteria 1859
301 Ga0207645_10762311 3300025907 Bacteria 658
302 Ga0207705_10001151 3300025909 Bacteria 21513
303 Ga0207705_10007147 3300025909 Bacteria 8231
304 Ga0207705_10058106 3300025909 Bacteria 2790
305 Ga0207705_10070601 3300025909 Bacteria 2531
306 Ga0207705_10190279 3300025909 Bacteria 1551
307 Ga0207705_10342726 3300025909 Bacteria 1150
308 Ga0207705_10455207 3300025909 Bacteria 992
309 Ga0207705_10629749 3300025909 Bacteria 834
310 Ga0207654_10625192 3300025911 Bacteria 770
311 Ga0207707_10047823 3300025912 Bacteria 3725
312 Ga0207707_10939584 3300025912 Bacteria 713
313 Ga0207671_10156544 3300025914 Bacteria 1763
314 Ga0207693_10054256 3300025915 Bacteria 3144
315 Ga0207693_10811602 3300025915 Bacteria 721
316 Ga0207662_10238577 3300025918 Bacteria 1189
317 Ga0207657_10000173 3300025919 Bacteria 66220
318 Ga0207657_10013237 3300025919 Bacteria 8096
319 Ga0207657_10032412 3300025919 Bacteria 4722
320 Ga0207657_10074562 3300025919 Bacteria 2865
321 Ga0207657_10076142 3300025919 Bacteria 2831
322 Ga0207657_10194856 3300025919 Bacteria 1633
323 Ga0207649_10000014 3300025920 Bacteria 255001
324 Ga0207649_10017445 3300025920 Bacteria 4068
325 Ga0207649_10032543 3300025920 Bacteria 3110
326 Ga0207649_10366117 3300025920 Bacteria 1071
327 Ga0207649_10410411 3300025920 Bacteria 1015
328 Ga0207649_10432448 3300025920 Bacteria 990
329 Ga0207649_10796551 3300025920 Bacteria 737
330 Ga0207652_10752064 3300025921 Bacteria 867
331 Ga0207694_10013073 3300025924 Bacteria 6250
332 Ga0207694_10411931 3300025924 Bacteria 1125
333 Ga0207650_10037049 3300025925 Bacteria 3552
334 Ga0207650_10060394 3300025925 Bacteria 2829
335 Ga0207687_10027104 3300025927 Bacteria 3843
336 Ga0207700_10073574 3300025928 Bacteria 2639
337 Ga0207664_10362043 3300025929 Bacteria 1285
338 Ga0207664_10502082 3300025929 Bacteria 1086
339 Ga0207644_10000344 3300025931 Bacteria 30156
340 Ga0207644_10000664 3300025931 Bacteria 21695
341 Ga0207644_10001420 3300025931 Bacteria 15416
342 Ga0207644_10003211 3300025931 Bacteria 10532
343 Ga0207644_10012128 3300025931 Bacteria 5718
344 Ga0207644_10023319 3300025931 Bacteria 4238
345 Ga0207644_10531336 3300025931 Bacteria 972
346 Ga0207690_10000150 3300025932 Bacteria 55157
347 Ga0207690_10070852 3300025932 Bacteria 2402
348 Ga0207690_10105372 3300025932 Bacteria 2022
349 Ga0207690_10145887 3300025932 Bacteria 1749
350 Ga0207690_10408308 3300025932 Bacteria 1084
351 Ga0207690_10556822 3300025932 Bacteria 933
352 Ga0207690_11169173 3300025932 Bacteria 642
353 Ga0207706_10000358 3300025933 Bacteria 49357
354 Ga0207706_10003923 3300025933 Bacteria 14115
355 Ga0207706_10008674 3300025933 Bacteria 9364
356 Ga0207706_10228596 3300025933 Bacteria 1628
357 Ga0207706_10373033 3300025933 Bacteria 1239
358 Ga0207686_10076720 3300025934 Bacteria 2168
359 Ga0207709_10357700 3300025935 Bacteria 1104
360 Ga0207670_11042959 3300025936 Bacteria 689
361 Ga0207669_10019629 3300025937 Bacteria 3525
362 Ga0207704_10007970 3300025938 Bacteria 5037
363 Ga0207704_10742054 3300025938 Unclassified 816
364 Ga0207665_10031767 3300025939 Bacteria 3495
365 Ga0207691_10003105 3300025940 Bacteria 16216
366 Ga0207691_10101143 3300025940 Bacteria 2572
367 Ga0207711_10001672 3300025941 Bacteria 20424
368 Ga0207711_10002775 3300025941 Bacteria 15413
369 Ga0207711_10007788 3300025941 Bacteria 8954
370 Ga0207711_10009489 3300025941 Bacteria 8119
371 Ga0207711_10017259 3300025941 Bacteria 5998
372 Ga0207711_10034134 3300025941 Bacteria 4308
373 Ga0207711_10325449 3300025941 Bacteria 1421
374 Ga0207711_10776418 3300025941 Bacteria 893
375 Ga0207689_10409633 3300025942 Bacteria 1131
376 Ga0207661_10009989 3300025944 Bacteria 6820
377 Ga0207661_10069112 3300025944 Bacteria 2879
378 Ga0207679_10000323 3300025945 Bacteria 35679
379 Ga0207679_10002496 3300025945 Bacteria 11320
380 Ga0207679_10010685 3300025945 Bacteria 5919
381 Ga0207679_10057290 3300025945 Bacteria 2881
382 Ga0207679_10240900 3300025945 Bacteria 1532
383 Ga0207679_11340537 3300025945 Bacteria 657
384 Ga0207667_10001713 3300025949 Bacteria 27586
385 Ga0207667_10130488 3300025949 Bacteria 2589
386 Ga0207667_10341252 3300025949 Bacteria 1529
387 Ga0207667_10473727 3300025949 Bacteria 1271
388 Ga0207667_10683174 3300025949 Bacteria 1030
389 Ga0207651_10034547 3300025960 Bacteria 3275
390 Ga0207651_10051185 3300025960 Bacteria 2808
391 Ga0207651_10238616 3300025960 Bacteria 1480
392 Ga0207668_10614217 3300025972 Bacteria 948
393 Ga0207668_11991086 3300025972 Unclassified 523
394 Ga0207640_10035701 3300025981 Bacteria 3113
395 Ga0207640_10269719 3300025981 Bacteria 1330
396 Ga0207640_10315605 3300025981 Bacteria 1242
397 Ga0207640_10484927 3300025981 Bacteria 1026
398 Ga0207640_10739229 3300025981 Bacteria 847
399 Ga0207658_10002162 3300025986 Bacteria 14613
400 Ga0207658_10011931 3300025986 Bacteria 5924
401 Ga0207658_10069594 3300025986 Bacteria 2659
402 Ga0207658_10115900 3300025986 Bacteria 2127
403 Ga0207658_10197710 3300025986 Bacteria 1676
404 Ga0207658_10684104 3300025986 Bacteria 926
405 Ga0207658_10988573 3300025986 Bacteria 767
406 Ga0207658_11512333 3300025986 Bacteria 614
407 Ga0207658_11815576 3300025986 Bacteria 556
408 Ga0207677_10008452 3300026023 Bacteria 5752
409 Ga0207677_10198697 3300026023 Bacteria 1592
410 Ga0207703_10015871 3300026035 Bacteria 5876
411 Ga0207703_10027350 3300026035 Bacteria 4491
412 Ga0207703_10032483 3300026035 Bacteria 4131
413 Ga0207703_11591378 3300026035 Bacteria 629
414 Ga0207639_10000581 3300026041 Bacteria 25117
415 Ga0207639_10001048 3300026041 Bacteria 18783
416 Ga0207639_10037630 3300026041 Bacteria 3594
417 Ga0207678_10001573 3300026067 Bacteria 20999
418 Ga0207678_10002050 3300026067 Bacteria 18282
419 Ga0207678_10007031 3300026067 Bacteria 9992
420 Ga0207678_10086442 3300026067 Bacteria 2680
421 Ga0207678_10369744 3300026067 Bacteria 1238
422 Ga0207702_10000840 3300026078 Bacteria 32178
423 Ga0207702_10020138 3300026078 Bacteria 5526
424 Ga0207702_10089954 3300026078 Bacteria 2685
425 Ga0207702_10196922 3300026078 Bacteria 1865
426 Ga0207702_10352276 3300026078 Bacteria 1409
427 Ga0207641_10036348 3300026088 Bacteria 4111
428 Ga0207641_10070617 3300026088 Bacteria 3001
429 Ga0207641_10081185 3300026088 Bacteria 2815
430 Ga0207641_10102800 3300026088 Bacteria 2520
431 Ga0207641_10737945 3300026088 Bacteria 971
432 Ga0207648_10003823 3300026089 Bacteria 15732
433 Ga0207676_10026001 3300026095 Bacteria 4347
434 Ga0207676_10053848 3300026095 Bacteria 3150
435 Ga0207676_10071277 3300026095 Bacteria 2789
436 Ga0207676_10075659 3300026095 Bacteria 2717
437 Ga0207674_10012841 3300026116 Bacteria 9350
438 Ga0207674_10022612 3300026116 Bacteria 6747
439 Ga0207674_10435063 3300026116 Bacteria 1268
440 Ga0207683_10001741 3300026121 Bacteria 19346
441 Ga0207683_10013466 3300026121 Bacteria 6977
442 Ga0207683_10367758 3300026121 Bacteria 1321
443 Ga0207698_10009494 3300026142 Bacteria 6206
444 Ga0207698_10031823 3300026142 Bacteria 3813
445 Ga0207698_10087957 3300026142 Bacteria 2532
446 Ga0207698_10252298 3300026142 Bacteria 1615
447 Ga0207698_10339531 3300026142 Bacteria 1414
448 Ga0207698_10361245 3300026142 Bacteria 1375
449 Ga0207698_11744979 3300026142 Bacteria 638
450 Ga0268266_10002202 3300028379 Bacteria 21322
451 Ga0268266_10036833 3300028379 Bacteria 4167
452 Ga0268266_10087768 3300028379 Bacteria 2722
453 Ga0268266_10968065 3300028379 Bacteria 823
454 Ga0268266_11020310 3300028379 Bacteria 801
455 Ga0268265_10003811 3300028380 Bacteria 10685
456 Ga0268265_10085308 3300028380 Bacteria 2506
457 Ga0268264_10144947 3300028381 Bacteria 2122
458 Ga0268264_11948877 3300028381 Unclassified 597
459 Ga0307406_10401413 3300031901 Bacteria 1087
460 Ga0307416_100008977 3300032002 Bacteria 6502
461 Ga0307415_100009240 3300032126 Bacteria 5511
462 Ga0373959_0057149 3300034820 Bacteria 855
463 Ga0373952_0291880 3300035092 Unclassified 505
464 Ga0373936_0170142 3300035113 Bacteria 952
465 Ga0373960_0008950 3300035121 Bacteria 2413
466 Ga0373943_0028919 3300035170 Bacteria 2615
467 Ga0373943_0527738 3300035170 Bacteria 691
468 Ga0373946_0014469 3300035171 Bacteria 2976
469 Ga0373942_0327896 3300035207 Unclassified 536
470 Ga0373931_0035529 3300035691 Bacteria 2592
471 Ga0373931_0109491 3300035691 Bacteria 1565
472 Ga0373935_0010804 3300035692 Bacteria 5485
473 Ga0373935_0013911 3300035692 Bacteria 4858
474 Ga0373927_0189702 3300035695 Bacteria 1349
475 Ga0373947_0060987 3300035725 Bacteria 2291
476 Ga0373947_1121653 3300035725 Unclassified 536
477 Ga0373925_0004884 3300037068 Bacteria 10088
478 Ga0395899_0051839 3300037312 Bacteria 3044
479 Ga0395899_0143826 3300037312 Bacteria 1695
480 Ga0395899_0177100 3300037312 Bacteria 1499
481 Ga0395899_0189963 3300037312 Bacteria 1437
482 Ga0395899_0315200 3300037312 Bacteria 1055
483 Ga0395900_0001168 3300037418 Bacteria 32771
484 Ga0395900_0004276 3300037418 Bacteria 15148
485 Ga0395900_0004297 3300037418 Bacteria 15108
486 Ga0395900_0009144 3300037418 Bacteria 10148
487 Ga0395900_0033727 3300037418 Bacteria 5268
488 Ga0395900_0042482 3300037418 Bacteria 4685
489 Ga0395900_0061180 3300037418 Bacteria 3872
490 Ga0395900_0220156 3300037418 Bacteria 1913
491 Ga0395900_0392347 3300037418 Bacteria 1354
492 Ga0395900_0731686 3300037418 Bacteria 921
493 Ga0395900_1090992 3300037418 Bacteria 716
494 Ga0395898_0047080 3300037466 Bacteria 4233
495 Ga0395898_0199728 3300037466 Bacteria 1909
496 Ga0395898_0563352 3300037466 Bacteria 1082
497 Ga0395898_1603636 3300037466 Bacteria 575
498 Ga0395905_0001952 3300037471 Bacteria 23608
499 Ga0395905_0002564 3300037471 Bacteria 20014
500 Ga0395905_0004681 3300037471 Bacteria 14148
501 Ga0395905_0018224 3300037471 Bacteria 6663
502 Ga0395905_0042329 3300037471 Bacteria 4274
503 Ga0395905_0059465 3300037471 Bacteria 3572
504 Ga0395905_0135702 3300037471 Bacteria 2314
505 Ga0395905_0136147 3300037471 Bacteria 2310
506 Ga0395905_0216625 3300037471 Bacteria 1793
507 Ga0395905_0235628 3300037471 Bacteria 1711
508 Ga0395905_0282453 3300037471 Bacteria 1546
509 Ga0395905_0864401 3300037471 Bacteria 807
510 Ga0395905_0991825 3300037471 Bacteria 743
511 Ga0395901_0000471 3300038443 Bacteria 46714
512 Ga0395901_0014921 3300038443 Bacteria 7894
513 Ga0395901_0034872 3300038443 Bacteria 5197
514 Ga0395901_0066808 3300038443 Bacteria 3745
515 Ga0395901_0128972 3300038443 Bacteria 2658
516 Ga0395901_0824491 3300038443 Bacteria 915
517 Ga0439455_0044985 3300042012 Bacteria 1140
518 Ga0450913_035866 3300042117 Bacteria 503
519 Ga0450917_002995 3300042120 Bacteria 1215
520 Ga0450892_005627 3300042130 Bacteria 1033
521 Ga0450905_001006 3300042142 Bacteria 3539
522 Ga0450889_000036 3300042144 Bacteria 11695
523 Ga0466969_0185563 3300044656 Bacteria 951
524 Ga0466972_0134516 3300044658 Bacteria 1164
525 Ga0466972_0274093 3300044658 Bacteria 788
526 Ga0466964_0102548 3300044706 Bacteria 1263
527 Ga0466968_0174026 3300044735 Bacteria 998
528 Ga0466970_0079863 3300044765 Bacteria 1767
529 Ga0466970_0165659 3300044765 Bacteria 1223
530 Ga0466959_0067575 3300045049 Bacteria 2591
531 Ga0466958_0153646 3300045836 Bacteria 1452
532 Ga0466967_0617751 3300045976 Bacteria 1070
533 Ga0495629_0521001 3300046459 Bacteria 800
534 Ga0495580_0377850 3300046472 Bacteria 957
535 Ga0495632_0381991 3300046519 Bacteria 617
536 Ga0495643_0299922 3300046522 Bacteria 733
537 Ga0495642_0374210 3300046528 Bacteria 627
538 Ga0495668_0134041 3300046616 Bacteria 1356
539 Ga0495669_0107084 3300046684 Bacteria 1303
540 Ga0495669_0342708 3300046684 Bacteria 722
541 Ga0496100_0068344 3300048903 Bacteria 2362
542 Ga0496100_0225602 3300048903 Bacteria 1376
543 Ga0496101_0000725 3300048904 Bacteria 19617
544 Ga0496101_0008886 3300048904 Bacteria 6579
545 Ga0496102_0442536 3300048905 Bacteria 1219
546 Ga0496103_0050494 3300048906 Bacteria 2573
547 Ga0496104_0241271 3300048907 Bacteria 1719
548 Ga0496105_0036847 3300048908 Bacteria 4030
549 Ga0496106_0077807 3300048909 Bacteria 2544
550 Ga0496106_0143496 3300048909 Bacteria 1879
551 Ga0496107_0002647 3300048910 Bacteria 11715
552 Ga0496107_0009652 3300048910 Bacteria 6693
553 Ga0496107_0200643 3300048910 Bacteria 1483
554 Ga0496107_0214334 3300048910 Bacteria 1432
555 Ga0496107_0681857 3300048910 Bacteria 756
556 Ga0496108_0003963 3300048911 Bacteria 11894
557 Ga0496108_0005358 3300048911 Bacteria 10370
558 Ga0496108_0026410 3300048911 Bacteria 4789
559 Ga0496109_0022104 3300048912 Bacteria 5629
560 Ga0496109_0046491 3300048912 Bacteria 3942
561 Ga0496109_0821575 3300048912 Bacteria 867
562 Ga0496109_1102120 3300048912 Bacteria 731
563 Ga0496110_0000304 3300048913 Bacteria 32429
564 Ga0496110_0067103 3300048913 Bacteria 3174
565 Ga0496110_0088202 3300048913 Bacteria 2771
566 Ga0496111_0151618 3300048914 Bacteria 1719
567 Ga0496111_0211041 3300048914 Bacteria 1442
568 Ga0496112_0016706 3300048915 Bacteria 6881
569 Ga0496112_0166993 3300048915 Bacteria 2166
570 Ga0496112_0468266 3300048915 Bacteria 1197
571 Ga0496112_1345931 3300048915 Bacteria 629
572 Ga0496113_0022411 3300048916 Bacteria 4467
573 Ga0496113_0071677 3300048916 Bacteria 2635
574 Ga0496114_0092095 3300048917 Bacteria 2575
575 Ga0496114_0148202 3300048917 Bacteria 2035
576 Ga0496115_0046562 3300048918 Bacteria 3467
577 nmdc:mga09592_306296_c1 3300050508 Bacteria 1377
578 nmdc:mga08y16_370585_c1 3300050511 Bacteria 1469
579 nmdc:mga08x19_333518_c1 3300050514 Bacteria 1057
580 Ga0466962_0197576 3300061719 Bacteria 982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046519 Ga0495632_0381991 Ga0495632_0381991_168_563 106
2 3300028380 Ga0268265_10085308 Ga0268265_100853082 111
3 3300035113 Ga0373936_0170142 Ga0373936_0170142_152_553 115
4 3300035170 Ga0373943_0028919 Ga0373943_0028919_385_786 115
5 3300035171 Ga0373946_0014469 Ga0373946_0014469_1720_2121 115
6 3300035692 Ga0373935_0010804 Ga0373935_0010804_710_1111 115
7 3300035695 Ga0373927_0189702 Ga0373927_0189702_241_642 115
8 3300035725 Ga0373947_0060987 Ga0373947_0060987_1074_1475 115
9 3300037068 Ga0373925_0004884 Ga0373925_0004884_2270_2671 115
10 3300026116 Ga0207674_10022612 Ga0207674_100226125 118
11 3300006844 Ga0075428_101105712 Ga0075428_1011057123 121
12 3300006880 Ga0075429_101629925 Ga0075429_1016299251 121
13 3300009147 Ga0114129_10383745 Ga0114129_103837452 121
14 3300050508 nmdc:mga09592_306296_c1 nmdc:mga09592_306296_c1_169_567 121
15 3300048915 Ga0496112_0468266 Ga0496112_0468266_471_872 123
16 3300005563 Ga0068855_100548517 Ga0068855_1005485172 127
17 3300009148 Ga0105243_10332756 Ga0105243_103327564 127
18 3300001990 JGI24737J22298_10026324 JGI24737J22298_100263242 130
19 3300002075 JGI24738J21930_10011443 JGI24738J21930_100114432 130
20 3300002077 JGI24744J21845_10097393 JGI24744J21845_100973931 130
21 3300005327 Ga0070658_10006601 Ga0070658_1000660111 130
22 3300005330 Ga0070690_100001887 Ga0070690_10000188715 130
23 3300005335 Ga0070666_10003944 Ga0070666_100039442 130
24 3300005338 Ga0068868_100054055 Ga0068868_1000540552 130
25 3300005339 Ga0070660_100142349 Ga0070660_1001423494 130
26 3300005340 Ga0070689_100628142 Ga0070689_1006281422 130
27 3300005343 Ga0070687_100169690 Ga0070687_1001696903 130
28 3300005344 Ga0070661_100696434 Ga0070661_1006964343 130
29 3300005354 Ga0070675_100547198 Ga0070675_1005471982 130
30 3300005355 Ga0070671_100020497 Ga0070671_1000204972 130
31 3300005356 Ga0070674_100042885 Ga0070674_1000428853 130
32 3300005364 Ga0070673_100018258 Ga0070673_1000182582 130
33 3300005366 Ga0070659_100246736 Ga0070659_1002467361 130
34 3300005367 Ga0070667_100014827 Ga0070667_1000148277 130
35 3300005456 Ga0070678_100005530 Ga0070678_1000055303 130
36 3300005457 Ga0070662_100059642 Ga0070662_1000596422 130
37 3300005459 Ga0068867_100086774 Ga0068867_1000867742 130
38 3300005543 Ga0070672_100024392 Ga0070672_1000243927 130
39 3300005544 Ga0070686_100049311 Ga0070686_1000493113 130
40 3300005548 Ga0070665_100018293 Ga0070665_1000182936 130
41 3300005564 Ga0070664_101644074 Ga0070664_1016440741 130
42 3300005614 Ga0068856_100020942 Ga0068856_1000209422 130
43 3300005616 Ga0068852_100005050 Ga0068852_1000050504 130
44 3300005617 Ga0068859_100003970 Ga0068859_10000397015 130
45 3300005618 Ga0068864_100175110 Ga0068864_1001751104 130
46 3300005834 Ga0068851_10015160 Ga0068851_100151605 130
47 3300005841 Ga0068863_100016307 Ga0068863_1000163078 130
48 3300005842 Ga0068858_100008562 Ga0068858_1000085622 130
49 3300005843 Ga0068860_100091899 Ga0068860_1000918995 130
50 3300005844 Ga0068862_101806145 Ga0068862_1018061452 130
51 3300006237 Ga0097621_100018095 Ga0097621_1000180958 130
52 3300006358 Ga0068871_100008583 Ga0068871_1000085832 130
53 3300006931 Ga0097620_100003970 Ga0097620_10000397015 130
54 3300009093 Ga0105240_10442452 Ga0105240_104424524 130
55 3300009098 Ga0105245_10052595 Ga0105245_100525952 130
56 3300009101 Ga0105247_10254181 Ga0105247_102541812 130
57 3300009148 Ga0105243_10226656 Ga0105243_102266562 130
58 3300009176 Ga0105242_10003949 Ga0105242_1000394914 130
59 3300009177 Ga0105248_10312956 Ga0105248_103129564 130
60 3300009551 Ga0105238_10015109 Ga0105238_100151099 130
61 3300009553 Ga0105249_11504905 Ga0105249_115049052 130
62 3300013102 Ga0157371_10009947 Ga0157371_100099478 130
63 3300013104 Ga0157370_10136000 Ga0157370_101360001 130
64 3300013105 Ga0157369_10034534 Ga0157369_100345347 130
65 3300013105 Ga0157369_12633268 Ga0157369_126332681 130
66 3300013296 Ga0157374_10026226 Ga0157374_100262265 130
67 3300013297 Ga0157378_10044962 Ga0157378_100449622 130
68 3300013306 Ga0163162_10184748 Ga0163162_101847484 130
69 3300013308 Ga0157375_10462353 Ga0157375_104623532 130
70 3300014325 Ga0163163_10220643 Ga0163163_102206433 130
71 3300014745 Ga0157377_10149510 Ga0157377_101495102 130
72 3300014968 Ga0157379_10030156 Ga0157379_100301562 130
73 3300014969 Ga0157376_10007200 Ga0157376_100072002 130
74 3300017792 Ga0163161_10081950 Ga0163161_100819503 130
75 3300025315 Ga0207697_10155984 Ga0207697_101559843 130
76 3300025321 Ga0207656_10002771 Ga0207656_100027718 130
77 3300025899 Ga0207642_10115347 Ga0207642_101153473 130
78 3300025901 Ga0207688_10031655 Ga0207688_100316555 130
79 3300025903 Ga0207680_10104446 Ga0207680_101044464 130
80 3300025909 Ga0207705_10007147 Ga0207705_100071479 130
81 3300025918 Ga0207662_10238577 Ga0207662_102385772 130
82 3300025919 Ga0207657_10194856 Ga0207657_101948563 130
83 3300025920 Ga0207649_10032543 Ga0207649_100325431 130
84 3300025927 Ga0207687_10027104 Ga0207687_100271046 130
85 3300025931 Ga0207644_10000344 Ga0207644_1000034430 130
86 3300025932 Ga0207690_10556822 Ga0207690_105568221 130
87 3300025933 Ga0207706_10003923 Ga0207706_100039232 130
88 3300025934 Ga0207686_10076720 Ga0207686_100767203 130
89 3300025935 Ga0207709_10357700 Ga0207709_103577003 130
90 3300025937 Ga0207669_10019629 Ga0207669_100196296 130
91 3300025938 Ga0207704_10007970 Ga0207704_100079705 130
92 3300025940 Ga0207691_10003105 Ga0207691_1000310510 130
93 3300025941 Ga0207711_10009489 Ga0207711_100094894 130
94 3300025942 Ga0207689_10409633 Ga0207689_104096332 130
95 3300025945 Ga0207679_11340537 Ga0207679_113405372 130
96 3300025949 Ga0207667_10683174 Ga0207667_106831742 130
97 3300025960 Ga0207651_10034547 Ga0207651_100345475 130
98 3300025986 Ga0207658_10069594 Ga0207658_100695942 130
99 3300026023 Ga0207677_10008452 Ga0207677_100084528 130
100 3300026035 Ga0207703_10027350 Ga0207703_100273503 130
101 3300026078 Ga0207702_10196922 Ga0207702_101969224 130
102 3300026088 Ga0207641_10036348 Ga0207641_100363483 130
103 3300026089 Ga0207648_10003823 Ga0207648_1000382315 130
104 3300026095 Ga0207676_10026001 Ga0207676_100260017 130
105 3300026121 Ga0207683_10001741 Ga0207683_1000174115 130
106 3300026142 Ga0207698_10252298 Ga0207698_102522982 130
107 3300028379 Ga0268266_10087768 Ga0268266_100877684 130
108 3300028381 Ga0268264_10144947 Ga0268264_101449473 130
109 3300035691 Ga0373931_0109491 Ga0373931_0109491_98_499 130
110 3300045836 Ga0466958_0153646 Ga0466958_0153646_348_749 130
111 3300046684 Ga0495669_0342708 Ga0495669_0342708_54_455 130
112 3300048903 Ga0496100_0068344 Ga0496100_0068344_98_499 130
113 3300048904 Ga0496101_0000725 Ga0496101_0000725_15247_15648 130
114 3300048905 Ga0496102_0442536 Ga0496102_0442536_766_1167 130
115 3300048906 Ga0496103_0050494 Ga0496103_0050494_660_1061 130
116 3300048907 Ga0496104_0241271 Ga0496104_0241271_1166_1567 130
117 3300048908 Ga0496105_0036847 Ga0496105_0036847_3092_3493 130
118 3300048909 Ga0496106_0143496 Ga0496106_0143496_674_1075 130
119 3300048910 Ga0496107_0002647 Ga0496107_0002647_9667_10068 130
120 3300048911 Ga0496108_0005358 Ga0496108_0005358_7449_7850 130
121 3300048912 Ga0496109_0022104 Ga0496109_0022104_419_820 130
122 3300048913 Ga0496110_0000304 Ga0496110_0000304_30759_31160 130
123 3300048915 Ga0496112_0166993 Ga0496112_0166993_366_767 130
124 3300048916 Ga0496113_0071677 Ga0496113_0071677_625_1026 130
125 3300048917 Ga0496114_0092095 Ga0496114_0092095_1648_2049 130
126 3300005341 Ga0070691_10976395 Ga0070691_109763951 132
127 3300005347 Ga0070668_100318506 Ga0070668_1003185062 132
128 3300005366 Ga0070659_100094190 Ga0070659_1000941904 132
129 3300005457 Ga0070662_100046693 Ga0070662_1000466936 132
130 3300005458 Ga0070681_10105659 Ga0070681_101056594 132
131 3300005530 Ga0070679_100420585 Ga0070679_1004205852 132
132 3300005546 Ga0070696_100003539 Ga0070696_10000353911 132
133 3300005547 Ga0070693_100201077 Ga0070693_1002010772 132
134 3300005547 Ga0070693_101380006 Ga0070693_1013800061 132
135 3300009094 Ga0111539_10023431 Ga0111539_1002343110 132
136 3300009147 Ga0114129_13463640 Ga0114129_134636402 132
137 3300013100 Ga0157373_10181626 Ga0157373_101816262 132
138 3300025907 Ga0207645_10762311 Ga0207645_107623112 132
139 3300025912 Ga0207707_10939584 Ga0207707_109395842 132
140 3300025921 Ga0207652_10752064 Ga0207652_107520642 132
141 3300025932 Ga0207690_10105372 Ga0207690_101053723 132
142 3300025981 Ga0207640_10269719 Ga0207640_102697192 132
143 3300031901 Ga0307406_10401413 Ga0307406_104014131 132
144 3300037312 Ga0395899_0143826 Ga0395899_0143826_451_849 132
145 3300037418 Ga0395900_0004297 Ga0395900_0004297_4831_5229 132
146 3300037466 Ga0395898_0563352 Ga0395898_0563352_435_836 132
147 3300037466 Ga0395898_1603636 Ga0395898_1603636_68_466 132
148 3300037471 Ga0395905_0018224 Ga0395905_0018224_4973_5371 132
149 3300037471 Ga0395905_0042329 Ga0395905_0042329_1912_2313 132
150 3300037471 Ga0395905_0216625 Ga0395905_0216625_125_526 132
151 3300042117 Ga0450913_035866 Ga0450913_035866_62_460 132
152 3300042120 Ga0450917_002995 Ga0450917_002995_13_411 132
153 3300042130 Ga0450892_005627 Ga0450892_005627_293_691 132
154 3300042142 Ga0450905_001006 Ga0450905_001006_1352_1750 132
155 3300042144 Ga0450889_000036 Ga0450889_000036_11285_11683 132
156 3300050511 nmdc:mga08y16_370585_c1 nmdc:mga08y16_370585_c1_280_678 132
157 3300001979 JGI24740J21852_10007440 JGI24740J21852_100074404 133
158 3300001989 JGI24739J22299_10005700 JGI24739J22299_100057007 133
159 3300001990 JGI24737J22298_10011335 JGI24737J22298_100113355 133
160 3300002067 JGI24735J21928_10011514 JGI24735J21928_100115142 133
161 3300002075 JGI24738J21930_10004349 JGI24738J21930_100043494 133
162 3300003320 rootH2_10038505 rootH2_100385052 133
163 3300005327 Ga0070658_10002122 Ga0070658_100021228 133
164 3300005327 Ga0070658_10051114 Ga0070658_100511145 133
165 3300005327 Ga0070658_10099453 Ga0070658_100994534 133
166 3300005327 Ga0070658_10286233 Ga0070658_102862332 133
167 3300005327 Ga0070658_10375796 Ga0070658_103757962 133
168 3300005328 Ga0070676_10053129 Ga0070676_100531291 133
169 3300005329 Ga0070683_100002586 Ga0070683_10000258614 133
170 3300005329 Ga0070683_100502172 Ga0070683_1005021722 133
171 3300005330 Ga0070690_100148893 Ga0070690_1001488931 133
172 3300005331 Ga0070670_100008751 Ga0070670_1000087517 133
173 3300005331 Ga0070670_100197496 Ga0070670_1001974964 133
174 3300005335 Ga0070666_10001159 Ga0070666_1000115921 133
175 3300005335 Ga0070666_10174972 Ga0070666_101749722 133
176 3300005335 Ga0070666_10312245 Ga0070666_103122452 133
177 3300005335 Ga0070666_11078985 Ga0070666_110789852 133
178 3300005336 Ga0070680_101202409 Ga0070680_1012024092 133
179 3300005337 Ga0070682_100177055 Ga0070682_1001770552 133
180 3300005337 Ga0070682_101518428 Ga0070682_1015184282 133
181 3300005338 Ga0068868_100268183 Ga0068868_1002681834 133
182 3300005338 Ga0068868_101001028 Ga0068868_1010010281 133
183 3300005339 Ga0070660_100000877 Ga0070660_10000087718 133
184 3300005339 Ga0070660_100005831 Ga0070660_1000058317 133
185 3300005339 Ga0070660_100041969 Ga0070660_1000419696 133
186 3300005339 Ga0070660_100113515 Ga0070660_1001135154 133
187 3300005339 Ga0070660_100459743 Ga0070660_1004597434 133
188 3300005339 Ga0070660_100468144 Ga0070660_1004681443 133
189 3300005339 Ga0070660_100639520 Ga0070660_1006395202 133
190 3300005339 Ga0070660_101054171 Ga0070660_1010541712 133
191 3300005341 Ga0070691_10040093 Ga0070691_100400934 133
192 3300005344 Ga0070661_100000033 Ga0070661_10000003363 133
193 3300005344 Ga0070661_100084271 Ga0070661_1000842712 133
194 3300005344 Ga0070661_100090640 Ga0070661_1000906404 133
195 3300005344 Ga0070661_101255753 Ga0070661_1012557532 133
196 3300005345 Ga0070692_10077747 Ga0070692_100777471 133
197 3300005345 Ga0070692_10080769 Ga0070692_100807692 133
198 3300005345 Ga0070692_10347424 Ga0070692_103474241 133
199 3300005345 Ga0070692_10444761 Ga0070692_104447611 133
200 3300005347 Ga0070668_100313068 Ga0070668_1003130681 133
201 3300005347 Ga0070668_100743607 Ga0070668_1007436073 133
202 3300005355 Ga0070671_100002272 Ga0070671_10000227217 133
203 3300005355 Ga0070671_100003128 Ga0070671_1000031289 133
204 3300005355 Ga0070671_100005357 Ga0070671_10000535713 133
205 3300005355 Ga0070671_100049049 Ga0070671_1000490495 133
206 3300005355 Ga0070671_100084596 Ga0070671_1000845962 133
207 3300005355 Ga0070671_100328478 Ga0070671_1003284782 133
208 3300005364 Ga0070673_100025433 Ga0070673_1000254335 133
209 3300005364 Ga0070673_100305031 Ga0070673_1003050311 133
210 3300005364 Ga0070673_101385187 Ga0070673_1013851872 133
211 3300005366 Ga0070659_100000142 Ga0070659_10000014249 133
212 3300005366 Ga0070659_100038725 Ga0070659_1000387256 133
213 3300005366 Ga0070659_100057254 Ga0070659_1000572542 133
214 3300005366 Ga0070659_100134846 Ga0070659_1001348462 133
215 3300005366 Ga0070659_100163700 Ga0070659_1001637003 133
216 3300005366 Ga0070659_100724699 Ga0070659_1007246991 133
217 3300005366 Ga0070659_100910426 Ga0070659_1009104261 133
218 3300005367 Ga0070667_100021410 Ga0070667_1000214103 133
219 3300005367 Ga0070667_100070579 Ga0070667_1000705792 133
220 3300005367 Ga0070667_100218114 Ga0070667_1002181142 133
221 3300005367 Ga0070667_100312529 Ga0070667_1003125294 133
222 3300005367 Ga0070667_100453724 Ga0070667_1004537242 133
223 3300005367 Ga0070667_100457577 Ga0070667_1004575772 133
224 3300005367 Ga0070667_100474462 Ga0070667_1004744621 133
225 3300005367 Ga0070667_100967675 Ga0070667_1009676753 133
226 3300005367 Ga0070667_100984211 Ga0070667_1009842112 133
227 3300005367 Ga0070667_101115220 Ga0070667_1011152202 133
228 3300005367 Ga0070667_101564489 Ga0070667_1015644891 133
229 3300005435 Ga0070714_100061398 Ga0070714_1000613981 133
230 3300005435 Ga0070714_100104675 Ga0070714_1001046754 133
231 3300005435 Ga0070714_100154950 Ga0070714_1001549502 133
232 3300005436 Ga0070713_100025122 Ga0070713_1000251224 133
233 3300005436 Ga0070713_100219958 Ga0070713_1002199584 133
234 3300005455 Ga0070663_100000230 Ga0070663_1000002306 133
235 3300005455 Ga0070663_100272312 Ga0070663_1002723124 133
236 3300005456 Ga0070678_100711870 Ga0070678_1007118702 133
237 3300005456 Ga0070678_100869137 Ga0070678_1008691372 133
238 3300005456 Ga0070678_102275497 Ga0070678_1022754971 133
239 3300005457 Ga0070662_100000021 Ga0070662_10000002118 133
240 3300005457 Ga0070662_100024772 Ga0070662_1000247727 133
241 3300005457 Ga0070662_100420425 Ga0070662_1004204252 133
242 3300005458 Ga0070681_10027150 Ga0070681_100271505 133
243 3300005458 Ga0070681_10148966 Ga0070681_101489663 133
244 3300005458 Ga0070681_10305744 Ga0070681_103057442 133
245 3300005458 Ga0070681_10368599 Ga0070681_103685991 133
246 3300005458 Ga0070681_10542463 Ga0070681_105424632 133
247 3300005458 Ga0070681_11270954 Ga0070681_112709542 133
248 3300005459 Ga0068867_100129071 Ga0068867_1001290712 133
249 3300005530 Ga0070679_100059366 Ga0070679_1000593661 133
250 3300005530 Ga0070679_100660021 Ga0070679_1006600211 133
251 3300005530 Ga0070679_100691531 Ga0070679_1006915311 133
252 3300005530 Ga0070679_101109615 Ga0070679_1011096151 133
253 3300005530 Ga0070679_101225670 Ga0070679_1012256702 133
254 3300005530 Ga0070679_101265431 Ga0070679_1012654312 133
255 3300005535 Ga0070684_100165260 Ga0070684_1001652604 133
256 3300005539 Ga0068853_100000220 Ga0068853_10000022028 133
257 3300005539 Ga0068853_100010496 Ga0068853_1000104965 133
258 3300005539 Ga0068853_100061430 Ga0068853_1000614301 133
259 3300005539 Ga0068853_101364043 Ga0068853_1013640432 133
260 3300005539 Ga0068853_101398474 Ga0068853_1013984742 133
261 3300005539 Ga0068853_101778203 Ga0068853_1017782031 133
262 3300005547 Ga0070693_100011000 Ga0070693_1000110005 133
263 3300005547 Ga0070693_100615619 Ga0070693_1006156191 133
264 3300005548 Ga0070665_100001858 Ga0070665_10000185812 133
265 3300005548 Ga0070665_100024933 Ga0070665_1000249334 133
266 3300005548 Ga0070665_100374530 Ga0070665_1003745303 133
267 3300005548 Ga0070665_100918869 Ga0070665_1009188692 133
268 3300005563 Ga0068855_100001017 Ga0068855_10000101720 133
269 3300005563 Ga0068855_100119162 Ga0068855_1001191622 133
270 3300005563 Ga0068855_100390037 Ga0068855_1003900371 133
271 3300005563 Ga0068855_100556843 Ga0068855_1005568432 133
272 3300005563 Ga0068855_101740727 Ga0068855_1017407272 133
273 3300005563 Ga0068855_102040314 Ga0068855_1020403141 133
274 3300005564 Ga0070664_100000127 Ga0070664_10000012763 133
275 3300005564 Ga0070664_100001413 Ga0070664_10000141313 133
276 3300005564 Ga0070664_100003436 Ga0070664_1000034369 133
277 3300005564 Ga0070664_100013142 Ga0070664_1000131427 133
278 3300005564 Ga0070664_100101573 Ga0070664_1001015734 133
279 3300005564 Ga0070664_100301343 Ga0070664_1003013432 133
280 3300005564 Ga0070664_100690009 Ga0070664_1006900093 133
281 3300005577 Ga0068857_100066010 Ga0068857_1000660102 133
282 3300005577 Ga0068857_100360408 Ga0068857_1003604083 133
283 3300005577 Ga0068857_100472241 Ga0068857_1004722411 133
284 3300005577 Ga0068857_101543388 Ga0068857_1015433881 133
285 3300005578 Ga0068854_100046149 Ga0068854_1000461494 133
286 3300005578 Ga0068854_100171074 Ga0068854_1001710744 133
287 3300005578 Ga0068854_100473360 Ga0068854_1004733602 133
288 3300005578 Ga0068854_100663320 Ga0068854_1006633202 133
289 3300005614 Ga0068856_100000177 Ga0068856_10000017757 133
290 3300005614 Ga0068856_100139348 Ga0068856_1001393484 133
291 3300005614 Ga0068856_100139922 Ga0068856_1001399224 133
292 3300005615 Ga0070702_101311782 Ga0070702_1013117821 133
293 3300005616 Ga0068852_100005634 Ga0068852_1000056344 133
294 3300005616 Ga0068852_100023663 Ga0068852_1000236635 133
295 3300005616 Ga0068852_100062116 Ga0068852_1000621163 133
296 3300005616 Ga0068852_100101672 Ga0068852_1001016724 133
297 3300005617 Ga0068859_100046030 Ga0068859_1000460306 133
298 3300005617 Ga0068859_101261034 Ga0068859_1012610342 133
299 3300005618 Ga0068864_100000768 Ga0068864_10000076822 133
300 3300005618 Ga0068864_100124037 Ga0068864_1001240372 133
301 3300005618 Ga0068864_101463556 Ga0068864_1014635562 133
302 3300005718 Ga0068866_10276686 Ga0068866_102766862 133
303 3300005834 Ga0068851_10036599 Ga0068851_100365994 133
304 3300005834 Ga0068851_10761410 Ga0068851_107614102 133
305 3300005841 Ga0068863_100023899 Ga0068863_1000238996 133
306 3300005841 Ga0068863_100161097 Ga0068863_1001610974 133
307 3300005841 Ga0068863_100846841 Ga0068863_1008468411 133
308 3300005841 Ga0068863_101462045 Ga0068863_1014620451 133
309 3300005842 Ga0068858_100064701 Ga0068858_1000647012 133
310 3300005842 Ga0068858_100145275 Ga0068858_1001452753 133
311 3300005842 Ga0068858_100316155 Ga0068858_1003161553 133
312 3300005842 Ga0068858_100717681 Ga0068858_1007176812 133
313 3300005843 Ga0068860_100051565 Ga0068860_1000515653 133
314 3300005843 Ga0068860_102360546 Ga0068860_1023605461 133
315 3300006028 Ga0070717_10227620 Ga0070717_102276202 133
316 3300006173 Ga0070716_100187513 Ga0070716_1001875133 133
317 3300006175 Ga0070712_100035069 Ga0070712_1000350695 133
318 3300006175 Ga0070712_100942012 Ga0070712_1009420122 133
319 3300006237 Ga0097621_100086766 Ga0097621_1000867664 133
320 3300006237 Ga0097621_100087568 Ga0097621_1000875684 133
321 3300006237 Ga0097621_100253523 Ga0097621_1002535234 133
322 3300006914 Ga0075436_100583305 Ga0075436_1005833052 133
323 3300006931 Ga0097620_100017045 Ga0097620_1000170458 133
324 3300006931 Ga0097620_100046031 Ga0097620_1000460312 133
325 3300006931 Ga0097620_101260855 Ga0097620_1012608552 133
326 3300009174 Ga0105241_10302290 Ga0105241_103022901 133
327 3300009177 Ga0105248_10001601 Ga0105248_1000160124 133
328 3300009177 Ga0105248_10001721 Ga0105248_1000172121 133
329 3300009177 Ga0105248_10007133 Ga0105248_1000713310 133
330 3300009177 Ga0105248_10008243 Ga0105248_1000824315 133
331 3300009177 Ga0105248_10035921 Ga0105248_100359216 133
332 3300009177 Ga0105248_10046658 Ga0105248_100466587 133
333 3300009177 Ga0105248_10109675 Ga0105248_101096754 133
334 3300009545 Ga0105237_10117463 Ga0105237_101174635 133
335 3300009551 Ga0105238_10020145 Ga0105238_100201459 133
336 3300009551 Ga0105238_10036786 Ga0105238_100367862 133
337 3300010375 Ga0105239_10021054 Ga0105239_100210549 133
338 3300012512 Ga0157327_1005245 Ga0157327_10052453 133
339 3300013100 Ga0157373_10065022 Ga0157373_100650225 133
340 3300013100 Ga0157373_10076020 Ga0157373_100760204 133
341 3300013100 Ga0157373_10541564 Ga0157373_105415642 133
342 3300013100 Ga0157373_11480093 Ga0157373_114800931 133
343 3300013102 Ga0157371_10000934 Ga0157371_1000093422 133
344 3300013102 Ga0157371_10016130 Ga0157371_100161306 133
345 3300013102 Ga0157371_10034365 Ga0157371_100343653 133
346 3300013102 Ga0157371_10541568 Ga0157371_105415681 133
347 3300013102 Ga0157371_11280722 Ga0157371_112807222 133
348 3300013104 Ga0157370_10053638 Ga0157370_100536386 133
349 3300013104 Ga0157370_10803985 Ga0157370_108039852 133
350 3300013104 Ga0157370_11376015 Ga0157370_113760151 133
351 3300013105 Ga0157369_10190765 Ga0157369_101907654 133
352 3300013105 Ga0157369_10386136 Ga0157369_103861364 133
353 3300013105 Ga0157369_11917024 Ga0157369_119170242 133
354 3300013296 Ga0157374_10503390 Ga0157374_105033904 133
355 3300013296 Ga0157374_10613492 Ga0157374_106134922 133
356 3300013296 Ga0157374_11428597 Ga0157374_114285973 133
357 3300013297 Ga0157378_10170564 Ga0157378_101705642 133
358 3300013306 Ga0163162_10842588 Ga0163162_108425882 133
359 3300013307 Ga0157372_10809312 Ga0157372_108093122 133
360 3300014325 Ga0163163_10000587 Ga0163163_1000058734 133
361 3300014325 Ga0163163_10588849 Ga0163163_105888491 133
362 3300014968 Ga0157379_10028970 Ga0157379_100289704 133
363 3300014968 Ga0157379_11384885 Ga0157379_113848852 133
364 3300014969 Ga0157376_12109474 Ga0157376_121094742 133
365 3300017792 Ga0163161_10421406 Ga0163161_104214062 133
366 3300025321 Ga0207656_10011010 Ga0207656_100110104 133
367 3300025321 Ga0207656_10197491 Ga0207656_101974912 133
368 3300025901 Ga0207688_10185356 Ga0207688_101853563 133
369 3300025903 Ga0207680_10174742 Ga0207680_101747422 133
370 3300025903 Ga0207680_10353007 Ga0207680_103530073 133
371 3300025903 Ga0207680_10662400 Ga0207680_106624002 133
372 3300025904 Ga0207647_10003169 Ga0207647_1000316910 133
373 3300025904 Ga0207647_10030317 Ga0207647_100303176 133
374 3300025906 Ga0207699_10026306 Ga0207699_100263064 133
375 3300025907 Ga0207645_10017801 Ga0207645_100178017 133
376 3300025907 Ga0207645_10071300 Ga0207645_100713004 133
377 3300025907 Ga0207645_10101209 Ga0207645_101012094 133
378 3300025909 Ga0207705_10001151 Ga0207705_1000115118 133
379 3300025909 Ga0207705_10058106 Ga0207705_100581065 133
380 3300025909 Ga0207705_10070601 Ga0207705_100706012 133
381 3300025909 Ga0207705_10190279 Ga0207705_101902793 133
382 3300025909 Ga0207705_10342726 Ga0207705_103427262 133
383 3300025909 Ga0207705_10455207 Ga0207705_104552073 133
384 3300025909 Ga0207705_10629749 Ga0207705_106297493 133
385 3300025911 Ga0207654_10625192 Ga0207654_106251922 133
386 3300025912 Ga0207707_10047823 Ga0207707_100478236 133
387 3300025914 Ga0207671_10156544 Ga0207671_101565442 133
388 3300025915 Ga0207693_10054256 Ga0207693_100542565 133
389 3300025915 Ga0207693_10811602 Ga0207693_108116022 133
390 3300025919 Ga0207657_10000173 Ga0207657_1000017357 133
391 3300025919 Ga0207657_10013237 Ga0207657_100132378 133
392 3300025919 Ga0207657_10032412 Ga0207657_100324127 133
393 3300025919 Ga0207657_10074562 Ga0207657_100745625 133
394 3300025919 Ga0207657_10076142 Ga0207657_100761422 133
395 3300025920 Ga0207649_10000014 Ga0207649_1000001460 133
396 3300025920 Ga0207649_10017445 Ga0207649_100174455 133
397 3300025920 Ga0207649_10366117 Ga0207649_103661172 133
398 3300025920 Ga0207649_10410411 Ga0207649_104104112 133
399 3300025920 Ga0207649_10432448 Ga0207649_104324482 133
400 3300025920 Ga0207649_10796551 Ga0207649_107965512 133
401 3300025924 Ga0207694_10013073 Ga0207694_100130738 133
402 3300025924 Ga0207694_10411931 Ga0207694_104119312 133
403 3300025925 Ga0207650_10037049 Ga0207650_100370494 133
404 3300025925 Ga0207650_10060394 Ga0207650_100603944 133
405 3300025928 Ga0207700_10073574 Ga0207700_100735744 133
406 3300025929 Ga0207664_10362043 Ga0207664_103620432 133
407 3300025929 Ga0207664_10502082 Ga0207664_105020821 133
408 3300025931 Ga0207644_10000664 Ga0207644_100006647 133
409 3300025931 Ga0207644_10001420 Ga0207644_1000142013 133
410 3300025931 Ga0207644_10003211 Ga0207644_100032114 133
411 3300025931 Ga0207644_10012128 Ga0207644_100121287 133
412 3300025931 Ga0207644_10023319 Ga0207644_100233195 133
413 3300025931 Ga0207644_10531336 Ga0207644_105313362 133
414 3300025932 Ga0207690_10000150 Ga0207690_1000015043 133
415 3300025932 Ga0207690_10070852 Ga0207690_100708522 133
416 3300025932 Ga0207690_10145887 Ga0207690_101458874 133
417 3300025932 Ga0207690_10408308 Ga0207690_104083083 133
418 3300025932 Ga0207690_11169173 Ga0207690_111691732 133
419 3300025933 Ga0207706_10000358 Ga0207706_1000035838 133
420 3300025933 Ga0207706_10008674 Ga0207706_1000867410 133
421 3300025933 Ga0207706_10228596 Ga0207706_102285964 133
422 3300025933 Ga0207706_10373033 Ga0207706_103730332 133
423 3300025936 Ga0207670_11042959 Ga0207670_110429592 133
424 3300025938 Ga0207704_10742054 Ga0207704_107420542 133
425 3300025939 Ga0207665_10031767 Ga0207665_100317675 133
426 3300025940 Ga0207691_10101143 Ga0207691_101011434 133
427 3300025941 Ga0207711_10001672 Ga0207711_1000167210 133
428 3300025941 Ga0207711_10002775 Ga0207711_1000277515 133
429 3300025941 Ga0207711_10007788 Ga0207711_1000778812 133
430 3300025941 Ga0207711_10017259 Ga0207711_100172593 133
431 3300025941 Ga0207711_10034134 Ga0207711_100341344 133
432 3300025941 Ga0207711_10325449 Ga0207711_103254491 133
433 3300025941 Ga0207711_10776418 Ga0207711_107764181 133
434 3300025944 Ga0207661_10009989 Ga0207661_100099896 133
435 3300025944 Ga0207661_10069112 Ga0207661_100691124 133
436 3300025945 Ga0207679_10000323 Ga0207679_100003238 133
437 3300025945 Ga0207679_10002496 Ga0207679_100024961 133
438 3300025945 Ga0207679_10010685 Ga0207679_100106859 133
439 3300025945 Ga0207679_10057290 Ga0207679_100572904 133
440 3300025945 Ga0207679_10240900 Ga0207679_102409004 133
441 3300025949 Ga0207667_10001713 Ga0207667_1000171313 133
442 3300025949 Ga0207667_10130488 Ga0207667_101304885 133
443 3300025949 Ga0207667_10341252 Ga0207667_103412521 133
444 3300025949 Ga0207667_10473727 Ga0207667_104737272 133
445 3300025960 Ga0207651_10051185 Ga0207651_100511855 133
446 3300025960 Ga0207651_10238616 Ga0207651_102386162 133
447 3300025972 Ga0207668_10614217 Ga0207668_106142173 133
448 3300025972 Ga0207668_11991086 Ga0207668_119910861 133
449 3300025981 Ga0207640_10035701 Ga0207640_100357014 133
450 3300025981 Ga0207640_10315605 Ga0207640_103156054 133
451 3300025981 Ga0207640_10484927 Ga0207640_104849273 133
452 3300025981 Ga0207640_10739229 Ga0207640_107392291 133
453 3300025986 Ga0207658_10002162 Ga0207658_100021629 133
454 3300025986 Ga0207658_10011931 Ga0207658_100119318 133
455 3300025986 Ga0207658_10115900 Ga0207658_101159004 133
456 3300025986 Ga0207658_10197710 Ga0207658_101977102 133
457 3300025986 Ga0207658_10684104 Ga0207658_106841042 133
458 3300025986 Ga0207658_10988573 Ga0207658_109885732 133
459 3300025986 Ga0207658_11512333 Ga0207658_115123332 133
460 3300025986 Ga0207658_11815576 Ga0207658_118155762 133
461 3300026023 Ga0207677_10198697 Ga0207677_101986974 133
462 3300026035 Ga0207703_10015871 Ga0207703_100158716 133
463 3300026035 Ga0207703_10032483 Ga0207703_100324837 133
464 3300026035 Ga0207703_11591378 Ga0207703_115913781 133
465 3300026041 Ga0207639_10000581 Ga0207639_1000058114 133
466 3300026041 Ga0207639_10001048 Ga0207639_100010484 133
467 3300026041 Ga0207639_10037630 Ga0207639_100376302 133
468 3300026067 Ga0207678_10001573 Ga0207678_100015736 133
469 3300026067 Ga0207678_10002050 Ga0207678_1000205012 133
470 3300026067 Ga0207678_10007031 Ga0207678_100070311 133
471 3300026067 Ga0207678_10086442 Ga0207678_100864425 133
472 3300026067 Ga0207678_10369744 Ga0207678_103697441 133
473 3300026078 Ga0207702_10000840 Ga0207702_100008404 133
474 3300026078 Ga0207702_10020138 Ga0207702_100201387 133
475 3300026078 Ga0207702_10089954 Ga0207702_100899543 133
476 3300026078 Ga0207702_10352276 Ga0207702_103522762 133
477 3300026088 Ga0207641_10070617 Ga0207641_100706172 133
478 3300026088 Ga0207641_10081185 Ga0207641_100811854 133
479 3300026088 Ga0207641_10102800 Ga0207641_101028004 133
480 3300026088 Ga0207641_10737945 Ga0207641_107379452 133
481 3300026095 Ga0207676_10053848 Ga0207676_100538484 133
482 3300026095 Ga0207676_10071277 Ga0207676_100712773 133
483 3300026095 Ga0207676_10075659 Ga0207676_100756594 133
484 3300026116 Ga0207674_10012841 Ga0207674_100128417 133
485 3300026116 Ga0207674_10435063 Ga0207674_104350631 133
486 3300026121 Ga0207683_10013466 Ga0207683_100134662 133
487 3300026121 Ga0207683_10367758 Ga0207683_103677583 133
488 3300026142 Ga0207698_10009494 Ga0207698_100094948 133
489 3300026142 Ga0207698_10031823 Ga0207698_100318235 133
490 3300026142 Ga0207698_10087957 Ga0207698_100879572 133
491 3300026142 Ga0207698_10339531 Ga0207698_103395314 133
492 3300026142 Ga0207698_10361245 Ga0207698_103612452 133
493 3300026142 Ga0207698_11744979 Ga0207698_117449791 133
494 3300028379 Ga0268266_10002202 Ga0268266_1000220218 133
495 3300028379 Ga0268266_10036833 Ga0268266_100368337 133
496 3300028379 Ga0268266_10968065 Ga0268266_109680652 133
497 3300028379 Ga0268266_11020310 Ga0268266_110203101 133
498 3300028380 Ga0268265_10003811 Ga0268265_1000381113 133
499 3300028381 Ga0268264_11948877 Ga0268264_119488771 133
500 3300032002 Ga0307416_100008977 Ga0307416_1000089778 133
501 3300032126 Ga0307415_100009240 Ga0307415_1000092402 133
502 3300034820 Ga0373959_0057149 Ga0373959_0057149_223_624 133
503 3300035092 Ga0373952_0291880 Ga0373952_0291880_36_437 133
504 3300035121 Ga0373960_0008950 Ga0373960_0008950_1115_1516 133
505 3300035170 Ga0373943_0527738 Ga0373943_0527738_232_648 133
506 3300035207 Ga0373942_0327896 Ga0373942_0327896_42_443 133
507 3300035691 Ga0373931_0035529 Ga0373931_0035529_1457_1858 133
508 3300035692 Ga0373935_0013911 Ga0373935_0013911_3465_3881 133
509 3300035725 Ga0373947_1121653 Ga0373947_1121653_32_448 133
510 3300037312 Ga0395899_0051839 Ga0395899_0051839_2530_2943 133
511 3300037312 Ga0395899_0177100 Ga0395899_0177100_714_1118 133
512 3300037312 Ga0395899_0189963 Ga0395899_0189963_218_619 133
513 3300037312 Ga0395899_0315200 Ga0395899_0315200_543_944 133
514 3300037418 Ga0395900_0001168 Ga0395900_0001168_499_912 133
515 3300037418 Ga0395900_0004276 Ga0395900_0004276_12706_13110 133
516 3300037418 Ga0395900_0009144 Ga0395900_0009144_7834_8235 133
517 3300037418 Ga0395900_0033727 Ga0395900_0033727_1190_1591 133
518 3300037418 Ga0395900_0042482 Ga0395900_0042482_534_935 133
519 3300037418 Ga0395900_0061180 Ga0395900_0061180_2397_2798 133
520 3300037418 Ga0395900_0220156 Ga0395900_0220156_506_907 133
521 3300037418 Ga0395900_0392347 Ga0395900_0392347_367_780 133
522 3300037418 Ga0395900_0731686 Ga0395900_0731686_180_581 133
523 3300037418 Ga0395900_1090992 Ga0395900_1090992_248_649 133
524 3300037466 Ga0395898_0047080 Ga0395898_0047080_289_702 133
525 3300037466 Ga0395898_0199728 Ga0395898_0199728_918_1319 133
526 3300037471 Ga0395905_0001952 Ga0395905_0001952_2522_2935 133
527 3300037471 Ga0395905_0002564 Ga0395905_0002564_19279_19680 133
528 3300037471 Ga0395905_0004681 Ga0395905_0004681_12641_13042 133
529 3300037471 Ga0395905_0059465 Ga0395905_0059465_2707_3108 133
530 3300037471 Ga0395905_0135702 Ga0395905_0135702_988_1389 133
531 3300037471 Ga0395905_0136147 Ga0395905_0136147_1532_1945 133
532 3300037471 Ga0395905_0235628 Ga0395905_0235628_137_538 133
533 3300037471 Ga0395905_0282453 Ga0395905_0282453_423_824 133
534 3300037471 Ga0395905_0864401 Ga0395905_0864401_119_520 133
535 3300037471 Ga0395905_0991825 Ga0395905_0991825_327_728 133
536 3300038443 Ga0395901_0000471 Ga0395901_0000471_6850_7254 133
537 3300038443 Ga0395901_0014921 Ga0395901_0014921_4705_5106 133
538 3300038443 Ga0395901_0034872 Ga0395901_0034872_3049_3462 133
539 3300038443 Ga0395901_0066808 Ga0395901_0066808_697_1098 133
540 3300038443 Ga0395901_0128972 Ga0395901_0128972_507_908 133
541 3300038443 Ga0395901_0824491 Ga0395901_0824491_182_583 133
542 3300042012 Ga0439455_0044985 Ga0439455_0044985_669_1082 133
543 3300044656 Ga0466969_0185563 Ga0466969_0185563_27_440 133
544 3300044658 Ga0466972_0134516 Ga0466972_0134516_142_555 133
545 3300044658 Ga0466972_0274093 Ga0466972_0274093_139_540 133
546 3300044706 Ga0466964_0102548 Ga0466964_0102548_815_1228 133
547 3300044735 Ga0466968_0174026 Ga0466968_0174026_558_971 133
548 3300044765 Ga0466970_0079863 Ga0466970_0079863_1246_1659 133
549 3300044765 Ga0466970_0165659 Ga0466970_0165659_85_498 133
550 3300045049 Ga0466959_0067575 Ga0466959_0067575_892_1305 133
551 3300045976 Ga0466967_0617751 Ga0466967_0617751_317_730 133
552 3300046459 Ga0495629_0521001 Ga0495629_0521001_141_542 133
553 3300046472 Ga0495580_0377850 Ga0495580_0377850_26_427 133
554 3300046522 Ga0495643_0299922 Ga0495643_0299922_121_522 133
555 3300046528 Ga0495642_0374210 Ga0495642_0374210_68_481 133
556 3300046616 Ga0495668_0134041 Ga0495668_0134041_23_424 133
557 3300046684 Ga0495669_0107084 Ga0495669_0107084_661_1074 133
558 3300048903 Ga0496100_0225602 Ga0496100_0225602_774_1175 133
559 3300048904 Ga0496101_0008886 Ga0496101_0008886_4046_4447 133
560 3300048909 Ga0496106_0077807 Ga0496106_0077807_1923_2324 133
561 3300048910 Ga0496107_0009652 Ga0496107_0009652_2895_3296 133
562 3300048910 Ga0496107_0200643 Ga0496107_0200643_326_727 133
563 3300048910 Ga0496107_0214334 Ga0496107_0214334_87_488 133
564 3300048910 Ga0496107_0681857 Ga0496107_0681857_42_443 133
565 3300048911 Ga0496108_0003963 Ga0496108_0003963_128_529 133
566 3300048911 Ga0496108_0026410 Ga0496108_0026410_2114_2515 133
567 3300048912 Ga0496109_0046491 Ga0496109_0046491_1970_2371 133
568 3300048912 Ga0496109_0821575 Ga0496109_0821575_214_615 133
569 3300048912 Ga0496109_1102120 Ga0496109_1102120_170_571 133
570 3300048913 Ga0496110_0067103 Ga0496110_0067103_1565_1966 133
571 3300048913 Ga0496110_0088202 Ga0496110_0088202_277_678 133
572 3300048914 Ga0496111_0151618 Ga0496111_0151618_1179_1580 133
573 3300048914 Ga0496111_0211041 Ga0496111_0211041_978_1379 133
574 3300048915 Ga0496112_0016706 Ga0496112_0016706_1404_1805 133
575 3300048915 Ga0496112_1345931 Ga0496112_1345931_37_438 133
576 3300048916 Ga0496113_0022411 Ga0496113_0022411_1940_2341 133
577 3300048917 Ga0496114_0148202 Ga0496114_0148202_140_541 133
578 3300048918 Ga0496115_0046562 Ga0496115_0046562_2541_2942 133
579 3300050514 nmdc:mga08x19_333518_c1 nmdc:mga08x19_333518_c1_253_654 133
580 3300061719 Ga0466962_0197576 Ga0466962_0197576_160_573 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06676

DUF1178

Protein of unknown function (DUF1178)

1

132

0.93

Feature Viewer

pLDDT pTM Quality
87.19 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map