F465954

General Info

Members Datasets Scaffolds Average Seq Length
580 228 1160 247

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10367744|Ga0207681_103677441
Length 288
Sequence MRSPLALLPPEGGSYKTRIGLSPLIIVAIAVVMGGPMPAAQQPAAGAGAPAGLPPLFLREGWRQLERPPGAAADFVAEGGVTPAAVTNADLELRLYDPNAKSVPSYLKQPPTGSIARDWGGPSCIQLAGYNQNPPPQKVSAGAATDPPNLWTGVCQTSVAVTLRHKRSYVDLTGLARIRWITRTSGFHVVRPVLKLADGTWLVGDYGEGAHSSNSTLFLDSELAIANVRWLPLDITRVVTRGQGWVEKPDLKKVDEVGFADLLPGSGHGWGGFVNVGRIEVYGRAVAR

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.59
Rhizosphere 97.07
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10367744 3300025923 Bacteria 1155
2 JGI24746J21847_1002097 3300001977 Bacteria 3189
3 Ga0065714_10093737 3300005288 Bacteria 1838
4 Ga0065712_10068892 3300005290 Bacteria 8643
5 Ga0065715_10008335 3300005293 Bacteria 2500
6 Ga0065707_10007339 3300005295 Bacteria 3746
7 Ga0070676_10005790 3300005328 Bacteria 6587
8 Ga0070676_10056483 3300005328 Unclassified 2320
9 Ga0070683_100132947 3300005329 Bacteria 2355
10 Ga0070683_100163822 3300005329 Unclassified 2109
11 Ga0070683_100350522 3300005329 Unclassified 1406
12 Ga0070690_100040359 3300005330 Bacteria 2952
13 Ga0070670_100001535 3300005331 Bacteria 18607
14 Ga0070670_100005083 3300005331 Bacteria 11069
15 Ga0070670_100031666 3300005331 Bacteria 4555
16 Ga0070670_100115134 3300005331 Bacteria 2318
17 Ga0070670_100431063 3300005331 Unclassified 1166
18 Ga0070677_10003688 3300005333 Bacteria 4950
19 Ga0070677_10151634 3300005333 Bacteria 1079
20 Ga0068869_100011928 3300005334 Bacteria 5719
21 Ga0068869_100014973 3300005334 Bacteria 5187
22 Ga0068869_100061900 3300005334 Bacteria 2746
23 Ga0068869_100081504 3300005334 Unclassified 2416
24 Ga0068869_100129816 3300005334 Bacteria 1936
25 Ga0068869_100496593 3300005334 Bacteria 1018
26 Ga0070666_10017745 3300005335 Bacteria 4566
27 Ga0070666_10054909 3300005335 Bacteria 2688
28 Ga0070666_10100178 3300005335 Bacteria 1996
29 Ga0070666_10162526 3300005335 Bacteria 1561
30 Ga0070666_10218744 3300005335 Unclassified 1343
31 Ga0070660_100306890 3300005339 Unclassified 1302
32 Ga0070689_100015973 3300005340 Bacteria 5488
33 Ga0070689_100101585 3300005340 Bacteria 2276
34 Ga0070687_100004005 3300005343 Bacteria 5812
35 Ga0070661_100003108 3300005344 Bacteria 11423
36 Ga0070661_100430177 3300005344 Bacteria 1047
37 Ga0070692_10032139 3300005345 Bacteria 2636
38 Ga0070668_100227649 3300005347 Bacteria 1540
39 Ga0070668_100400179 3300005347 Bacteria 1172
40 Ga0070669_100007002 3300005353 Bacteria 8104
41 Ga0070669_100019054 3300005353 Bacteria 4905
42 Ga0070669_100073686 3300005353 Bacteria 2530
43 Ga0070669_100136952 3300005353 Bacteria 1884
44 Ga0070675_100000267 3300005354 Bacteria 34364
45 Ga0070675_100001418 3300005354 Bacteria 17601
46 Ga0070675_100001820 3300005354 Bacteria 15787
47 Ga0070675_100012610 3300005354 Bacteria 6628
48 Ga0070675_100014917 3300005354 Bacteria 6136
49 Ga0070675_100028557 3300005354 Bacteria 4490
50 Ga0070675_100046762 3300005354 Bacteria 3545
51 Ga0070675_100079554 3300005354 Bacteria 2731
52 Ga0070675_100122125 3300005354 Bacteria 2213
53 Ga0070675_100181082 3300005354 Bacteria 1822
54 Ga0070675_100248369 3300005354 Bacteria 1556
55 Ga0070675_100251875 3300005354 Unclassified 1546
56 Ga0070675_100430134 3300005354 Bacteria 1181
57 Ga0070671_100036963 3300005355 Bacteria 4049
58 Ga0070671_100192175 3300005355 Unclassified 1730
59 Ga0070671_100333203 3300005355 Unclassified 1294
60 Ga0070674_100000528 3300005356 Bacteria 19236
61 Ga0070674_100058792 3300005356 Bacteria 2674
62 Ga0070674_100072072 3300005356 Bacteria 2445
63 Ga0070674_100080810 3300005356 Bacteria 2322
64 Ga0070674_100199065 3300005356 Bacteria 1546
65 Ga0070674_100317364 3300005356 Bacteria 1248
66 Ga0070674_100326646 3300005356 Unclassified 1232
67 Ga0070673_100006697 3300005364 Bacteria 7510
68 Ga0070673_100022406 3300005364 Bacteria 4597
69 Ga0070673_100148390 3300005364 Unclassified 1984
70 Ga0070673_100217436 3300005364 Bacteria 1652
71 Ga0070673_100320480 3300005364 Unclassified 1369
72 Ga0070688_100007177 3300005365 Bacteria 6000
73 Ga0070688_100012816 3300005365 Bacteria 4708
74 Ga0070688_100041298 3300005365 Bacteria 2831
75 Ga0070688_100130240 3300005365 Bacteria 1696
76 Ga0070688_100400584 3300005365 Unclassified 1016
77 Ga0070688_100415343 3300005365 Unclassified 999
78 Ga0070667_100006325 3300005367 Bacteria 9843
79 Ga0070667_100130368 3300005367 Bacteria 2194
80 Ga0070709_10667453 3300005434 Unclassified 806
81 Ga0070713_100079247 3300005436 Bacteria 2798
82 Ga0070713_100309577 3300005436 Unclassified 1456
83 Ga0070701_10037584 3300005438 Bacteria 2446
84 Ga0070701_10048940 3300005438 Bacteria 2184
85 Ga0070711_100788568 3300005439 Bacteria 805
86 Ga0070700_100036968 3300005441 Bacteria 2966
87 Ga0070700_100193084 3300005441 Bacteria 1425
88 Ga0070700_100568330 3300005441 Unclassified 884
89 Ga0070694_100043183 3300005444 Bacteria 3014
90 Ga0070694_100220667 3300005444 Bacteria 1422
91 Ga0070708_100677615 3300005445 Unclassified 971
92 Ga0070663_100449191 3300005455 Unclassified 1062
93 Ga0070678_100023265 3300005456 Bacteria 4126
94 Ga0070678_100081834 3300005456 Bacteria 2449
95 Ga0070678_100172307 3300005456 Bacteria 1764
96 Ga0070678_100272179 3300005456 Bacteria 1429
97 Ga0070662_100012540 3300005457 Bacteria 5623
98 Ga0070681_10326416 3300005458 Bacteria 1444
99 Ga0068867_100014063 3300005459 Bacteria 5668
100 Ga0068867_100122881 3300005459 Bacteria 2008
101 Ga0070685_10061027 3300005466 Bacteria 2207
102 Ga0070685_10101186 3300005466 Bacteria 1760
103 Ga0070685_10356857 3300005466 Unclassified 1001
104 Ga0070685_10368985 3300005466 Unclassified 986
105 Ga0070707_100425492 3300005468 Bacteria 1288
106 Ga0070707_100761641 3300005468 Unclassified 932
107 Ga0070679_100218752 3300005530 Bacteria 1866
108 Ga0070684_100193184 3300005535 Bacteria 1853
109 Ga0070684_100207582 3300005535 Bacteria 1785
110 Ga0070684_100228908 3300005535 Unclassified 1697
111 Ga0070684_100231245 3300005535 Bacteria 1688
112 Ga0068853_100318605 3300005539 Unclassified 1441
113 Ga0070672_100005236 3300005543 Bacteria 8583
114 Ga0070672_100007766 3300005543 Bacteria 7313
115 Ga0070672_100044669 3300005543 Bacteria 3424
116 Ga0070672_100078131 3300005543 Bacteria 2648
117 Ga0070672_100105431 3300005543 Bacteria 2292
118 Ga0070672_100177590 3300005543 Bacteria 1773
119 Ga0070672_100547295 3300005543 Unclassified 1005
120 Ga0070672_100580554 3300005543 Archaea 975
121 Ga0070686_100068234 3300005544 Unclassified 2319
122 Ga0070693_100183408 3300005547 Unclassified 1349
123 Ga0070665_100030337 3300005548 Bacteria 5442
124 Ga0070704_100040513 3300005549 Bacteria 3207
125 Ga0070704_100581258 3300005549 Unclassified 982
126 Ga0068855_100031045 3300005563 Bacteria 6384
127 Ga0068855_100635860 3300005563 Bacteria 1147
128 Ga0070664_100002082 3300005564 Bacteria 15985
129 Ga0070664_100042338 3300005564 Bacteria 3845
130 Ga0070664_100107697 3300005564 Bacteria 2430
131 Ga0068857_100009074 3300005577 Bacteria 8625
132 Ga0068857_100421145 3300005577 Unclassified 1245
133 Ga0068854_100734967 3300005578 Unclassified 855
134 Ga0068856_100828568 3300005614 Bacteria 944
135 Ga0070702_100278516 3300005615 Unclassified 1147
136 Ga0070702_100344711 3300005615 Unclassified 1047
137 Ga0068852_100080213 3300005616 Bacteria 2893
138 Ga0068852_100739732 3300005616 Unclassified 995
139 Ga0068859_100000967 3300005617 Bacteria 29415
140 Ga0068859_100052689 3300005617 Unclassified 4092
141 Ga0068859_100113112 3300005617 Bacteria 2778
142 Ga0068859_100128711 3300005617 Bacteria 2602
143 Ga0068859_100187427 3300005617 Bacteria 2153
144 Ga0068864_100072336 3300005618 Bacteria 3004
145 Ga0068864_100220791 3300005618 Bacteria 1748
146 Ga0068864_100239616 3300005618 Bacteria 1680
147 Ga0068864_100269263 3300005618 Bacteria 1587
148 Ga0068864_100476801 3300005618 Bacteria 1197
149 Ga0068866_10140488 3300005718 Unclassified 1386
150 Ga0068866_10465413 3300005718 Unclassified 830
151 Ga0068861_100015498 3300005719 Bacteria 5373
152 Ga0068861_100033346 3300005719 Bacteria 3798
153 Ga0068861_100309273 3300005719 Unclassified 1372
154 Ga0068861_100328197 3300005719 Bacteria 1335
155 Ga0068870_10022165 3300005840 Bacteria 3118
156 Ga0068870_10130508 3300005840 Unclassified 1459
157 Ga0068863_100000478 3300005841 Bacteria 41029
158 Ga0068863_100226145 3300005841 Bacteria 1804
159 Ga0068858_100007322 3300005842 Bacteria 10685
160 Ga0068858_100042213 3300005842 Bacteria 4229
161 Ga0068858_100080560 3300005842 Bacteria 3025
162 Ga0068858_100162351 3300005842 Bacteria 2104
163 Ga0068860_100026781 3300005843 Bacteria 5556
164 Ga0068860_100080543 3300005843 Bacteria 3096
165 Ga0068860_100110447 3300005843 Unclassified 2628
166 Ga0068860_100508027 3300005843 Bacteria 1204
167 Ga0068862_100002399 3300005844 Bacteria 16666
168 Ga0068862_100366660 3300005844 Unclassified 1340
169 Ga0068862_100420743 3300005844 Unclassified 1254
170 Ga0068862_100896990 3300005844 Bacteria 871
171 Ga0081539_10128201 3300005985 Unclassified 1250
172 Ga0070717_10487472 3300006028 Unclassified 1113
173 Ga0070715_10033370 3300006163 Bacteria 2103
174 Ga0097621_100000043 3300006237 Bacteria 65396
175 Ga0097621_100027446 3300006237 Bacteria 4477
176 Ga0097621_100104261 3300006237 Unclassified 2389
177 Ga0097621_100159209 3300006237 Bacteria 1940
178 Ga0097621_100285557 3300006237 Bacteria 1454
179 Ga0097621_100356126 3300006237 Unclassified 1303
180 Ga0097621_100516338 3300006237 Unclassified 1084
181 Ga0068871_100000194 3300006358 Bacteria 41868
182 Ga0068871_100031691 3300006358 Bacteria 4170
183 Ga0068871_100034356 3300006358 Bacteria 4023
184 Ga0068871_100063654 3300006358 Bacteria 3017
185 Ga0068871_100115778 3300006358 Bacteria 2260
186 Ga0068871_100438082 3300006358 Unclassified 1169
187 Ga0068871_100445400 3300006358 Unclassified 1160
188 Ga0068871_100634274 3300006358 Bacteria 974
189 Ga0075428_100007177 3300006844 Bacteria 12337
190 Ga0075428_100008359 3300006844 Bacteria 11476
191 Ga0075428_100179183 3300006844 Unclassified 2294
192 Ga0075428_100306717 3300006844 Bacteria 1706
193 Ga0075430_100025297 3300006846 Bacteria 5050
194 Ga0075430_100065442 3300006846 Unclassified 3054
195 Ga0075430_100085923 3300006846 Unclassified 2634
196 Ga0075430_100088584 3300006846 Bacteria 2590
197 Ga0075430_100371023 3300006846 Bacteria 1181
198 Ga0075431_100107983 3300006847 Bacteria 2872
199 Ga0075431_100171853 3300006847 Unclassified 2226
200 Ga0075433_10002247 3300006852 Bacteria 14659
201 Ga0075433_10012461 3300006852 Bacteria 6873
202 Ga0075433_10047778 3300006852 Bacteria 3723
203 Ga0075433_10308639 3300006852 Bacteria 1400
204 Ga0075434_100009424 3300006871 Bacteria 9101
205 Ga0075434_100010285 3300006871 Bacteria 8767
206 Ga0075434_100016123 3300006871 Bacteria 7181
207 Ga0075434_100050410 3300006871 Bacteria 4135
208 Ga0075429_100062159 3300006880 Unclassified 3254
209 Ga0075429_100068326 3300006880 Bacteria 3092
210 Ga0075429_100073244 3300006880 Bacteria 2983
211 Ga0075429_100081008 3300006880 Bacteria 2831
212 Ga0068865_100001483 3300006881 Bacteria 13664
213 Ga0068865_100013070 3300006881 Bacteria 5237
214 Ga0068865_100024853 3300006881 Bacteria 3935
215 Ga0097620_100000967 3300006931 Bacteria 29415
216 Ga0097620_100052685 3300006931 Unclassified 4092
217 Ga0097620_100113109 3300006931 Bacteria 2778
218 Ga0097620_100128715 3300006931 Bacteria 2602
219 Ga0097620_100187428 3300006931 Bacteria 2153
220 Ga0075435_100015489 3300007076 Bacteria 5733
221 Ga0075435_100178751 3300007076 Bacteria 1793
222 Ga0075435_100460896 3300007076 Bacteria 1096
223 Ga0105240_10092071 3300009093 Bacteria 3702
224 Ga0105240_10760153 3300009093 Unclassified 1053
225 Ga0111539_10000161 3300009094 Bacteria 76584
226 Ga0111539_10000577 3300009094 Bacteria 47124
227 Ga0111539_10004416 3300009094 Bacteria 18385
228 Ga0111539_10008503 3300009094 Bacteria 13045
229 Ga0111539_10009164 3300009094 Bacteria 12518
230 Ga0111539_10290990 3300009094 Unclassified 1901
231 Ga0111539_10603722 3300009094 Unclassified 1278
232 Ga0111539_10636222 3300009094 Unclassified 1242
233 Ga0111539_10643328 3300009094 Unclassified 1235
234 Ga0105245_10023647 3300009098 Bacteria 5394
235 Ga0105245_10161567 3300009098 Bacteria 2126
236 Ga0105247_10022582 3300009101 Bacteria 3789
237 Ga0105247_10208917 3300009101 Bacteria 1316
238 Ga0105247_10244551 3300009101 Bacteria 1224
239 Ga0105247_10461027 3300009101 Unclassified 918
240 Ga0114129_10010595 3300009147 Bacteria 13145
241 Ga0114129_10261389 3300009147 Unclassified 2320
242 Ga0114129_10291685 3300009147 Unclassified 2177
243 Ga0105243_10030476 3300009148 Bacteria 4153
244 Ga0105243_10675926 3300009148 Bacteria 1003
245 Ga0105241_10132110 3300009174 Bacteria 2022
246 Ga0105242_10007739 3300009176 Bacteria 8266
247 Ga0105242_10015664 3300009176 Bacteria 5889
248 Ga0105242_10021496 3300009176 Bacteria 5068
249 Ga0105242_10141113 3300009176 Bacteria 2091
250 Ga0105242_10569259 3300009176 Unclassified 1089
251 Ga0105248_10000867 3300009177 Bacteria 33991
252 Ga0105248_10001910 3300009177 Bacteria 23122
253 Ga0105248_10033986 3300009177 Bacteria 5700
254 Ga0105248_10053840 3300009177 Bacteria 4514
255 Ga0105248_10203655 3300009177 Bacteria 2230
256 Ga0105248_10674447 3300009177 Bacteria 1166
257 Ga0105237_10309473 3300009545 Bacteria 1583
258 Ga0105238_10008290 3300009551 Bacteria 10392
259 Ga0105238_10085548 3300009551 Unclassified 3141
260 Ga0105239_10109987 3300010375 Unclassified 3054
261 Ga0105239_10326026 3300010375 Unclassified 1732
262 Ga0105246_11006097 3300011119 Unclassified 755
263 Ga0157370_10005543 3300013104 Bacteria 14153
264 Ga0157370_10243593 3300013104 Unclassified 1663
265 Ga0157369_10198195 3300013105 Bacteria 2108
266 Ga0157374_10046453 3300013296 Bacteria 4021
267 Ga0157374_10347143 3300013296 Unclassified 1474
268 Ga0157374_10541336 3300013296 Bacteria 1171
269 Ga0157378_10013226 3300013297 Bacteria 7216
270 Ga0157378_10311718 3300013297 Bacteria 1526
271 Ga0163162_10008221 3300013306 Bacteria 10182
272 Ga0163162_10011893 3300013306 Bacteria 8489
273 Ga0163162_10070921 3300013306 Bacteria 3536
274 Ga0163162_10095549 3300013306 Bacteria 3059
275 Ga0163162_10418353 3300013306 Unclassified 1472
276 Ga0163162_10462363 3300013306 Unclassified 1400
277 Ga0157372_10278882 3300013307 Unclassified 1943
278 Ga0157375_10000105 3300013308 Bacteria 82289
279 Ga0157375_10088942 3300013308 Unclassified 3144
280 Ga0157375_10205824 3300013308 Bacteria 2124
281 Ga0157375_10272468 3300013308 Unclassified 1855
282 Ga0163163_10017963 3300014325 Bacteria 6608
283 Ga0163163_10025202 3300014325 Bacteria 5669
284 Ga0163163_10034946 3300014325 Bacteria 4873
285 Ga0163163_10036149 3300014325 Bacteria 4796
286 Ga0163163_10070420 3300014325 Bacteria 3483
287 Ga0163163_11286082 3300014325 Unclassified 794
288 Ga0157380_10004252 3300014326 Bacteria 9908
289 Ga0157380_10022929 3300014326 Bacteria 4707
290 Ga0157380_10025098 3300014326 Bacteria 4518
291 Ga0157380_10050503 3300014326 Bacteria 3286
292 Ga0157380_10065126 3300014326 Bacteria 2928
293 Ga0157380_10258351 3300014326 Unclassified 1581
294 Ga0157377_10019070 3300014745 Bacteria 3579
295 Ga0157377_10019650 3300014745 Bacteria 3531
296 Ga0157377_10071579 3300014745 Bacteria 2006
297 Ga0157377_10080333 3300014745 Bacteria 1905
298 Ga0157377_10098063 3300014745 Bacteria 1741
299 Ga0157379_10000223 3300014968 Bacteria 44424
300 Ga0157379_10064086 3300014968 Bacteria 3285
301 Ga0157379_10363328 3300014968 Unclassified 1327
302 Ga0157379_10415078 3300014968 Bacteria 1239
303 Ga0157376_10000370 3300014969 Bacteria 29552
304 Ga0157376_10018839 3300014969 Bacteria 5305
305 Ga0157376_10033679 3300014969 Unclassified 4127
306 Ga0157376_10039431 3300014969 Bacteria 3852
307 Ga0157376_10192159 3300014969 Unclassified 1873
308 Ga0157376_10335348 3300014969 Bacteria 1442
309 Ga0157376_10408913 3300014969 Bacteria 1314
310 Ga0157376_10687386 3300014969 Unclassified 1027
311 Ga0163161_10015653 3300017792 Bacteria 5289
312 Ga0163161_10385471 3300017792 Bacteria 1121
313 Ga0213876_10235695 3300021384 Bacteria 973
314 Ga0207697_10000814 3300025315 Bacteria 17672
315 Ga0207682_10000770 3300025893 Bacteria 14797
316 Ga0207682_10007089 3300025893 Unclassified 4489
317 Ga0207682_10039667 3300025893 Unclassified 1916
318 Ga0207710_10032075 3300025900 Bacteria 2301
319 Ga0207688_10000771 3300025901 Bacteria 15946
320 Ga0207688_10163171 3300025901 Bacteria 1322
321 Ga0207680_10009023 3300025903 Bacteria 4925
322 Ga0207680_10201362 3300025903 Unclassified 1357
323 Ga0207680_10394962 3300025903 Bacteria 977
324 Ga0207699_10064329 3300025906 Bacteria 2219
325 Ga0207645_10000922 3300025907 Bacteria 24408
326 Ga0207645_10181436 3300025907 Unclassified 1381
327 Ga0207643_10001581 3300025908 Bacteria 12898
328 Ga0207643_10015371 3300025908 Bacteria 4166
329 Ga0207707_10100988 3300025912 Unclassified 2521
330 Ga0207695_10037945 3300025913 Bacteria 5194
331 Ga0207662_10003153 3300025918 Bacteria 8427
332 Ga0207649_10019067 3300025920 Bacteria 3917
333 Ga0207649_10294250 3300025920 Unclassified 1185
334 Ga0207652_10079225 3300025921 Unclassified 2870
335 Ga0207646_10273497 3300025922 Unclassified 1527
336 Ga0207646_10349051 3300025922 Bacteria 1337
337 Ga0207681_10007603 3300025923 Bacteria 6641
338 Ga0207681_10026687 3300025923 Bacteria 3728
339 Ga0207681_10088832 3300025923 Bacteria 2202
340 Ga0207681_10107700 3300025923 Bacteria 2022
341 Ga0207681_10405376 3300025923 Unclassified 1102
342 Ga0207694_10024548 3300025924 Bacteria 4579
343 Ga0207694_10035698 3300025924 Bacteria 3814
344 Ga0207650_10049737 3300025925 Bacteria 3097
345 Ga0207650_10076541 3300025925 Bacteria 2528
346 Ga0207650_10100904 3300025925 Bacteria 2221
347 Ga0207650_10447020 3300025925 Unclassified 1075
348 Ga0207659_10000967 3300025926 Bacteria 17159
349 Ga0207659_10003984 3300025926 Bacteria 8910
350 Ga0207659_10005049 3300025926 Bacteria 8003
351 Ga0207659_10007167 3300025926 Bacteria 6843
352 Ga0207659_10016287 3300025926 Bacteria 4836
353 Ga0207659_10029207 3300025926 Bacteria 3756
354 Ga0207659_10064857 3300025926 Bacteria 2645
355 Ga0207659_10070846 3300025926 Bacteria 2543
356 Ga0207659_10074221 3300025926 Bacteria 2493
357 Ga0207659_10188510 3300025926 Bacteria 1640
358 Ga0207659_10336660 3300025926 Unclassified 1249
359 Ga0207659_10408645 3300025926 Bacteria 1137
360 Ga0207687_10023475 3300025927 Bacteria 4112
361 Ga0207700_10256717 3300025928 Bacteria 1495
362 Ga0207644_10010848 3300025931 Bacteria 6016
363 Ga0207644_10099302 3300025931 Unclassified 2184
364 Ga0207706_10001352 3300025933 Bacteria 24484
365 Ga0207706_10017734 3300025933 Bacteria 6412
366 Ga0207706_10088051 3300025933 Bacteria 2730
367 Ga0207706_10420246 3300025933 Unclassified 1158
368 Ga0207686_10002845 3300025934 Bacteria 9341
369 Ga0207686_10005627 3300025934 Bacteria 6715
370 Ga0207686_10286109 3300025934 Unclassified 1219
371 Ga0207670_10003072 3300025936 Bacteria 8816
372 Ga0207670_10104826 3300025936 Bacteria 2026
373 Ga0207670_10334484 3300025936 Bacteria 1195
374 Ga0207669_10002722 3300025937 Bacteria 7567
375 Ga0207669_10044378 3300025937 Bacteria 2611
376 Ga0207669_10074634 3300025937 Bacteria 2145
377 Ga0207669_10165052 3300025937 Bacteria 1569
378 Ga0207669_10500022 3300025937 Bacteria 972
379 Ga0207704_10000389 3300025938 Bacteria 20157
380 Ga0207704_10017872 3300025938 Bacteria 3687
381 Ga0207704_10027095 3300025938 Bacteria 3155
382 Ga0207691_10003439 3300025940 Bacteria 15403
383 Ga0207691_10003487 3300025940 Bacteria 15308
384 Ga0207691_10018176 3300025940 Bacteria 6660
385 Ga0207691_10032111 3300025940 Bacteria 4898
386 Ga0207691_10040441 3300025940 Unclassified 4307
387 Ga0207691_10051765 3300025940 Unclassified 3753
388 Ga0207691_10166741 3300025940 Bacteria 1930
389 Ga0207691_10182006 3300025940 Bacteria 1836
390 Ga0207711_10001195 3300025941 Bacteria 24603
391 Ga0207711_10122276 3300025941 Bacteria 2325
392 Ga0207711_10124637 3300025941 Unclassified 2303
393 Ga0207711_10892569 3300025941 Unclassified 826
394 Ga0207689_10002899 3300025942 Bacteria 15823
395 Ga0207689_10019859 3300025942 Bacteria 5661
396 Ga0207689_10022643 3300025942 Bacteria 5279
397 Ga0207689_10040926 3300025942 Bacteria 3834
398 Ga0207689_10041356 3300025942 Unclassified 3814
399 Ga0207689_10181357 3300025942 Unclassified 1736
400 Ga0207679_10007054 3300025945 Bacteria 7125
401 Ga0207679_10056394 3300025945 Bacteria 2900
402 Ga0207679_10521926 3300025945 Bacteria 1062
403 Ga0207651_10020859 3300025960 Bacteria 3966
404 Ga0207651_10040742 3300025960 Bacteria 3077
405 Ga0207651_10086697 3300025960 Bacteria 2276
406 Ga0207651_10263423 3300025960 Bacteria 1416
407 Ga0207668_10221035 3300025972 Bacteria 1521
408 Ga0207668_10467643 3300025972 Bacteria 1079
409 Ga0207658_10017875 3300025986 Bacteria 4887
410 Ga0207658_10124843 3300025986 Bacteria 2058
411 Ga0207677_10138568 3300026023 Bacteria 1859
412 Ga0207703_10010217 3300026035 Bacteria 7354
413 Ga0207703_10098732 3300026035 Unclassified 2470
414 Ga0207703_10133194 3300026035 Bacteria 2149
415 Ga0207703_10173357 3300026035 Bacteria 1899
416 Ga0207703_10269949 3300026035 Bacteria 1541
417 Ga0207703_10339529 3300026035 Bacteria 1380
418 Ga0207708_10053145 3300026075 Bacteria 3086
419 Ga0207708_10176658 3300026075 Bacteria 1694
420 Ga0207702_10375825 3300026078 Bacteria 1365
421 Ga0207641_10010923 3300026088 Bacteria 7440
422 Ga0207641_10012599 3300026088 Bacteria 6933
423 Ga0207641_10314677 3300026088 Bacteria 1483
424 Ga0207641_10907621 3300026088 Unclassified 875
425 Ga0207648_10006793 3300026089 Bacteria 11344
426 Ga0207648_10022040 3300026089 Bacteria 5722
427 Ga0207648_10101465 3300026089 Bacteria 2522
428 Ga0207648_10127817 3300026089 Bacteria 2236
429 Ga0207648_10145506 3300026089 Bacteria 2090
430 Ga0207676_10115480 3300026095 Bacteria 2254
431 Ga0207676_10169832 3300026095 Unclassified 1899
432 Ga0207674_10021695 3300026116 Bacteria 6913
433 Ga0207674_10103083 3300026116 Bacteria 2833
434 Ga0207674_10519872 3300026116 Bacteria 1150
435 Ga0207674_10658684 3300026116 Unclassified 1011
436 Ga0207674_10673824 3300026116 Bacteria 999
437 Ga0207675_100105752 3300026118 Bacteria 2653
438 Ga0207675_100126234 3300026118 Bacteria 2423
439 Ga0207675_100280839 3300026118 Unclassified 1618
440 Ga0207683_10010696 3300026121 Bacteria 7820
441 Ga0207683_10152369 3300026121 Bacteria 2087
442 Ga0207683_10352269 3300026121 Bacteria 1351
443 Ga0207683_10495526 3300026121 Bacteria 1128
444 Ga0207698_10132469 3300026142 Bacteria 2133
445 Ga0207428_10000186 3300027907 Bacteria 86221
446 Ga0207428_10002174 3300027907 Bacteria 19678
447 Ga0207428_10039960 3300027907 Bacteria 3808
448 Ga0207428_10042974 3300027907 Bacteria 3652
449 Ga0207428_10130080 3300027907 Unclassified 1927
450 Ga0207428_10153750 3300027907 Unclassified 1750
451 Ga0268266_10081336 3300028379 Unclassified 2824
452 Ga0268266_10250742 3300028379 Bacteria 1637
453 Ga0268265_10162304 3300028380 Bacteria 1900
454 Ga0268265_10299280 3300028380 Bacteria 1448
455 Ga0268265_10332738 3300028380 Unclassified 1380
456 Ga0268265_10681182 3300028380 Bacteria 991
457 Ga0268264_10021381 3300028381 Bacteria 5283
458 Ga0268264_10145894 3300028381 Unclassified 2116
459 Ga0268264_10228618 3300028381 Bacteria 1717
460 Ga0265338_10407441 3300028800 Bacteria 968
461 Ga0307408_100026177 3300031548 Unclassified 4003
462 Ga0307408_100213244 3300031548 Bacteria 1571
463 Ga0265314_10003465 3300031711 Bacteria 15240
464 Ga0307405_10001283 3300031731 Bacteria 10480
465 Ga0307413_10040276 3300031824 Unclassified 2725
466 Ga0307413_10075121 3300031824 Bacteria 2144
467 Ga0307410_10070218 3300031852 Unclassified 2425
468 Ga0307407_10000908 3300031903 Bacteria 9993
469 Ga0307412_10015520 3300031911 Bacteria 4519
470 Ga0307409_100034172 3300031995 Unclassified 3709
471 Ga0307416_100051031 3300032002 Unclassified 3301
472 Ga0307414_10013019 3300032004 Unclassified 4941
473 Ga0307414_10202246 3300032004 Bacteria 1617
474 Ga0307411_10176485 3300032005 Bacteria 1617
475 Ga0307415_100031267 3300032126 Unclassified 3427
476 Ga0373938_0067386 3300034957 Bacteria 849
477 Ga0373943_0010444 3300035170 Bacteria 4160
478 Ga0373946_0008506 3300035171 Bacteria 3766
479 Ga0373955_0012983 3300035172 Bacteria 4017
480 Ga0373935_0018035 3300035692 Bacteria 4290
481 Ga0373927_0253477 3300035695 Bacteria 1157
482 Ga0373933_0547741 3300035724 Bacteria 759
483 Ga0373947_0448004 3300035725 Bacteria 874
484 Ga0373937_0168097 3300036401 Bacteria 2057
485 Ga0373937_0344105 3300036401 Bacteria 1412
486 Ga0373937_0352669 3300036401 Bacteria 1394
487 Ga0373925_0603679 3300037068 Unclassified 904
488 Ga0436365_0345061 3300039437 Bacteria 2944
489 Ga0439453_0009731 3300041408 Bacteria 1570
490 Ga0451576_0912716 3300045051 Unclassified 921
491 Ga0495592_0033047 3300046454 Bacteria 3903
492 Ga0495582_0063980 3300046473 Bacteria 2031
493 Ga0495639_0224357 3300046475 Bacteria 924
494 Ga0495664_0400694 3300046477 Bacteria 824
495 Ga0495608_0002247 3300046511 Bacteria 13945
496 Ga0495587_0078233 3300046536 Unclassified 1919
497 Ga0495598_0023315 3300046537 Unclassified 1666
498 Ga0495598_0025996 3300046537 Unclassified 1601
499 Ga0495645_0118381 3300046543 Bacteria 1867
500 Ga0495656_0231614 3300046615 Unclassified 927
501 Ga0495634_0366225 3300046642 Bacteria 861
502 Ga0495659_0037159 3300046664 Bacteria 1724
503 Ga0495657_0178664 3300046675 Bacteria 1304
504 Ga0495647_0045594 3300046681 Unclassified 1685
505 Ga0495669_0007121 3300046684 Bacteria 4685
506 Ga0495669_0046856 3300046684 Unclassified 1930
507 Ga0495613_0008669 3300046689 Bacteria 7542
508 Ga0495613_0144996 3300046689 Bacteria 1695
509 Ga0495581_0113245 3300047315 Bacteria 1577
510 Ga0495581_0222324 3300047315 Unclassified 1104
511 Ga0495604_0184988 3300047317 Unclassified 1455
512 Ga0495674_0043328 3300047319 Bacteria 4005
513 Ga0495684_0008838 3300047471 Bacteria 7785
514 Ga0496100_0277233 3300048903 Bacteria 1249
515 Ga0496101_0153966 3300048904 Unclassified 1760
516 Ga0496104_0171083 3300048907 Bacteria 2083
517 Ga0496104_0252506 3300048907 Bacteria 1676
518 Ga0496104_0883292 3300048907 Bacteria 799
519 Ga0496106_0282935 3300048909 Bacteria 1329
520 Ga0496108_0127508 3300048911 Unclassified 2186
521 Ga0496109_0032968 3300048912 Unclassified 4660
522 Ga0496110_0273591 3300048913 Unclassified 1538
523 Ga0496112_0210165 3300048915 Bacteria 1903
524 Ga0496112_0825876 3300048915 Bacteria 851
525 Ga0496114_0000820 3300048917 Bacteria 23314
526 Ga0496114_0120805 3300048917 Bacteria 2253
527 Ga0496114_0941897 3300048917 Bacteria 746
528 Ga0496115_0185249 3300048918 Bacteria 1720
529 Ga0501036_0172290 3300049572 Bacteria 1823
530 Ga0501036_0304986 3300049572 Bacteria 1332
531 Ga0501038_0225456 3300049574 Unclassified 1494
532 Ga0501039_0217904 3300049575 Bacteria 1501
533 Ga0501042_0018397 3300049578 Bacteria 4836
534 Ga0501075_0005235 3300049591 Bacteria 8869
535 Ga0501076_0036719 3300049592 Bacteria 3840
536 Ga0501076_0328918 3300049592 Unclassified 1254
537 Ga0501080_0166425 3300049742 Bacteria 2034
538 Ga0501081_0008952 3300049743 Bacteria 6505
539 Ga0501045_0030202 3300049824 Bacteria 3921
540 nmdc:mga05p37_149353_c1 3300050507 Bacteria 2860
541 nmdc:mga09592_111677_c1 3300050508 Unclassified 2345
542 nmdc:mga09592_118277_c1 3300050508 Bacteria 2275
543 nmdc:mga09592_168423_c1 3300050508 Unclassified 1894
544 nmdc:mga09592_313607_c1 3300050508 Bacteria 1359
545 nmdc:mga09592_56307_c1 3300050508 Bacteria 3323
546 nmdc:mga0qj67_151879_c1 3300050509 Bacteria 1879
547 nmdc:mga0qj67_240163_c1 3300050509 Unclassified 1470
548 nmdc:mga0qj67_56824_c1 3300050509 Bacteria 3103
549 nmdc:mga0qj67_87207_c1 3300050509 Bacteria 2504
550 nmdc:mga06r32_279104_c1 3300050510 Unclassified 1658
551 nmdc:mga06r32_538892_c1 3300050510 Unclassified 1142
552 nmdc:mga06r32_573782_c1 3300050510 Bacteria 1101
553 nmdc:mga08y16_110625_c1 3300050511 Bacteria 2861
554 nmdc:mga08y16_157041_c1 3300050511 Bacteria 2364
555 nmdc:mga08y16_159_c2 3300050511 Bacteria 44026
556 nmdc:mga08y16_17563_c1 3300050511 Bacteria 7535
557 nmdc:mga08y16_176583_c1 3300050511 Unclassified 2218
558 nmdc:mga08y16_409_c1 3300050511 Bacteria 39492
559 nmdc:mga08y16_46481_c1 3300050511 Bacteria 4545
560 nmdc:mga08y16_470811_c1 3300050511 Unclassified 1279
561 nmdc:mga08y16_532095_c1 3300050511 Unclassified 1191
562 nmdc:mga08y16_595486_c1 3300050511 Unclassified 1115
563 nmdc:mga08y16_844679_c1 3300050511 Unclassified 905
564 nmdc:mga0n895_34665_c1 3300050512 Bacteria 4861
565 nmdc:mga0n895_36440_c1 3300050512 Bacteria 4749
566 nmdc:mga0n895_37184_c1 3300050512 Bacteria 4708
567 nmdc:mga0n895_46091_c1 3300050512 Bacteria 4258
568 nmdc:mga0n895_46773_c1 3300050512 Bacteria 4229
569 nmdc:mga0rr50_2929_c1 3300050513 Bacteria 9748
570 nmdc:mga0rr50_426093_c1 3300050513 Bacteria 1123
571 nmdc:mga0a205_13235_c1 3300050515 Bacteria 7670
572 nmdc:mga0a205_2302_c1 3300050515 Bacteria 16855
573 nmdc:mga0a205_324_c1 3300050515 Bacteria 35790
574 nmdc:mga0a205_79_c1 3300050515 Bacteria 53549
575 Ga0495601_0008595 3300053077 Bacteria 6031
576 Ga0495601_0041550 3300053077 Bacteria 2883
577 Ga0495595_0166091 3300053084 Bacteria 1091
578 Ga0495595_0251580 3300053084 Unclassified 885
579 Ga0495619_0131872 3300053085 Bacteria 1717
580 Ga0501082_0222541 3300060353 Bacteria 1642
581 Ga0207681_10367744
582 JGI24746J21847_1002097
583 Ga0065714_10093737
584 Ga0065712_10068892
585 Ga0065715_10008335
586 Ga0065707_10007339
587 Ga0070676_10005790
588 Ga0070676_10056483
589 Ga0070683_100132947
590 Ga0070683_100163822
591 Ga0070683_100350522
592 Ga0070690_100040359
593 Ga0070670_100001535
594 Ga0070670_100005083
595 Ga0070670_100031666
596 Ga0070670_100115134
597 Ga0070670_100431063
598 Ga0070677_10003688
599 Ga0070677_10151634
600 Ga0068869_100011928
601 Ga0068869_100014973
602 Ga0068869_100061900
603 Ga0068869_100081504
604 Ga0068869_100129816
605 Ga0068869_100496593
606 Ga0070666_10017745
607 Ga0070666_10054909
608 Ga0070666_10100178
609 Ga0070666_10162526
610 Ga0070666_10218744
611 Ga0070660_100306890
612 Ga0070689_100015973
613 Ga0070689_100101585
614 Ga0070687_100004005
615 Ga0070661_100003108
616 Ga0070661_100430177
617 Ga0070692_10032139
618 Ga0070668_100227649
619 Ga0070668_100400179
620 Ga0070669_100007002
621 Ga0070669_100019054
622 Ga0070669_100073686
623 Ga0070669_100136952
624 Ga0070675_100000267
625 Ga0070675_100001418
626 Ga0070675_100001820
627 Ga0070675_100012610
628 Ga0070675_100014917
629 Ga0070675_100028557
630 Ga0070675_100046762
631 Ga0070675_100079554
632 Ga0070675_100122125
633 Ga0070675_100181082
634 Ga0070675_100248369
635 Ga0070675_100251875
636 Ga0070675_100430134
637 Ga0070671_100036963
638 Ga0070671_100192175
639 Ga0070671_100333203
640 Ga0070674_100000528
641 Ga0070674_100058792
642 Ga0070674_100072072
643 Ga0070674_100080810
644 Ga0070674_100199065
645 Ga0070674_100317364
646 Ga0070674_100326646
647 Ga0070673_100006697
648 Ga0070673_100022406
649 Ga0070673_100148390
650 Ga0070673_100217436
651 Ga0070673_100320480
652 Ga0070688_100007177
653 Ga0070688_100012816
654 Ga0070688_100041298
655 Ga0070688_100130240
656 Ga0070688_100400584
657 Ga0070688_100415343
658 Ga0070667_100006325
659 Ga0070667_100130368
660 Ga0070709_10667453
661 Ga0070713_100079247
662 Ga0070713_100309577
663 Ga0070701_10037584
664 Ga0070701_10048940
665 Ga0070711_100788568
666 Ga0070700_100036968
667 Ga0070700_100193084
668 Ga0070700_100568330
669 Ga0070694_100043183
670 Ga0070694_100220667
671 Ga0070708_100677615
672 Ga0070663_100449191
673 Ga0070678_100023265
674 Ga0070678_100081834
675 Ga0070678_100172307
676 Ga0070678_100272179
677 Ga0070662_100012540
678 Ga0070681_10326416
679 Ga0068867_100014063
680 Ga0068867_100122881
681 Ga0070685_10061027
682 Ga0070685_10101186
683 Ga0070685_10356857
684 Ga0070685_10368985
685 Ga0070707_100425492
686 Ga0070707_100761641
687 Ga0070679_100218752
688 Ga0070684_100193184
689 Ga0070684_100207582
690 Ga0070684_100228908
691 Ga0070684_100231245
692 Ga0068853_100318605
693 Ga0070672_100005236
694 Ga0070672_100007766
695 Ga0070672_100044669
696 Ga0070672_100078131
697 Ga0070672_100105431
698 Ga0070672_100177590
699 Ga0070672_100547295
700 Ga0070672_100580554
701 Ga0070686_100068234
702 Ga0070693_100183408
703 Ga0070665_100030337
704 Ga0070704_100040513
705 Ga0070704_100581258
706 Ga0068855_100031045
707 Ga0068855_100635860
708 Ga0070664_100002082
709 Ga0070664_100042338
710 Ga0070664_100107697
711 Ga0068857_100009074
712 Ga0068857_100421145
713 Ga0068854_100734967
714 Ga0068856_100828568
715 Ga0070702_100278516
716 Ga0070702_100344711
717 Ga0068852_100080213
718 Ga0068852_100739732
719 Ga0068859_100000967
720 Ga0068859_100052689
721 Ga0068859_100113112
722 Ga0068859_100128711
723 Ga0068859_100187427
724 Ga0068864_100072336
725 Ga0068864_100220791
726 Ga0068864_100239616
727 Ga0068864_100269263
728 Ga0068864_100476801
729 Ga0068866_10140488
730 Ga0068866_10465413
731 Ga0068861_100015498
732 Ga0068861_100033346
733 Ga0068861_100309273
734 Ga0068861_100328197
735 Ga0068870_10022165
736 Ga0068870_10130508
737 Ga0068863_100000478
738 Ga0068863_100226145
739 Ga0068858_100007322
740 Ga0068858_100042213
741 Ga0068858_100080560
742 Ga0068858_100162351
743 Ga0068860_100026781
744 Ga0068860_100080543
745 Ga0068860_100110447
746 Ga0068860_100508027
747 Ga0068862_100002399
748 Ga0068862_100366660
749 Ga0068862_100420743
750 Ga0068862_100896990
751 Ga0081539_10128201
752 Ga0070717_10487472
753 Ga0070715_10033370
754 Ga0097621_100000043
755 Ga0097621_100027446
756 Ga0097621_100104261
757 Ga0097621_100159209
758 Ga0097621_100285557
759 Ga0097621_100356126
760 Ga0097621_100516338
761 Ga0068871_100000194
762 Ga0068871_100031691
763 Ga0068871_100034356
764 Ga0068871_100063654
765 Ga0068871_100115778
766 Ga0068871_100438082
767 Ga0068871_100445400
768 Ga0068871_100634274
769 Ga0075428_100007177
770 Ga0075428_100008359
771 Ga0075428_100179183
772 Ga0075428_100306717
773 Ga0075430_100025297
774 Ga0075430_100065442
775 Ga0075430_100085923
776 Ga0075430_100088584
777 Ga0075430_100371023
778 Ga0075431_100107983
779 Ga0075431_100171853
780 Ga0075433_10002247
781 Ga0075433_10012461
782 Ga0075433_10047778
783 Ga0075433_10308639
784 Ga0075434_100009424
785 Ga0075434_100010285
786 Ga0075434_100016123
787 Ga0075434_100050410
788 Ga0075429_100062159
789 Ga0075429_100068326
790 Ga0075429_100073244
791 Ga0075429_100081008
792 Ga0068865_100001483
793 Ga0068865_100013070
794 Ga0068865_100024853
795 Ga0097620_100000967
796 Ga0097620_100052685
797 Ga0097620_100113109
798 Ga0097620_100128715
799 Ga0097620_100187428
800 Ga0075435_100015489
801 Ga0075435_100178751
802 Ga0075435_100460896
803 Ga0105240_10092071
804 Ga0105240_10760153
805 Ga0111539_10000161
806 Ga0111539_10000577
807 Ga0111539_10004416
808 Ga0111539_10008503
809 Ga0111539_10009164
810 Ga0111539_10290990
811 Ga0111539_10603722
812 Ga0111539_10636222
813 Ga0111539_10643328
814 Ga0105245_10023647
815 Ga0105245_10161567
816 Ga0105247_10022582
817 Ga0105247_10208917
818 Ga0105247_10244551
819 Ga0105247_10461027
820 Ga0114129_10010595
821 Ga0114129_10261389
822 Ga0114129_10291685
823 Ga0105243_10030476
824 Ga0105243_10675926
825 Ga0105241_10132110
826 Ga0105242_10007739
827 Ga0105242_10015664
828 Ga0105242_10021496
829 Ga0105242_10141113
830 Ga0105242_10569259
831 Ga0105248_10000867
832 Ga0105248_10001910
833 Ga0105248_10033986
834 Ga0105248_10053840
835 Ga0105248_10203655
836 Ga0105248_10674447
837 Ga0105237_10309473
838 Ga0105238_10008290
839 Ga0105238_10085548
840 Ga0105239_10109987
841 Ga0105239_10326026
842 Ga0105246_11006097
843 Ga0157370_10005543
844 Ga0157370_10243593
845 Ga0157369_10198195
846 Ga0157374_10046453
847 Ga0157374_10347143
848 Ga0157374_10541336
849 Ga0157378_10013226
850 Ga0157378_10311718
851 Ga0163162_10008221
852 Ga0163162_10011893
853 Ga0163162_10070921
854 Ga0163162_10095549
855 Ga0163162_10418353
856 Ga0163162_10462363
857 Ga0157372_10278882
858 Ga0157375_10000105
859 Ga0157375_10088942
860 Ga0157375_10205824
861 Ga0157375_10272468
862 Ga0163163_10017963
863 Ga0163163_10025202
864 Ga0163163_10034946
865 Ga0163163_10036149
866 Ga0163163_10070420
867 Ga0163163_11286082
868 Ga0157380_10004252
869 Ga0157380_10022929
870 Ga0157380_10025098
871 Ga0157380_10050503
872 Ga0157380_10065126
873 Ga0157380_10258351
874 Ga0157377_10019070
875 Ga0157377_10019650
876 Ga0157377_10071579
877 Ga0157377_10080333
878 Ga0157377_10098063
879 Ga0157379_10000223
880 Ga0157379_10064086
881 Ga0157379_10363328
882 Ga0157379_10415078
883 Ga0157376_10000370
884 Ga0157376_10018839
885 Ga0157376_10033679
886 Ga0157376_10039431
887 Ga0157376_10192159
888 Ga0157376_10335348
889 Ga0157376_10408913
890 Ga0157376_10687386
891 Ga0163161_10015653
892 Ga0163161_10385471
893 Ga0213876_10235695
894 Ga0207697_10000814
895 Ga0207682_10000770
896 Ga0207682_10007089
897 Ga0207682_10039667
898 Ga0207710_10032075
899 Ga0207688_10000771
900 Ga0207688_10163171
901 Ga0207680_10009023
902 Ga0207680_10201362
903 Ga0207680_10394962
904 Ga0207699_10064329
905 Ga0207645_10000922
906 Ga0207645_10181436
907 Ga0207643_10001581
908 Ga0207643_10015371
909 Ga0207707_10100988
910 Ga0207695_10037945
911 Ga0207662_10003153
912 Ga0207649_10019067
913 Ga0207649_10294250
914 Ga0207652_10079225
915 Ga0207646_10273497
916 Ga0207646_10349051
917 Ga0207681_10007603
918 Ga0207681_10026687
919 Ga0207681_10088832
920 Ga0207681_10107700
921 Ga0207681_10405376
922 Ga0207694_10024548
923 Ga0207694_10035698
924 Ga0207650_10049737
925 Ga0207650_10076541
926 Ga0207650_10100904
927 Ga0207650_10447020
928 Ga0207659_10000967
929 Ga0207659_10003984
930 Ga0207659_10005049
931 Ga0207659_10007167
932 Ga0207659_10016287
933 Ga0207659_10029207
934 Ga0207659_10064857
935 Ga0207659_10070846
936 Ga0207659_10074221
937 Ga0207659_10188510
938 Ga0207659_10336660
939 Ga0207659_10408645
940 Ga0207687_10023475
941 Ga0207700_10256717
942 Ga0207644_10010848
943 Ga0207644_10099302
944 Ga0207706_10001352
945 Ga0207706_10017734
946 Ga0207706_10088051
947 Ga0207706_10420246
948 Ga0207686_10002845
949 Ga0207686_10005627
950 Ga0207686_10286109
951 Ga0207670_10003072
952 Ga0207670_10104826
953 Ga0207670_10334484
954 Ga0207669_10002722
955 Ga0207669_10044378
956 Ga0207669_10074634
957 Ga0207669_10165052
958 Ga0207669_10500022
959 Ga0207704_10000389
960 Ga0207704_10017872
961 Ga0207704_10027095
962 Ga0207691_10003439
963 Ga0207691_10003487
964 Ga0207691_10018176
965 Ga0207691_10032111
966 Ga0207691_10040441
967 Ga0207691_10051765
968 Ga0207691_10166741
969 Ga0207691_10182006
970 Ga0207711_10001195
971 Ga0207711_10122276
972 Ga0207711_10124637
973 Ga0207711_10892569
974 Ga0207689_10002899
975 Ga0207689_10019859
976 Ga0207689_10022643
977 Ga0207689_10040926
978 Ga0207689_10041356
979 Ga0207689_10181357
980 Ga0207679_10007054
981 Ga0207679_10056394
982 Ga0207679_10521926
983 Ga0207651_10020859
984 Ga0207651_10040742
985 Ga0207651_10086697
986 Ga0207651_10263423
987 Ga0207668_10221035
988 Ga0207668_10467643
989 Ga0207658_10017875
990 Ga0207658_10124843
991 Ga0207677_10138568
992 Ga0207703_10010217
993 Ga0207703_10098732
994 Ga0207703_10133194
995 Ga0207703_10173357
996 Ga0207703_10269949
997 Ga0207703_10339529
998 Ga0207708_10053145
999 Ga0207708_10176658
1000 Ga0207702_10375825
1001 Ga0207641_10010923
1002 Ga0207641_10012599
1003 Ga0207641_10314677
1004 Ga0207641_10907621
1005 Ga0207648_10006793
1006 Ga0207648_10022040
1007 Ga0207648_10101465
1008 Ga0207648_10127817
1009 Ga0207648_10145506
1010 Ga0207676_10115480
1011 Ga0207676_10169832
1012 Ga0207674_10021695
1013 Ga0207674_10103083
1014 Ga0207674_10519872
1015 Ga0207674_10658684
1016 Ga0207674_10673824
1017 Ga0207675_100105752
1018 Ga0207675_100126234
1019 Ga0207675_100280839
1020 Ga0207683_10010696
1021 Ga0207683_10152369
1022 Ga0207683_10352269
1023 Ga0207683_10495526
1024 Ga0207698_10132469
1025 Ga0207428_10000186
1026 Ga0207428_10002174
1027 Ga0207428_10039960
1028 Ga0207428_10042974
1029 Ga0207428_10130080
1030 Ga0207428_10153750
1031 Ga0268266_10081336
1032 Ga0268266_10250742
1033 Ga0268265_10162304
1034 Ga0268265_10299280
1035 Ga0268265_10332738
1036 Ga0268265_10681182
1037 Ga0268264_10021381
1038 Ga0268264_10145894
1039 Ga0268264_10228618
1040 Ga0265338_10407441
1041 Ga0307408_100026177
1042 Ga0307408_100213244
1043 Ga0265314_10003465
1044 Ga0307405_10001283
1045 Ga0307413_10040276
1046 Ga0307413_10075121
1047 Ga0307410_10070218
1048 Ga0307407_10000908
1049 Ga0307412_10015520
1050 Ga0307409_100034172
1051 Ga0307416_100051031
1052 Ga0307414_10013019
1053 Ga0307414_10202246
1054 Ga0307411_10176485
1055 Ga0307415_100031267
1056 Ga0373938_0067386
1057 Ga0373943_0010444
1058 Ga0373946_0008506
1059 Ga0373955_0012983
1060 Ga0373935_0018035
1061 Ga0373927_0253477
1062 Ga0373933_0547741
1063 Ga0373947_0448004
1064 Ga0373937_0168097
1065 Ga0373937_0344105
1066 Ga0373937_0352669
1067 Ga0373925_0603679
1068 Ga0436365_0345061
1069 Ga0439453_0009731
1070 Ga0451576_0912716
1071 Ga0495592_0033047
1072 Ga0495582_0063980
1073 Ga0495639_0224357
1074 Ga0495664_0400694
1075 Ga0495608_0002247
1076 Ga0495587_0078233
1077 Ga0495598_0023315
1078 Ga0495598_0025996
1079 Ga0495645_0118381
1080 Ga0495656_0231614
1081 Ga0495634_0366225
1082 Ga0495659_0037159
1083 Ga0495657_0178664
1084 Ga0495647_0045594
1085 Ga0495669_0007121
1086 Ga0495669_0046856
1087 Ga0495613_0008669
1088 Ga0495613_0144996
1089 Ga0495581_0113245
1090 Ga0495581_0222324
1091 Ga0495604_0184988
1092 Ga0495674_0043328
1093 Ga0495684_0008838
1094 Ga0496100_0277233
1095 Ga0496101_0153966
1096 Ga0496104_0171083
1097 Ga0496104_0252506
1098 Ga0496104_0883292
1099 Ga0496106_0282935
1100 Ga0496108_0127508
1101 Ga0496109_0032968
1102 Ga0496110_0273591
1103 Ga0496112_0210165
1104 Ga0496112_0825876
1105 Ga0496114_0000820
1106 Ga0496114_0120805
1107 Ga0496114_0941897
1108 Ga0496115_0185249
1109 Ga0501036_0172290
1110 Ga0501036_0304986
1111 Ga0501038_0225456
1112 Ga0501039_0217904
1113 Ga0501042_0018397
1114 Ga0501075_0005235
1115 Ga0501076_0036719
1116 Ga0501076_0328918
1117 Ga0501080_0166425
1118 Ga0501081_0008952
1119 Ga0501045_0030202
1120 nmdc:mga05p37_149353_c1
1121 nmdc:mga09592_111677_c1
1122 nmdc:mga09592_118277_c1
1123 nmdc:mga09592_168423_c1
1124 nmdc:mga09592_313607_c1
1125 nmdc:mga09592_56307_c1
1126 nmdc:mga0qj67_151879_c1
1127 nmdc:mga0qj67_240163_c1
1128 nmdc:mga0qj67_56824_c1
1129 nmdc:mga0qj67_87207_c1
1130 nmdc:mga06r32_279104_c1
1131 nmdc:mga06r32_538892_c1
1132 nmdc:mga06r32_573782_c1
1133 nmdc:mga08y16_110625_c1
1134 nmdc:mga08y16_157041_c1
1135 nmdc:mga08y16_159_c2
1136 nmdc:mga08y16_17563_c1
1137 nmdc:mga08y16_176583_c1
1138 nmdc:mga08y16_409_c1
1139 nmdc:mga08y16_46481_c1
1140 nmdc:mga08y16_470811_c1
1141 nmdc:mga08y16_532095_c1
1142 nmdc:mga08y16_595486_c1
1143 nmdc:mga08y16_844679_c1
1144 nmdc:mga0n895_34665_c1
1145 nmdc:mga0n895_36440_c1
1146 nmdc:mga0n895_37184_c1
1147 nmdc:mga0n895_46091_c1
1148 nmdc:mga0n895_46773_c1
1149 nmdc:mga0rr50_2929_c1
1150 nmdc:mga0rr50_426093_c1
1151 nmdc:mga0a205_13235_c1
1152 nmdc:mga0a205_2302_c1
1153 nmdc:mga0a205_324_c1
1154 nmdc:mga0a205_79_c1
1155 Ga0495601_0008595
1156 Ga0495601_0041550
1157 Ga0495595_0166091
1158 Ga0495595_0251580
1159 Ga0495619_0131872
1160 Ga0501082_0222541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o59-assembly1.cif.gz_A crystal structure of allantoicase (yir029w) from saccharomyces cerevisiae at 2.40 a resolution 0.6524 125 251
3fha-assembly2.cif.gz_C structure of endo-beta-n-acetylglucosaminidase a 0.634 117 252
1sg3-assembly1.cif.gz_B structure of allantoicase 0.6189 125 252
1v0a-assembly1.cif.gz_A family 11 carbohydrate-binding module of cellulosomal cellulase lic26a-cel5e of clostridium thermocellum 0.6184 122 251
6r31-assembly1.cif.gz_A family 11 carbohydrate-binding module from clostridium thermocellum in complex with beta-1,3-1,4-mixed-linked tetrasaccharide 0.6061 122 256
ID Description Score Start End Superfamily
af_Q84WT5_62_167_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6666 132 249 2.60.120.260
af_A0A2R8RIP2_42_197_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6438 110 251 2.60.120.260
af_A0A1R3LXF8_43_196_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.632 126 250 2.60.120.260
4gwmB02 Mainly Beta;Sandwich;Jelly Rolls; 0.6253 117 256 2.60.120.200
af_Q6UXC1_810_968_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6182 128 253 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A1F3LYC9-F1-model_v4 Uncharacterized protein 0.9465 113 256
AF-A0A7X9I945-F1-model_v4 Right-handed parallel beta-helix repeat-containing protein 0.8807 32 256
AF-A0A2V8BPL1-F1-model_v4 Uncharacterized protein 0.8714 36 260
AF-A0A2V8LLE6-F1-model_v4 Uncharacterized protein 0.8653 145 263
AF-A0A2V8BPL1-F1-model_v4 Uncharacterized protein 0.8628 36 260

Map