F465929

General Info

Members Datasets Scaffolds Average Seq Length
580 249 1160 127

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100238137|Ga0075431_1002381373
Length 147
Sequence MAKTHHPALTRRERQIMDILYRRGRATAAEVMDDLAKAPAGQGGSSGSAPMRAWKPTSSTVRTQLRVLEEKGHVRHEEHGLRFIYLPAVPRHAARKSALRHLIDTFFDGSAEKVVAAVLGGEATRVTDEELSRIAELVARTARKETR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
191 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
192 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
193 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
194 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 2.76
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 23.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100238137 3300006847 Bacteria 1852
2 JGI24746J21847_1042691 3300001977 Unclassified 632
3 JGI24750J21931_1054413 3300002070 Unclassified 630
4 JGI24035J26624_1028422 3300002126 Unclassified 604
5 Ga0065715_10153464 3300005293 Unclassified 1703
6 Ga0065715_10230912 3300005293 Bacteria 1226
7 Ga0065707_10189744 3300005295 Bacteria 1368
8 Ga0070676_10005963 3300005328 Bacteria 6505
9 Ga0070676_10215717 3300005328 Bacteria 1265
10 Ga0070676_10628491 3300005328 Unclassified 777
11 Ga0070676_11619446 3300005328 Bacteria 501
12 Ga0070683_101019101 3300005329 Unclassified 795
13 Ga0070690_100023915 3300005330 Bacteria 3753
14 Ga0070690_100094757 3300005330 Unclassified 1970
15 Ga0070690_100307315 3300005330 Unclassified 1139
16 Ga0070670_100001593 3300005331 Bacteria 18314
17 Ga0070670_100021651 3300005331 Bacteria 5528
18 Ga0070670_100040437 3300005331 Bacteria 4009
19 Ga0070677_10009113 3300005333 Bacteria 3360
20 Ga0070677_10087600 3300005333 Bacteria 1347
21 Ga0070677_10214735 3300005333 Bacteria 936
22 Ga0068869_100000788 3300005334 Bacteria 18070
23 Ga0068869_100032395 3300005334 Unclassified 3683
24 Ga0070666_10007203 3300005335 Bacteria 6858
25 Ga0070666_10016078 3300005335 Bacteria 4782
26 Ga0070666_10048183 3300005335 Bacteria 2862
27 Ga0070666_10952033 3300005335 Bacteria 636
28 Ga0070680_100421363 3300005336 Bacteria 1139
29 Ga0070680_100576641 3300005336 Unclassified 965
30 Ga0068868_100234293 3300005338 Bacteria 1541
31 Ga0068868_100655597 3300005338 Bacteria 935
32 Ga0068868_101455871 3300005338 Bacteria 640
33 Ga0068868_102236226 3300005338 Bacteria 521
34 Ga0070689_100027908 3300005340 Bacteria 4261
35 Ga0070689_100039784 3300005340 Bacteria 3602
36 Ga0070689_100205125 3300005340 Bacteria 1611
37 Ga0070691_10065815 3300005341 Bacteria 1751
38 Ga0070687_100025180 3300005343 Bacteria 2851
39 Ga0070687_100072600 3300005343 Bacteria 1852
40 Ga0070687_100542501 3300005343 Unclassified 790
41 Ga0070687_100982358 3300005343 Bacteria 611
42 Ga0070661_100288049 3300005344 Unclassified 1276
43 Ga0070692_10215356 3300005345 Bacteria 1132
44 Ga0070668_100648179 3300005347 Bacteria 928
45 Ga0070668_101000908 3300005347 Bacteria 751
46 Ga0070669_100006288 3300005353 Bacteria 8563
47 Ga0070669_100169124 3300005353 Bacteria 1703
48 Ga0070669_100617686 3300005353 Bacteria 909
49 Ga0070675_100002251 3300005354 Bacteria 14305
50 Ga0070675_100048701 3300005354 Bacteria 3476
51 Ga0070675_100201938 3300005354 Bacteria 1725
52 Ga0070675_100336744 3300005354 Bacteria 1336
53 Ga0070675_100414398 3300005354 Unclassified 1204
54 Ga0070675_100766834 3300005354 Unclassified 881
55 Ga0070675_101777918 3300005354 Unclassified 569
56 Ga0070671_100081981 3300005355 Bacteria 2697
57 Ga0070671_100514143 3300005355 Bacteria 1031
58 Ga0070671_101129588 3300005355 Bacteria 689
59 Ga0070674_100008967 3300005356 Bacteria 5975
60 Ga0070674_100143527 3300005356 Bacteria 1795
61 Ga0070673_100074863 3300005364 Bacteria 2729
62 Ga0070673_100175904 3300005364 Bacteria 1829
63 Ga0070673_100209358 3300005364 Bacteria 1683
64 Ga0070673_100375892 3300005364 Bacteria 1266
65 Ga0070688_100075092 3300005365 Bacteria 2172
66 Ga0070688_100182263 3300005365 Unclassified 1457
67 Ga0070688_100196680 3300005365 Bacteria 1408
68 Ga0070688_100606333 3300005365 Bacteria 839
69 Ga0070659_100168120 3300005366 Unclassified 1795
70 Ga0070659_100442862 3300005366 Bacteria 1101
71 Ga0070667_100354108 3300005367 Bacteria 1330
72 Ga0070667_100389103 3300005367 Bacteria 1268
73 Ga0070667_100471165 3300005367 Bacteria 1149
74 Ga0070703_10212790 3300005406 Unclassified 765
75 Ga0070703_10322051 3300005406 Bacteria 651
76 Ga0070701_10006915 3300005438 Unclassified 4805
77 Ga0070701_10034924 3300005438 Unclassified 2522
78 Ga0070701_10201438 3300005438 Bacteria 1177
79 Ga0070711_101061823 3300005439 Unclassified 697
80 Ga0070705_100027764 3300005440 Bacteria 3093
81 Ga0070700_100014807 3300005441 Bacteria 4408
82 Ga0070700_100016401 3300005441 Bacteria 4220
83 Ga0070700_100054819 3300005441 Bacteria 2493
84 Ga0070700_100123950 3300005441 Bacteria 1735
85 Ga0070700_101667417 3300005441 Bacteria 546
86 Ga0070694_100067902 3300005444 Unclassified 2449
87 Ga0070694_100411334 3300005444 Bacteria 1061
88 Ga0070708_100084800 3300005445 Unclassified 2874
89 Ga0070663_100063197 3300005455 Bacteria 2672
90 Ga0070678_100006398 3300005456 Bacteria 6910
91 Ga0070678_100489829 3300005456 Bacteria 1083
92 Ga0070678_100621765 3300005456 Bacteria 966
93 Ga0070662_100339400 3300005457 Bacteria 1229
94 Ga0070662_100603591 3300005457 Bacteria 923
95 Ga0070681_11596182 3300005458 Bacteria 578
96 Ga0068867_100002997 3300005459 Bacteria 11901
97 Ga0068867_100003832 3300005459 Bacteria 10568
98 Ga0068867_100645650 3300005459 Unclassified 928
99 Ga0070685_10015488 3300005466 Unclassified 4051
100 Ga0070707_100313437 3300005468 Bacteria 1525
101 Ga0070698_100372063 3300005471 Bacteria 1361
102 Ga0070698_100707820 3300005471 Unclassified 949
103 Ga0070699_100557859 3300005518 Bacteria 1043
104 Ga0070697_100439142 3300005536 Bacteria 1136
105 Ga0068853_101839701 3300005539 Bacteria 587
106 Ga0070672_100034692 3300005543 Bacteria 3830
107 Ga0070672_100035318 3300005543 Bacteria 3799
108 Ga0070672_100037140 3300005543 Bacteria 3714
109 Ga0070672_100108554 3300005543 Unclassified 2259
110 Ga0070672_100154782 3300005543 Unclassified 1898
111 Ga0070686_100001050 3300005544 Bacteria 15900
112 Ga0070686_100019971 3300005544 Bacteria 3959
113 Ga0070686_100139383 3300005544 Bacteria 1686
114 Ga0070686_101885903 3300005544 Bacteria 510
115 Ga0070695_100638202 3300005545 Bacteria 840
116 Ga0070693_100170918 3300005547 Bacteria 1392
117 Ga0070693_100514497 3300005547 Unclassified 851
118 Ga0070665_100117684 3300005548 Bacteria 2660
119 Ga0070665_100175363 3300005548 Unclassified 2144
120 Ga0070665_101868491 3300005548 Bacteria 607
121 Ga0070704_100516529 3300005549 Bacteria 1039
122 Ga0068855_100191174 3300005563 Bacteria 2309
123 Ga0070664_100064421 3300005564 Bacteria 3126
124 Ga0070664_101058880 3300005564 Bacteria 763
125 Ga0068854_100081094 3300005578 Bacteria 2395
126 Ga0068854_100195861 3300005578 Bacteria 1586
127 Ga0070702_100096600 3300005615 Bacteria 1803
128 Ga0070702_100242601 3300005615 Bacteria 1217
129 Ga0068852_101322260 3300005616 Bacteria 743
130 Ga0068859_100028832 3300005617 Bacteria 5567
131 Ga0068859_100030435 3300005617 Bacteria 5416
132 Ga0068859_101293574 3300005617 Bacteria 803
133 Ga0068859_101806160 3300005617 Bacteria 675
134 Ga0068859_102776837 3300005617 Bacteria 538
135 Ga0068864_100032856 3300005618 Bacteria 4410
136 Ga0068864_101063425 3300005618 Bacteria 804
137 Ga0068864_101143279 3300005618 Bacteria 776
138 Ga0068864_101287636 3300005618 Bacteria 731
139 Ga0068864_101345552 3300005618 Bacteria 715
140 Ga0068866_10028834 3300005718 Bacteria 2648
141 Ga0068861_100060246 3300005719 Bacteria 2908
142 Ga0068861_101229364 3300005719 Unclassified 725
143 Ga0068861_101868339 3300005719 Bacteria 597
144 Ga0068861_101984428 3300005719 Unclassified 580
145 Ga0068861_102018667 3300005719 Unclassified 575
146 Ga0068851_10131438 3300005834 Unclassified 1354
147 Ga0068870_10016171 3300005840 Bacteria 3558
148 Ga0068870_10025841 3300005840 Bacteria 2920
149 Ga0068870_10087946 3300005840 Bacteria 1731
150 Ga0068870_10145136 3300005840 Bacteria 1392
151 Ga0068870_10321186 3300005840 Bacteria 984
152 Ga0068863_100049088 3300005841 Bacteria 4002
153 Ga0068863_100333452 3300005841 Bacteria 1475
154 Ga0068858_100006718 3300005842 Bacteria 11192
155 Ga0068858_100160031 3300005842 Bacteria 2120
156 Ga0068858_100177115 3300005842 Bacteria 2012
157 Ga0068858_101122557 3300005842 Unclassified 772
158 Ga0068860_100357345 3300005843 Bacteria 1438
159 Ga0068860_100856020 3300005843 Unclassified 924
160 Ga0068862_100061361 3300005844 Bacteria 3231
161 Ga0081455_10302564 3300005937 Bacteria 1147
162 Ga0081539_10179519 3300005985 Bacteria 994
163 Ga0075364_10040166 3300006051 Bacteria 3035
164 Ga0097621_100007748 3300006237 Bacteria 7700
165 Ga0097621_100351494 3300006237 Bacteria 1311
166 Ga0097621_100499901 3300006237 Bacteria 1101
167 Ga0097621_100505938 3300006237 Bacteria 1095
168 Ga0097621_100565507 3300006237 Unclassified 1036
169 Ga0097621_100956224 3300006237 Bacteria 800
170 Ga0097621_101052241 3300006237 Unclassified 763
171 Ga0097621_101531386 3300006237 Bacteria 633
172 Ga0068871_100007305 3300006358 Bacteria 7885
173 Ga0068871_100071201 3300006358 Bacteria 2859
174 Ga0068871_100183390 3300006358 Unclassified 1800
175 Ga0068871_100275729 3300006358 Bacteria 1470
176 Ga0075428_100127028 3300006844 Bacteria 2774
177 Ga0075428_100377020 3300006844 Unclassified 1521
178 Ga0075428_101986518 3300006844 Unclassified 603
179 Ga0075430_101413065 3300006846 Unclassified 572
180 Ga0075431_100275555 3300006847 Bacteria 1704
181 Ga0075431_100841661 3300006847 Bacteria 889
182 Ga0075433_10000075 3300006852 Bacteria 44503
183 Ga0075433_10001401 3300006852 Bacteria 17764
184 Ga0075433_10007830 3300006852 Bacteria 8496
185 Ga0075433_10024165 3300006852 Bacteria 5125
186 Ga0075434_100000505 3300006871 Bacteria 29553
187 Ga0075434_100001374 3300006871 Bacteria 20412
188 Ga0075434_100009308 3300006871 Bacteria 9152
189 Ga0075434_100009343 3300006871 Bacteria 9139
190 Ga0075434_100012294 3300006871 Bacteria 8111
191 Ga0075434_100022142 3300006871 Bacteria 6189
192 Ga0075434_100044659 3300006871 Bacteria 4395
193 Ga0075434_100349654 3300006871 Bacteria 1499
194 Ga0068865_100025551 3300006881 Bacteria 3886
195 Ga0068865_100058416 3300006881 Bacteria 2694
196 Ga0068865_100106672 3300006881 Unclassified 2059
197 Ga0068865_100689779 3300006881 Bacteria 872
198 Ga0068865_101021783 3300006881 Bacteria 725
199 Ga0075436_100001003 3300006914 Bacteria 18959
200 Ga0075436_100045572 3300006914 Bacteria 3025
201 Ga0075436_100061264 3300006914 Bacteria 2599
202 Ga0075436_100164430 3300006914 Bacteria 1565
203 Ga0097620_100028829 3300006931 Bacteria 5567
204 Ga0097620_100030435 3300006931 Bacteria 5416
205 Ga0097620_101293568 3300006931 Bacteria 803
206 Ga0097620_101805995 3300006931 Bacteria 675
207 Ga0097620_102777044 3300006931 Bacteria 538
208 Ga0075435_100000129 3300007076 Bacteria 43005
209 Ga0075435_100000566 3300007076 Bacteria 22768
210 Ga0075435_100032243 3300007076 Bacteria 4136
211 Ga0075435_100038441 3300007076 Bacteria 3815
212 Ga0075435_100088315 3300007076 Bacteria 2555
213 Ga0105250_10333595 3300009092 Bacteria 661
214 Ga0105240_10641081 3300009093 Bacteria 1166
215 Ga0105240_11609721 3300009093 Unclassified 679
216 Ga0111539_10004849 3300009094 Bacteria 17531
217 Ga0111539_10073878 3300009094 Unclassified 4019
218 Ga0111539_10134216 3300009094 Bacteria 2898
219 Ga0111539_10213546 3300009094 Unclassified 2248
220 Ga0111539_10395468 3300009094 Bacteria 1610
221 Ga0111539_10404324 3300009094 Bacteria 1590
222 Ga0111539_10501602 3300009094 Bacteria 1414
223 Ga0111539_10565244 3300009094 Bacteria 1325
224 Ga0111539_10574273 3300009094 Unclassified 1313
225 Ga0111539_10577836 3300009094 Bacteria 1309
226 Ga0111539_10898499 3300009094 Bacteria 1030
227 Ga0111539_12826838 3300009094 Bacteria 562
228 Ga0111539_12845379 3300009094 Unclassified 560
229 Ga0105245_10853040 3300009098 Unclassified 951
230 Ga0105247_10289211 3300009101 Bacteria 1133
231 Ga0114129_10096377 3300009147 Unclassified 4096
232 Ga0114129_10458004 3300009147 Bacteria 1672
233 Ga0105243_10076093 3300009148 Bacteria 2726
234 Ga0105243_10109525 3300009148 Bacteria 2307
235 Ga0105243_12383717 3300009148 Unclassified 567
236 Ga0105241_10052831 3300009174 Bacteria 3104
237 Ga0105241_10290389 3300009174 Unclassified 1400
238 Ga0105241_12151418 3300009174 Bacteria 552
239 Ga0105242_11341763 3300009176 Bacteria 740
240 Ga0105242_11410363 3300009176 Bacteria 724
241 Ga0105248_10129548 3300009177 Bacteria 2846
242 Ga0105248_10216583 3300009177 Bacteria 2157
243 Ga0105248_10262712 3300009177 Unclassified 1943
244 Ga0105248_10566753 3300009177 Bacteria 1281
245 Ga0105248_10572261 3300009177 Unclassified 1275
246 Ga0105248_11213890 3300009177 Unclassified 853
247 Ga0105248_11424372 3300009177 Bacteria 784
248 Ga0105238_10085559 3300009551 Bacteria 3141
249 Ga0105249_10001058 3300009553 Bacteria 24390
250 Ga0105249_10220076 3300009553 Bacteria 1868
251 Ga0105249_11021551 3300009553 Bacteria 896
252 Ga0105239_10776249 3300010375 Bacteria 1097
253 Ga0105239_10852348 3300010375 Bacteria 1045
254 Ga0157378_10015609 3300013297 Bacteria 6652
255 Ga0157378_10897371 3300013297 Bacteria 917
256 Ga0157378_11023711 3300013297 Bacteria 861
257 Ga0163162_10003240 3300013306 Bacteria 15562
258 Ga0163162_10977128 3300013306 Bacteria 957
259 Ga0157375_10192793 3300013308 Bacteria 2193
260 Ga0157375_10605370 3300013308 Bacteria 1255
261 Ga0157375_12668000 3300013308 Bacteria 597
262 Ga0157375_13606928 3300013308 Bacteria 515
263 Ga0163163_10065678 3300014325 Bacteria 3603
264 Ga0163163_10233713 3300014325 Bacteria 1888
265 Ga0163163_10440823 3300014325 Bacteria 1362
266 Ga0163163_11789844 3300014325 Unclassified 675
267 Ga0157380_10004405 3300014326 Bacteria 9758
268 Ga0157380_10021374 3300014326 Bacteria 4853
269 Ga0157380_10036018 3300014326 Bacteria 3827
270 Ga0157380_10055210 3300014326 Unclassified 3154
271 Ga0157380_10070362 3300014326 Bacteria 2827
272 Ga0157380_10187909 3300014326 Bacteria 1821
273 Ga0157380_10681465 3300014326 Bacteria 1030
274 Ga0157380_11407581 3300014326 Unclassified 748
275 Ga0157380_11677206 3300014326 Unclassified 693
276 Ga0157380_11830724 3300014326 Unclassified 667
277 Ga0157380_12264628 3300014326 Bacteria 608
278 Ga0157380_13064147 3300014326 Unclassified 533
279 Ga0157380_13470914 3300014326 Unclassified 505
280 Ga0157377_10011680 3300014745 Bacteria 4391
281 Ga0157377_10618054 3300014745 Bacteria 775
282 Ga0157377_11735951 3300014745 Unclassified 505
283 Ga0157379_10014773 3300014968 Bacteria 6848
284 Ga0157379_10188786 3300014968 Bacteria 1862
285 Ga0157379_10373559 3300014968 Bacteria 1307
286 Ga0157379_11929468 3300014968 Bacteria 582
287 Ga0157376_10041317 3300014969 Unclassified 3775
288 Ga0157376_10091148 3300014969 Bacteria 2640
289 Ga0157376_10355939 3300014969 Bacteria 1402
290 Ga0157376_12017289 3300014969 Bacteria 615
291 Ga0163161_11048370 3300017792 Unclassified 698
292 Ga0163161_11495517 3300017792 Unclassified 593
293 Ga0213876_10453090 3300021384 Unclassified 682
294 Ga0207697_10000380 3300025315 Bacteria 24920
295 Ga0207682_10011887 3300025893 Bacteria 3400
296 Ga0207682_10073409 3300025893 Bacteria 1453
297 Ga0207710_10071131 3300025900 Unclassified 1595
298 Ga0207710_10114829 3300025900 Bacteria 1281
299 Ga0207680_10153043 3300025903 Unclassified 1539
300 Ga0207680_10356907 3300025903 Unclassified 1027
301 Ga0207680_10512470 3300025903 Bacteria 855
302 Ga0207645_10010039 3300025907 Bacteria 6519
303 Ga0207643_10001171 3300025908 Bacteria 15608
304 Ga0207643_10072842 3300025908 Unclassified 1979
305 Ga0207643_10147961 3300025908 Bacteria 1406
306 Ga0207643_10350233 3300025908 Unclassified 927
307 Ga0207643_10387062 3300025908 Bacteria 882
308 Ga0207654_10289124 3300025911 Bacteria 1111
309 Ga0207707_11132655 3300025912 Bacteria 636
310 Ga0207695_10906842 3300025913 Unclassified 761
311 Ga0207660_10097001 3300025917 Unclassified 2196
312 Ga0207660_10857091 3300025917 Unclassified 741
313 Ga0207662_10013380 3300025918 Bacteria 4588
314 Ga0207662_10016671 3300025918 Bacteria 4148
315 Ga0207662_10077764 3300025918 Bacteria 2018
316 Ga0207662_10274068 3300025918 Bacteria 1114
317 Ga0207662_10512747 3300025918 Bacteria 827
318 Ga0207649_10155739 3300025920 Bacteria 1578
319 Ga0207649_10725618 3300025920 Bacteria 772
320 Ga0207646_10222945 3300025922 Bacteria 1703
321 Ga0207681_10052989 3300025923 Bacteria 2753
322 Ga0207681_10102672 3300025923 Bacteria 2065
323 Ga0207681_10137666 3300025923 Unclassified 1814
324 Ga0207681_10382139 3300025923 Bacteria 1134
325 Ga0207681_10600701 3300025923 Bacteria 909
326 Ga0207650_10026716 3300025925 Bacteria 4122
327 Ga0207650_10078582 3300025925 Bacteria 2497
328 Ga0207650_10136663 3300025925 Bacteria 1923
329 Ga0207659_10009110 3300025926 Bacteria 6195
330 Ga0207659_10057462 3300025926 Unclassified 2790
331 Ga0207659_10182785 3300025926 Bacteria 1663
332 Ga0207659_10188465 3300025926 Bacteria 1640
333 Ga0207687_10749636 3300025927 Unclassified 831
334 Ga0207644_10011109 3300025931 Bacteria 5948
335 Ga0207644_10234052 3300025931 Bacteria 1461
336 Ga0207644_10267608 3300025931 Bacteria 1368
337 Ga0207690_10951533 3300025932 Bacteria 713
338 Ga0207690_10952488 3300025932 Unclassified 713
339 Ga0207706_10263219 3300025933 Bacteria 1505
340 Ga0207706_11002941 3300025933 Bacteria 701
341 Ga0207686_10031010 3300025934 Bacteria 3171
342 Ga0207686_10671935 3300025934 Bacteria 821
343 Ga0207709_10848383 3300025935 Unclassified 740
344 Ga0207709_11064405 3300025935 Bacteria 663
345 Ga0207670_10132553 3300025936 Bacteria 1828
346 Ga0207670_10169630 3300025936 Bacteria 1635
347 Ga0207670_10556756 3300025936 Bacteria 937
348 Ga0207669_10489327 3300025937 Bacteria 982
349 Ga0207669_10675653 3300025937 Bacteria 847
350 Ga0207704_10004694 3300025938 Bacteria 6267
351 Ga0207704_10238043 3300025938 Bacteria 1358
352 Ga0207704_10909232 3300025938 Unclassified 740
353 Ga0207665_10402379 3300025939 Bacteria 1043
354 Ga0207665_10680274 3300025939 Bacteria 808
355 Ga0207691_10002188 3300025940 Bacteria 19113
356 Ga0207691_10028462 3300025940 Bacteria 5233
357 Ga0207691_10037672 3300025940 Bacteria 4477
358 Ga0207691_10050955 3300025940 Bacteria 3788
359 Ga0207691_10076306 3300025940 Unclassified 3020
360 Ga0207691_10550493 3300025940 Unclassified 978
361 Ga0207711_10047094 3300025941 Bacteria 3685
362 Ga0207711_10179256 3300025941 Bacteria 1926
363 Ga0207711_10337666 3300025941 Bacteria 1394
364 Ga0207711_10533893 3300025941 Unclassified 1094
365 Ga0207711_10888711 3300025941 Bacteria 828
366 Ga0207689_10003136 3300025942 Bacteria 15170
367 Ga0207689_10039718 3300025942 Bacteria 3895
368 Ga0207689_10041190 3300025942 Bacteria 3822
369 Ga0207689_10085511 3300025942 Bacteria 2592
370 Ga0207689_10221097 3300025942 Bacteria 1565
371 Ga0207661_10904868 3300025944 Unclassified 813
372 Ga0207679_10340167 3300025945 Bacteria 1305
373 Ga0207679_10544033 3300025945 Unclassified 1041
374 Ga0207667_11289983 3300025949 Bacteria 707
375 Ga0207651_10018728 3300025960 Unclassified 4129
376 Ga0207651_10072784 3300025960 Bacteria 2441
377 Ga0207651_10222972 3300025960 Bacteria 1525
378 Ga0207651_10603989 3300025960 Bacteria 959
379 Ga0207651_10762051 3300025960 Bacteria 856
380 Ga0207651_11964552 3300025960 Bacteria 526
381 Ga0207712_10021969 3300025961 Bacteria 4195
382 Ga0207640_10074347 3300025981 Bacteria 2300
383 Ga0207640_10095055 3300025981 Bacteria 2074
384 Ga0207640_10170112 3300025981 Bacteria 1623
385 Ga0207658_10270135 3300025986 Bacteria 1453
386 Ga0207658_10345804 3300025986 Bacteria 1294
387 Ga0207677_10021970 3300026023 Bacteria 3911
388 Ga0207677_10162479 3300026023 Bacteria 1737
389 Ga0207703_11005163 3300026035 Unclassified 800
390 Ga0207703_11007013 3300026035 Bacteria 799
391 Ga0207639_10290276 3300026041 Bacteria 1442
392 Ga0207678_10086906 3300026067 Bacteria 2672
393 Ga0207708_10009309 3300026075 Bacteria 7270
394 Ga0207708_10010499 3300026075 Bacteria 6874
395 Ga0207708_10036154 3300026075 Bacteria 3760
396 Ga0207708_10046644 3300026075 Bacteria 3299
397 Ga0207708_10128116 3300026075 Bacteria 1982
398 Ga0207708_10785383 3300026075 Bacteria 819
399 Ga0207641_10072714 3300026088 Bacteria 2962
400 Ga0207641_10707920 3300026088 Bacteria 992
401 Ga0207648_10004718 3300026089 Bacteria 13934
402 Ga0207648_10021590 3300026089 Bacteria 5787
403 Ga0207676_10017528 3300026095 Bacteria 5192
404 Ga0207676_10343591 3300026095 Bacteria 1378
405 Ga0207676_10602511 3300026095 Bacteria 1055
406 Ga0207676_11057003 3300026095 Bacteria 801
407 Ga0207674_10402208 3300026116 Bacteria 1323
408 Ga0207675_100015590 3300026118 Bacteria 7089
409 Ga0207675_100091898 3300026118 Bacteria 2854
410 Ga0207675_100108349 3300026118 Bacteria 2620
411 Ga0207675_100123908 3300026118 Bacteria 2447
412 Ga0207675_101119941 3300026118 Unclassified 807
413 Ga0207675_101864449 3300026118 Bacteria 620
414 Ga0207675_102084709 3300026118 Bacteria 584
415 Ga0207683_10006728 3300026121 Bacteria 9836
416 Ga0207683_10021025 3300026121 Bacteria 5585
417 Ga0207683_10045484 3300026121 Bacteria 3839
418 Ga0207683_10937179 3300026121 Bacteria 804
419 Ga0207698_10910344 3300026142 Bacteria 887
420 Ga0207698_12248849 3300026142 Bacteria 558
421 Ga0207428_10014284 3300027907 Bacteria 6911
422 Ga0207428_10019227 3300027907 Bacteria 5825
423 Ga0207428_10124252 3300027907 Unclassified 1977
424 Ga0268266_10088022 3300028379 Bacteria 2718
425 Ga0268265_10008494 3300028380 Bacteria 6940
426 Ga0268265_10108888 3300028380 Unclassified 2257
427 Ga0268265_10234601 3300028380 Bacteria 1615
428 Ga0268265_10671006 3300028380 Bacteria 998
429 Ga0268265_11114569 3300028380 Bacteria 784
430 Ga0268264_10266455 3300028381 Bacteria 1599
431 Ga0268264_10308610 3300028381 Unclassified 1492
432 Ga0268264_10906687 3300028381 Unclassified 885
433 Ga0268264_11583791 3300028381 Bacteria 666
434 Ga0307413_11110568 3300031824 Bacteria 683
435 Ga0307413_11852262 3300031824 Unclassified 541
436 Ga0307410_10589215 3300031852 Unclassified 926
437 Ga0307407_11031396 3300031903 Unclassified 637
438 Ga0307412_11219968 3300031911 Bacteria 674
439 Ga0307409_100586721 3300031995 Unclassified 1099
440 Ga0307409_100710749 3300031995 Unclassified 1005
441 Ga0307416_100030605 3300032002 Unclassified 4041
442 Ga0307416_101280380 3300032002 Bacteria 839
443 Ga0307414_10080029 3300032004 Bacteria 2388
444 Ga0307411_10260009 3300032005 Unclassified 1370
445 Ga0307411_10319201 3300032005 Bacteria 1254
446 Ga0307415_101507551 3300032126 Unclassified 643
447 Ga0373930_0002325 3300034816 Bacteria 2936
448 Ga0373948_0012018 3300034817 Bacteria 1540
449 Ga0373950_0002176 3300034818 Bacteria 2668
450 Ga0373958_0008278 3300034819 Bacteria 1680
451 Ga0373959_0006366 3300034820 Bacteria 1957
452 Ga0373938_0000519 3300034957 Bacteria 6243
453 Ga0373929_0000376 3300035085 Bacteria 8379
454 Ga0373929_0104252 3300035085 Unclassified 718
455 Ga0373940_0009059 3300035088 Bacteria 2304
456 Ga0373940_0013110 3300035088 Bacteria 1997
457 Ga0373940_0343430 3300035088 Unclassified 522
458 Ga0373949_0001214 3300035090 Bacteria 7636
459 Ga0373949_0050099 3300035090 Bacteria 1050
460 Ga0373949_0066030 3300035090 Unclassified 939
461 Ga0373951_0005731 3300035091 Bacteria 2872
462 Ga0373952_0000831 3300035092 Bacteria 5586
463 Ga0373932_0000313 3300035112 Bacteria 14733
464 Ga0373932_0011807 3300035112 Unclassified 2141
465 Ga0373939_0001853 3300035114 Bacteria 5072
466 Ga0373939_0438787 3300035114 Unclassified 547
467 Ga0373941_0000172 3300035115 Bacteria 11961
468 Ga0373953_0266015 3300035117 Bacteria 746
469 Ga0373960_0004405 3300035121 Bacteria 3222
470 Ga0373943_0440640 3300035170 Bacteria 756
471 Ga0373942_0001155 3300035207 Bacteria 7000
472 Ga0373961_0007884 3300035241 Bacteria 2582
473 Ga0373961_0132600 3300035241 Unclassified 835
474 Ga0373962_0004187 3300035242 Bacteria 3475
475 Ga0373937_0532925 3300036401 Bacteria 1116
476 Ga0373925_1211874 3300037068 Bacteria 620
477 Ga0436365_1051486 3300039437 Unclassified 1208
478 Ga0436362_0821085 3300039453 Unclassified 526
479 Ga0439453_0059548 3300041408 Bacteria 788
480 Ga0451795_0045378 3300041456 Unclassified 549
481 Ga0451798_1112620 3300041458 Unclassified 926
482 Ga0451800_0490834 3300041459 Unclassified 670
483 Ga0451804_0106477 3300041463 Unclassified 564
484 Ga0451807_1197782 3300041486 Bacteria 873
485 Ga0439451_085580 3300042009 Unclassified 634
486 Ga0439446_0047205 3300042156 Bacteria 1281
487 Ga0450908_021005 3300042184 Unclassified 1147
488 Ga0439440_0102441 3300042993 Unclassified 780
489 Ga0451576_0023721 3300045051 Bacteria 6637
490 Ga0451576_0302702 3300045051 Unclassified 1672
491 Ga0495582_0149062 3300046473 Bacteria 1328
492 Ga0495663_0166501 3300046525 Bacteria 758
493 Ga0495652_0365560 3300046529 Bacteria 1030
494 Ga0495640_0024188 3300046533 Bacteria 4420
495 Ga0495609_0137071 3300046538 Bacteria 1046
496 Ga0495621_0037131 3300046539 Bacteria 1693
497 Ga0495656_0625648 3300046615 Bacteria 577
498 Ga0495656_0821919 3300046615 Bacteria 502
499 Ga0495646_0117387 3300046680 Bacteria 1509
500 Ga0495658_0014848 3300046683 Bacteria 3987
501 Ga0495658_0305763 3300046683 Bacteria 1006
502 Ga0495613_0462626 3300046689 Bacteria 858
503 Ga0495604_0711333 3300047317 Bacteria 637
504 Ga0495674_0416463 3300047319 Bacteria 1083
505 Ga0496101_0383213 3300048904 Bacteria 1106
506 Ga0496102_0938689 3300048905 Unclassified 786
507 Ga0496104_1879055 3300048907 Unclassified 501
508 Ga0496106_1043194 3300048909 Unclassified 642
509 Ga0496106_1074578 3300048909 Unclassified 631
510 Ga0496107_0254742 3300048910 Bacteria 1306
511 Ga0496108_1441493 3300048911 Bacteria 575
512 Ga0496109_0146992 3300048912 Bacteria 2206
513 Ga0496109_1846924 3300048912 Unclassified 537
514 Ga0496112_0316329 3300048915 Bacteria 1506
515 Ga0496113_0087315 3300048916 Bacteria 2398
516 Ga0501036_0745531 3300049572 Bacteria 808
517 Ga0501041_0299514 3300049577 Bacteria 1013
518 Ga0501042_0230771 3300049578 Bacteria 1335
519 Ga0501042_0461174 3300049578 Bacteria 922
520 Ga0501046_0484610 3300049580 Bacteria 887
521 Ga0501048_0608139 3300049582 Bacteria 785
522 Ga0501068_1019571 3300049584 Bacteria 546
523 Ga0501071_0053903 3300049587 Unclassified 2901
524 Ga0501071_1062300 3300049587 Unclassified 626
525 Ga0501071_1301575 3300049587 Bacteria 561
526 Ga0501072_0052817 3300049588 Unclassified 3200
527 Ga0501072_0207478 3300049588 Bacteria 1562
528 Ga0501073_0028209 3300049589 Bacteria 4011
529 Ga0501074_0056220 3300049590 Bacteria 2836
530 Ga0501074_0433007 3300049590 Bacteria 933
531 Ga0501075_1253820 3300049591 Unclassified 562
532 Ga0501076_0104913 3300049592 Unclassified 2281
533 Ga0501076_0993274 3300049592 Bacteria 691
534 Ga0501080_1350924 3300049742 Bacteria 609
535 Ga0501045_0377201 3300049824 Unclassified 1056
536 nmdc:mga06z11_17134_c1 3300050494 Bacteria 3281
537 nmdc:mga05p37_171404_c1 3300050507 Bacteria 2646
538 nmdc:mga05p37_2002047_c1 3300050507 Unclassified 548
539 nmdc:mga05p37_83533_c1 3300050507 Unclassified 3934
540 nmdc:mga09592_517955_c1 3300050508 Unclassified 1026
541 nmdc:mga0qj67_783474_c1 3300050509 Bacteria 755
542 nmdc:mga06r32_1012011_c1 3300050510 Bacteria 783
543 nmdc:mga06r32_227904_c1 3300050510 Bacteria 1851
544 nmdc:mga08y16_1335027_c1 3300050511 Bacteria 683
545 nmdc:mga08y16_1412600_c1 3300050511 Bacteria 659
546 nmdc:mga08y16_1974525_c1 3300050511 Bacteria 533
547 nmdc:mga08y16_21546_c1 3300050511 Bacteria 6805
548 nmdc:mga08y16_325649_c1 3300050511 Unclassified 1581
549 nmdc:mga08y16_400694_c1 3300050511 Bacteria 1404
550 nmdc:mga08y16_442580_c1 3300050511 Bacteria 1326
551 nmdc:mga08y16_469683_c1 3300050511 Unclassified 1281
552 nmdc:mga08y16_7151_c1 3300050511 Bacteria 11714
553 nmdc:mga08y16_793922_c1 3300050511 Bacteria 940
554 nmdc:mga0n895_109966_c1 3300050512 Unclassified 2771
555 nmdc:mga0n895_109_c1 3300050512 Bacteria 48376
556 nmdc:mga0n895_12700_c1 3300050512 Bacteria 7563
557 nmdc:mga0n895_137571_c1 3300050512 Bacteria 2470
558 nmdc:mga0n895_144515_c1 3300050512 Bacteria 2408
559 nmdc:mga0n895_191036_c1 3300050512 Bacteria 2079
560 nmdc:mga0n895_28422_c1 3300050512 Bacteria 5318
561 nmdc:mga0n895_43885_c1 3300050512 Bacteria 4359
562 nmdc:mga0rr50_17387_c1 3300050513 Bacteria 4801
563 nmdc:mga0rr50_23179_c1 3300050513 Bacteria 4275
564 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
565 nmdc:mga0rr50_478267_c1 3300050513 Unclassified 1058
566 nmdc:mga0rr50_67756_c1 3300050513 Bacteria 2713
567 nmdc:mga08x19_223_c1 3300050514 Bacteria 43405
568 nmdc:mga08x19_267095_c1 3300050514 Bacteria 1184
569 nmdc:mga08x19_42299_c1 3300050514 Bacteria 2904
570 nmdc:mga0a205_11275_c2 3300050515 Bacteria 3665
571 nmdc:mga0a205_327994_c1 3300050515 Unclassified 1401
572 nmdc:mga0a205_35383_c1 3300050515 Bacteria 4796
573 nmdc:mga0a205_6348_c1 3300050515 Bacteria 10676
574 Ga0495601_0182527 3300053077 Bacteria 1372
575 Ga0495655_0255018 3300053083 Bacteria 591
576 Ga0495619_0130904 3300053085 Bacteria 1724
577 Ga0495619_0397289 3300053085 Unclassified 952
578 Ga0501082_0738794 3300060353 Unclassified 861
579 Ga0501082_0933742 3300060353 Bacteria 759
580 Ga0501082_1005812 3300060353 Bacteria 729
581 Ga0075431_100238137
582 JGI24746J21847_1042691
583 JGI24750J21931_1054413
584 JGI24035J26624_1028422
585 Ga0065715_10153464
586 Ga0065715_10230912
587 Ga0065707_10189744
588 Ga0070676_10005963
589 Ga0070676_10215717
590 Ga0070676_10628491
591 Ga0070676_11619446
592 Ga0070683_101019101
593 Ga0070690_100023915
594 Ga0070690_100094757
595 Ga0070690_100307315
596 Ga0070670_100001593
597 Ga0070670_100021651
598 Ga0070670_100040437
599 Ga0070677_10009113
600 Ga0070677_10087600
601 Ga0070677_10214735
602 Ga0068869_100000788
603 Ga0068869_100032395
604 Ga0070666_10007203
605 Ga0070666_10016078
606 Ga0070666_10048183
607 Ga0070666_10952033
608 Ga0070680_100421363
609 Ga0070680_100576641
610 Ga0068868_100234293
611 Ga0068868_100655597
612 Ga0068868_101455871
613 Ga0068868_102236226
614 Ga0070689_100027908
615 Ga0070689_100039784
616 Ga0070689_100205125
617 Ga0070691_10065815
618 Ga0070687_100025180
619 Ga0070687_100072600
620 Ga0070687_100542501
621 Ga0070687_100982358
622 Ga0070661_100288049
623 Ga0070692_10215356
624 Ga0070668_100648179
625 Ga0070668_101000908
626 Ga0070669_100006288
627 Ga0070669_100169124
628 Ga0070669_100617686
629 Ga0070675_100002251
630 Ga0070675_100048701
631 Ga0070675_100201938
632 Ga0070675_100336744
633 Ga0070675_100414398
634 Ga0070675_100766834
635 Ga0070675_101777918
636 Ga0070671_100081981
637 Ga0070671_100514143
638 Ga0070671_101129588
639 Ga0070674_100008967
640 Ga0070674_100143527
641 Ga0070673_100074863
642 Ga0070673_100175904
643 Ga0070673_100209358
644 Ga0070673_100375892
645 Ga0070688_100075092
646 Ga0070688_100182263
647 Ga0070688_100196680
648 Ga0070688_100606333
649 Ga0070659_100168120
650 Ga0070659_100442862
651 Ga0070667_100354108
652 Ga0070667_100389103
653 Ga0070667_100471165
654 Ga0070703_10212790
655 Ga0070703_10322051
656 Ga0070701_10006915
657 Ga0070701_10034924
658 Ga0070701_10201438
659 Ga0070711_101061823
660 Ga0070705_100027764
661 Ga0070700_100014807
662 Ga0070700_100016401
663 Ga0070700_100054819
664 Ga0070700_100123950
665 Ga0070700_101667417
666 Ga0070694_100067902
667 Ga0070694_100411334
668 Ga0070708_100084800
669 Ga0070663_100063197
670 Ga0070678_100006398
671 Ga0070678_100489829
672 Ga0070678_100621765
673 Ga0070662_100339400
674 Ga0070662_100603591
675 Ga0070681_11596182
676 Ga0068867_100002997
677 Ga0068867_100003832
678 Ga0068867_100645650
679 Ga0070685_10015488
680 Ga0070707_100313437
681 Ga0070698_100372063
682 Ga0070698_100707820
683 Ga0070699_100557859
684 Ga0070697_100439142
685 Ga0068853_101839701
686 Ga0070672_100034692
687 Ga0070672_100035318
688 Ga0070672_100037140
689 Ga0070672_100108554
690 Ga0070672_100154782
691 Ga0070686_100001050
692 Ga0070686_100019971
693 Ga0070686_100139383
694 Ga0070686_101885903
695 Ga0070695_100638202
696 Ga0070693_100170918
697 Ga0070693_100514497
698 Ga0070665_100117684
699 Ga0070665_100175363
700 Ga0070665_101868491
701 Ga0070704_100516529
702 Ga0068855_100191174
703 Ga0070664_100064421
704 Ga0070664_101058880
705 Ga0068854_100081094
706 Ga0068854_100195861
707 Ga0070702_100096600
708 Ga0070702_100242601
709 Ga0068852_101322260
710 Ga0068859_100028832
711 Ga0068859_100030435
712 Ga0068859_101293574
713 Ga0068859_101806160
714 Ga0068859_102776837
715 Ga0068864_100032856
716 Ga0068864_101063425
717 Ga0068864_101143279
718 Ga0068864_101287636
719 Ga0068864_101345552
720 Ga0068866_10028834
721 Ga0068861_100060246
722 Ga0068861_101229364
723 Ga0068861_101868339
724 Ga0068861_101984428
725 Ga0068861_102018667
726 Ga0068851_10131438
727 Ga0068870_10016171
728 Ga0068870_10025841
729 Ga0068870_10087946
730 Ga0068870_10145136
731 Ga0068870_10321186
732 Ga0068863_100049088
733 Ga0068863_100333452
734 Ga0068858_100006718
735 Ga0068858_100160031
736 Ga0068858_100177115
737 Ga0068858_101122557
738 Ga0068860_100357345
739 Ga0068860_100856020
740 Ga0068862_100061361
741 Ga0081455_10302564
742 Ga0081539_10179519
743 Ga0075364_10040166
744 Ga0097621_100007748
745 Ga0097621_100351494
746 Ga0097621_100499901
747 Ga0097621_100505938
748 Ga0097621_100565507
749 Ga0097621_100956224
750 Ga0097621_101052241
751 Ga0097621_101531386
752 Ga0068871_100007305
753 Ga0068871_100071201
754 Ga0068871_100183390
755 Ga0068871_100275729
756 Ga0075428_100127028
757 Ga0075428_100377020
758 Ga0075428_101986518
759 Ga0075430_101413065
760 Ga0075431_100275555
761 Ga0075431_100841661
762 Ga0075433_10000075
763 Ga0075433_10001401
764 Ga0075433_10007830
765 Ga0075433_10024165
766 Ga0075434_100000505
767 Ga0075434_100001374
768 Ga0075434_100009308
769 Ga0075434_100009343
770 Ga0075434_100012294
771 Ga0075434_100022142
772 Ga0075434_100044659
773 Ga0075434_100349654
774 Ga0068865_100025551
775 Ga0068865_100058416
776 Ga0068865_100106672
777 Ga0068865_100689779
778 Ga0068865_101021783
779 Ga0075436_100001003
780 Ga0075436_100045572
781 Ga0075436_100061264
782 Ga0075436_100164430
783 Ga0097620_100028829
784 Ga0097620_100030435
785 Ga0097620_101293568
786 Ga0097620_101805995
787 Ga0097620_102777044
788 Ga0075435_100000129
789 Ga0075435_100000566
790 Ga0075435_100032243
791 Ga0075435_100038441
792 Ga0075435_100088315
793 Ga0105250_10333595
794 Ga0105240_10641081
795 Ga0105240_11609721
796 Ga0111539_10004849
797 Ga0111539_10073878
798 Ga0111539_10134216
799 Ga0111539_10213546
800 Ga0111539_10395468
801 Ga0111539_10404324
802 Ga0111539_10501602
803 Ga0111539_10565244
804 Ga0111539_10574273
805 Ga0111539_10577836
806 Ga0111539_10898499
807 Ga0111539_12826838
808 Ga0111539_12845379
809 Ga0105245_10853040
810 Ga0105247_10289211
811 Ga0114129_10096377
812 Ga0114129_10458004
813 Ga0105243_10076093
814 Ga0105243_10109525
815 Ga0105243_12383717
816 Ga0105241_10052831
817 Ga0105241_10290389
818 Ga0105241_12151418
819 Ga0105242_11341763
820 Ga0105242_11410363
821 Ga0105248_10129548
822 Ga0105248_10216583
823 Ga0105248_10262712
824 Ga0105248_10566753
825 Ga0105248_10572261
826 Ga0105248_11213890
827 Ga0105248_11424372
828 Ga0105238_10085559
829 Ga0105249_10001058
830 Ga0105249_10220076
831 Ga0105249_11021551
832 Ga0105239_10776249
833 Ga0105239_10852348
834 Ga0157378_10015609
835 Ga0157378_10897371
836 Ga0157378_11023711
837 Ga0163162_10003240
838 Ga0163162_10977128
839 Ga0157375_10192793
840 Ga0157375_10605370
841 Ga0157375_12668000
842 Ga0157375_13606928
843 Ga0163163_10065678
844 Ga0163163_10233713
845 Ga0163163_10440823
846 Ga0163163_11789844
847 Ga0157380_10004405
848 Ga0157380_10021374
849 Ga0157380_10036018
850 Ga0157380_10055210
851 Ga0157380_10070362
852 Ga0157380_10187909
853 Ga0157380_10681465
854 Ga0157380_11407581
855 Ga0157380_11677206
856 Ga0157380_11830724
857 Ga0157380_12264628
858 Ga0157380_13064147
859 Ga0157380_13470914
860 Ga0157377_10011680
861 Ga0157377_10618054
862 Ga0157377_11735951
863 Ga0157379_10014773
864 Ga0157379_10188786
865 Ga0157379_10373559
866 Ga0157379_11929468
867 Ga0157376_10041317
868 Ga0157376_10091148
869 Ga0157376_10355939
870 Ga0157376_12017289
871 Ga0163161_11048370
872 Ga0163161_11495517
873 Ga0213876_10453090
874 Ga0207697_10000380
875 Ga0207682_10011887
876 Ga0207682_10073409
877 Ga0207710_10071131
878 Ga0207710_10114829
879 Ga0207680_10153043
880 Ga0207680_10356907
881 Ga0207680_10512470
882 Ga0207645_10010039
883 Ga0207643_10001171
884 Ga0207643_10072842
885 Ga0207643_10147961
886 Ga0207643_10350233
887 Ga0207643_10387062
888 Ga0207654_10289124
889 Ga0207707_11132655
890 Ga0207695_10906842
891 Ga0207660_10097001
892 Ga0207660_10857091
893 Ga0207662_10013380
894 Ga0207662_10016671
895 Ga0207662_10077764
896 Ga0207662_10274068
897 Ga0207662_10512747
898 Ga0207649_10155739
899 Ga0207649_10725618
900 Ga0207646_10222945
901 Ga0207681_10052989
902 Ga0207681_10102672
903 Ga0207681_10137666
904 Ga0207681_10382139
905 Ga0207681_10600701
906 Ga0207650_10026716
907 Ga0207650_10078582
908 Ga0207650_10136663
909 Ga0207659_10009110
910 Ga0207659_10057462
911 Ga0207659_10182785
912 Ga0207659_10188465
913 Ga0207687_10749636
914 Ga0207644_10011109
915 Ga0207644_10234052
916 Ga0207644_10267608
917 Ga0207690_10951533
918 Ga0207690_10952488
919 Ga0207706_10263219
920 Ga0207706_11002941
921 Ga0207686_10031010
922 Ga0207686_10671935
923 Ga0207709_10848383
924 Ga0207709_11064405
925 Ga0207670_10132553
926 Ga0207670_10169630
927 Ga0207670_10556756
928 Ga0207669_10489327
929 Ga0207669_10675653
930 Ga0207704_10004694
931 Ga0207704_10238043
932 Ga0207704_10909232
933 Ga0207665_10402379
934 Ga0207665_10680274
935 Ga0207691_10002188
936 Ga0207691_10028462
937 Ga0207691_10037672
938 Ga0207691_10050955
939 Ga0207691_10076306
940 Ga0207691_10550493
941 Ga0207711_10047094
942 Ga0207711_10179256
943 Ga0207711_10337666
944 Ga0207711_10533893
945 Ga0207711_10888711
946 Ga0207689_10003136
947 Ga0207689_10039718
948 Ga0207689_10041190
949 Ga0207689_10085511
950 Ga0207689_10221097
951 Ga0207661_10904868
952 Ga0207679_10340167
953 Ga0207679_10544033
954 Ga0207667_11289983
955 Ga0207651_10018728
956 Ga0207651_10072784
957 Ga0207651_10222972
958 Ga0207651_10603989
959 Ga0207651_10762051
960 Ga0207651_11964552
961 Ga0207712_10021969
962 Ga0207640_10074347
963 Ga0207640_10095055
964 Ga0207640_10170112
965 Ga0207658_10270135
966 Ga0207658_10345804
967 Ga0207677_10021970
968 Ga0207677_10162479
969 Ga0207703_11005163
970 Ga0207703_11007013
971 Ga0207639_10290276
972 Ga0207678_10086906
973 Ga0207708_10009309
974 Ga0207708_10010499
975 Ga0207708_10036154
976 Ga0207708_10046644
977 Ga0207708_10128116
978 Ga0207708_10785383
979 Ga0207641_10072714
980 Ga0207641_10707920
981 Ga0207648_10004718
982 Ga0207648_10021590
983 Ga0207676_10017528
984 Ga0207676_10343591
985 Ga0207676_10602511
986 Ga0207676_11057003
987 Ga0207674_10402208
988 Ga0207675_100015590
989 Ga0207675_100091898
990 Ga0207675_100108349
991 Ga0207675_100123908
992 Ga0207675_101119941
993 Ga0207675_101864449
994 Ga0207675_102084709
995 Ga0207683_10006728
996 Ga0207683_10021025
997 Ga0207683_10045484
998 Ga0207683_10937179
999 Ga0207698_10910344
1000 Ga0207698_12248849
1001 Ga0207428_10014284
1002 Ga0207428_10019227
1003 Ga0207428_10124252
1004 Ga0268266_10088022
1005 Ga0268265_10008494
1006 Ga0268265_10108888
1007 Ga0268265_10234601
1008 Ga0268265_10671006
1009 Ga0268265_11114569
1010 Ga0268264_10266455
1011 Ga0268264_10308610
1012 Ga0268264_10906687
1013 Ga0268264_11583791
1014 Ga0307413_11110568
1015 Ga0307413_11852262
1016 Ga0307410_10589215
1017 Ga0307407_11031396
1018 Ga0307412_11219968
1019 Ga0307409_100586721
1020 Ga0307409_100710749
1021 Ga0307416_100030605
1022 Ga0307416_101280380
1023 Ga0307414_10080029
1024 Ga0307411_10260009
1025 Ga0307411_10319201
1026 Ga0307415_101507551
1027 Ga0373930_0002325
1028 Ga0373948_0012018
1029 Ga0373950_0002176
1030 Ga0373958_0008278
1031 Ga0373959_0006366
1032 Ga0373938_0000519
1033 Ga0373929_0000376
1034 Ga0373929_0104252
1035 Ga0373940_0009059
1036 Ga0373940_0013110
1037 Ga0373940_0343430
1038 Ga0373949_0001214
1039 Ga0373949_0050099
1040 Ga0373949_0066030
1041 Ga0373951_0005731
1042 Ga0373952_0000831
1043 Ga0373932_0000313
1044 Ga0373932_0011807
1045 Ga0373939_0001853
1046 Ga0373939_0438787
1047 Ga0373941_0000172
1048 Ga0373953_0266015
1049 Ga0373960_0004405
1050 Ga0373943_0440640
1051 Ga0373942_0001155
1052 Ga0373961_0007884
1053 Ga0373961_0132600
1054 Ga0373962_0004187
1055 Ga0373937_0532925
1056 Ga0373925_1211874
1057 Ga0436365_1051486
1058 Ga0436362_0821085
1059 Ga0439453_0059548
1060 Ga0451795_0045378
1061 Ga0451798_1112620
1062 Ga0451800_0490834
1063 Ga0451804_0106477
1064 Ga0451807_1197782
1065 Ga0439451_085580
1066 Ga0439446_0047205
1067 Ga0450908_021005
1068 Ga0439440_0102441
1069 Ga0451576_0023721
1070 Ga0451576_0302702
1071 Ga0495582_0149062
1072 Ga0495663_0166501
1073 Ga0495652_0365560
1074 Ga0495640_0024188
1075 Ga0495609_0137071
1076 Ga0495621_0037131
1077 Ga0495656_0625648
1078 Ga0495656_0821919
1079 Ga0495646_0117387
1080 Ga0495658_0014848
1081 Ga0495658_0305763
1082 Ga0495613_0462626
1083 Ga0495604_0711333
1084 Ga0495674_0416463
1085 Ga0496101_0383213
1086 Ga0496102_0938689
1087 Ga0496104_1879055
1088 Ga0496106_1043194
1089 Ga0496106_1074578
1090 Ga0496107_0254742
1091 Ga0496108_1441493
1092 Ga0496109_0146992
1093 Ga0496109_1846924
1094 Ga0496112_0316329
1095 Ga0496113_0087315
1096 Ga0501036_0745531
1097 Ga0501041_0299514
1098 Ga0501042_0230771
1099 Ga0501042_0461174
1100 Ga0501046_0484610
1101 Ga0501048_0608139
1102 Ga0501068_1019571
1103 Ga0501071_0053903
1104 Ga0501071_1062300
1105 Ga0501071_1301575
1106 Ga0501072_0052817
1107 Ga0501072_0207478
1108 Ga0501073_0028209
1109 Ga0501074_0056220
1110 Ga0501074_0433007
1111 Ga0501075_1253820
1112 Ga0501076_0104913
1113 Ga0501076_0993274
1114 Ga0501080_1350924
1115 Ga0501045_0377201
1116 nmdc:mga06z11_17134_c1
1117 nmdc:mga05p37_171404_c1
1118 nmdc:mga05p37_2002047_c1
1119 nmdc:mga05p37_83533_c1
1120 nmdc:mga09592_517955_c1
1121 nmdc:mga0qj67_783474_c1
1122 nmdc:mga06r32_1012011_c1
1123 nmdc:mga06r32_227904_c1
1124 nmdc:mga08y16_1335027_c1
1125 nmdc:mga08y16_1412600_c1
1126 nmdc:mga08y16_1974525_c1
1127 nmdc:mga08y16_21546_c1
1128 nmdc:mga08y16_325649_c1
1129 nmdc:mga08y16_400694_c1
1130 nmdc:mga08y16_442580_c1
1131 nmdc:mga08y16_469683_c1
1132 nmdc:mga08y16_7151_c1
1133 nmdc:mga08y16_793922_c1
1134 nmdc:mga0n895_109966_c1
1135 nmdc:mga0n895_109_c1
1136 nmdc:mga0n895_12700_c1
1137 nmdc:mga0n895_137571_c1
1138 nmdc:mga0n895_144515_c1
1139 nmdc:mga0n895_191036_c1
1140 nmdc:mga0n895_28422_c1
1141 nmdc:mga0n895_43885_c1
1142 nmdc:mga0rr50_17387_c1
1143 nmdc:mga0rr50_23179_c1
1144 nmdc:mga0rr50_36_c1
1145 nmdc:mga0rr50_478267_c1
1146 nmdc:mga0rr50_67756_c1
1147 nmdc:mga08x19_223_c1
1148 nmdc:mga08x19_267095_c1
1149 nmdc:mga08x19_42299_c1
1150 nmdc:mga0a205_11275_c2
1151 nmdc:mga0a205_327994_c1
1152 nmdc:mga0a205_35383_c1
1153 nmdc:mga0a205_6348_c1
1154 Ga0495601_0182527
1155 Ga0495655_0255018
1156 Ga0495619_0130904
1157 Ga0495619_0397289
1158 Ga0501082_0738794
1159 Ga0501082_0933742
1160 Ga0501082_1005812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

48

140

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9253 13 70
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9183 13 72
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9147 8 73
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8984 8 73
5vyv-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8906 13 71
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9621 9 69 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9322 23 71 3.30.230.130
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 9 69 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9253 13 70 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9249 13 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5SU18-F1-model_v4 deleted 0.9685 6 72
AF-A0A0K8NV68-F1-model_v4 Uncharacterized protein 0.9523 9 73
AF-A0A2D6Q9B9-F1-model_v4 ArsR family transcriptional regulator 0.9503 13 71
AF-A0A2V8ZG77-F1-model_v4 CopY family transcriptional regulator 0.9498 6 102 GO:0003677
GO:0045892
AF-A0A2S5SWH3-F1-model_v4 Uncharacterized protein 0.9401 9 73

Map