F465921

General Info

Members Datasets Scaffolds Average Seq Length
580 214 580 150

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100237508|Ga0070695_1002375082
Length 160
Sequence MSYAQRKEISGNRTLAIILVAVIQLGLGYAIVTGLAYNVIKKTVQDLKTFNVEDMPDISPKLEPARAKGDVRMLFSDSDYPASAQAAGAQGTAQAQLTIGPDGRVVGCSLVRSTGNGALDTATCNILRRRAKFTPAHDTTGAATTDTYTTPPITWRLAEE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 4.66
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001749 3300001979 Bacteria 9985
2 JGI24740J21852_10007690 3300001979 Bacteria 4361
3 JGI24740J21852_10009756 3300001979 Bacteria 3737
4 JGI24739J22299_10006141 3300001989 Bacteria 4538
5 JGI24737J22298_10000437 3300001990 Bacteria 14247
6 JGI24735J21928_10008978 3300002067 Bacteria 3222
7 JGI24738J21930_10008263 3300002075 Bacteria 2370
8 rootH2_10227537 3300003320 Bacteria 1043
9 Ga0070658_10011920 3300005327 Bacteria 6981
10 Ga0070658_10037201 3300005327 Bacteria 3922
11 Ga0070658_10061150 3300005327 Bacteria 3068
12 Ga0070658_10075606 3300005327 Bacteria 2763
13 Ga0070658_10091050 3300005327 Bacteria 2513
14 Ga0070658_10096390 3300005327 Bacteria 2442
15 Ga0070658_10112212 3300005327 Bacteria 2259
16 Ga0070658_10124162 3300005327 Bacteria 2148
17 Ga0070658_10126150 3300005327 Bacteria 2131
18 Ga0070658_10333564 3300005327 Bacteria 1296
19 Ga0070676_10029301 3300005328 Bacteria 3131
20 Ga0070683_100023262 3300005329 Bacteria 5541
21 Ga0070683_100027852 3300005329 Bacteria 5100
22 Ga0070683_100335146 3300005329 Bacteria 1440
23 Ga0070690_100019531 3300005330 Bacteria 4115
24 Ga0070670_100027221 3300005331 Bacteria 4918
25 Ga0070670_100054562 3300005331 Bacteria 3431
26 Ga0070670_100302444 3300005331 Unclassified 1399
27 Ga0070670_100537853 3300005331 Bacteria 1042
28 Ga0068869_100030209 3300005334 Bacteria 3802
29 Ga0068869_100073637 3300005334 Bacteria 2533
30 Ga0068869_100472432 3300005334 Bacteria 1043
31 Ga0070666_10001192 3300005335 Bacteria 15739
32 Ga0070666_10169730 3300005335 Bacteria 1527
33 Ga0070680_100318756 3300005336 Bacteria 1319
34 Ga0070682_100024223 3300005337 Bacteria 3610
35 Ga0068868_100011876 3300005338 Bacteria 6350
36 Ga0068868_100014488 3300005338 Bacteria 5811
37 Ga0068868_100130556 3300005338 Bacteria 2056
38 Ga0068868_100178751 3300005338 Bacteria 1759
39 Ga0070660_100022816 3300005339 Bacteria 4634
40 Ga0070660_100024573 3300005339 Bacteria 4470
41 Ga0070660_100030494 3300005339 Bacteria 4046
42 Ga0070660_100081113 3300005339 Bacteria 2546
43 Ga0070660_100252854 3300005339 Bacteria 1437
44 Ga0070660_100352931 3300005339 Bacteria 1211
45 Ga0070660_100507087 3300005339 Bacteria 1004
46 Ga0070660_100712048 3300005339 Unclassified 842
47 Ga0070689_100183886 3300005340 Bacteria 1699
48 Ga0070691_10002882 3300005341 Bacteria 7703
49 Ga0070687_100115384 3300005343 Bacteria 1527
50 Ga0070661_100052253 3300005344 Bacteria 2991
51 Ga0070661_100120693 3300005344 Bacteria 1963
52 Ga0070661_100642614 3300005344 Unclassified 861
53 Ga0070692_10009633 3300005345 Bacteria 4365
54 Ga0070692_10120183 3300005345 Bacteria 1464
55 Ga0070668_100027417 3300005347 Bacteria 4325
56 Ga0070668_100031969 3300005347 Bacteria 4005
57 Ga0070668_100252997 3300005347 Bacteria 1463
58 Ga0070669_100089087 3300005353 Bacteria 2310
59 Ga0070669_100235621 3300005353 Bacteria 1452
60 Ga0070675_100241355 3300005354 Bacteria 1579
61 Ga0070671_100000789 3300005355 Bacteria 22803
62 Ga0070671_100012914 3300005355 Bacteria 6731
63 Ga0070671_100032700 3300005355 Bacteria 4298
64 Ga0070671_100072623 3300005355 Bacteria 2874
65 Ga0070671_100234203 3300005355 Bacteria 1558
66 Ga0070671_100742101 3300005355 Unclassified 853
67 Ga0070673_100097422 3300005364 Bacteria 2415
68 Ga0070673_100751908 3300005364 Bacteria 898
69 Ga0070659_100012501 3300005366 Bacteria 6294
70 Ga0070659_100015805 3300005366 Bacteria 5657
71 Ga0070659_100023839 3300005366 Bacteria 4686
72 Ga0070659_100240350 3300005366 Bacteria 1498
73 Ga0070659_100291607 3300005366 Bacteria 1359
74 Ga0070659_100294702 3300005366 Bacteria 1351
75 Ga0070659_100596943 3300005366 Bacteria 948
76 Ga0070667_100000836 3300005367 Bacteria 28641
77 Ga0070667_100006939 3300005367 Bacteria 9410
78 Ga0070667_100072284 3300005367 Bacteria 2939
79 Ga0070667_100084272 3300005367 Bacteria 2724
80 Ga0070667_100200348 3300005367 Bacteria 1771
81 Ga0070709_10017933 3300005434 Bacteria 4068
82 Ga0070714_100094321 3300005435 Bacteria 2627
83 Ga0070714_100163827 3300005435 Bacteria 2014
84 Ga0070714_100235368 3300005435 Bacteria 1688
85 Ga0070714_100438025 3300005435 Bacteria 1240
86 Ga0070713_100021398 3300005436 Bacteria 4973
87 Ga0070701_10367559 3300005438 Bacteria 903
88 Ga0070694_100012672 3300005444 Bacteria 5248
89 Ga0070663_100059383 3300005455 Bacteria 2749
90 Ga0070663_100224759 3300005455 Bacteria 1475
91 Ga0070663_100389677 3300005455 Bacteria 1136
92 Ga0070663_100457977 3300005455 Bacteria 1052
93 Ga0070678_100001974 3300005456 Bacteria 11082
94 Ga0070678_100010233 3300005456 Bacteria 5720
95 Ga0070662_100007775 3300005457 Bacteria 6965
96 Ga0070662_100022795 3300005457 Bacteria 4292
97 Ga0070662_100029531 3300005457 Bacteria 3827
98 Ga0070662_100031711 3300005457 Bacteria 3711
99 Ga0070662_100069047 3300005457 Bacteria 2599
100 Ga0070681_10098411 3300005458 Bacteria 2871
101 Ga0068867_100004370 3300005459 Bacteria 9950
102 Ga0068867_100035898 3300005459 Bacteria 3597
103 Ga0068867_100213572 3300005459 Bacteria 1551
104 Ga0070679_100261481 3300005530 Bacteria 1686
105 Ga0070679_100271259 3300005530 Bacteria 1651
106 Ga0070684_100002471 3300005535 Bacteria 13605
107 Ga0070684_100108365 3300005535 Bacteria 2489
108 Ga0068853_100009684 3300005539 Bacteria 7769
109 Ga0068853_100132930 3300005539 Bacteria 2228
110 Ga0068853_100333542 3300005539 Bacteria 1408
111 Ga0070672_100015371 3300005543 Bacteria 5448
112 Ga0070672_100015815 3300005543 Bacteria 5387
113 Ga0070686_100008248 3300005544 Bacteria 5832
114 Ga0070695_100237508 3300005545 Bacteria 1320
115 Ga0070693_100018119 3300005547 Bacteria 3673
116 Ga0070665_100012573 3300005548 Bacteria 8524
117 Ga0068855_100049492 3300005563 Bacteria 4956
118 Ga0068855_100089424 3300005563 Bacteria 3555
119 Ga0068855_100181088 3300005563 Bacteria 2382
120 Ga0068855_100302970 3300005563 Bacteria 1769
121 Ga0070664_100002272 3300005564 Bacteria 15459
122 Ga0070664_100002857 3300005564 Bacteria 13980
123 Ga0070664_100009887 3300005564 Bacteria 7731
124 Ga0070664_100012887 3300005564 Bacteria 6803
125 Ga0070664_100018627 3300005564 Bacteria 5707
126 Ga0068857_100000424 3300005577 Bacteria 29783
127 Ga0068857_100005346 3300005577 Bacteria 10943
128 Ga0068857_100005446 3300005577 Bacteria 10854
129 Ga0068857_100006304 3300005577 Bacteria 10154
130 Ga0068857_100010041 3300005577 Bacteria 8224
131 Ga0068857_100011662 3300005577 Bacteria 7645
132 Ga0068857_100395433 3300005577 Bacteria 1285
133 Ga0068857_100857302 3300005577 Bacteria 869
134 Ga0068854_100030742 3300005578 Bacteria 3727
135 Ga0068854_100049593 3300005578 Bacteria 2999
136 Ga0068854_100054969 3300005578 Bacteria 2865
137 Ga0068854_100060225 3300005578 Bacteria 2746
138 Ga0068856_100019388 3300005614 Bacteria 6602
139 Ga0068856_100028999 3300005614 Bacteria 5408
140 Ga0068856_100097485 3300005614 Bacteria 2929
141 Ga0068856_100169021 3300005614 Bacteria 2198
142 Ga0068856_100221027 3300005614 Bacteria 1909
143 Ga0068856_100334655 3300005614 Bacteria 1532
144 Ga0068856_100620091 3300005614 Bacteria 1102
145 Ga0068852_100024324 3300005616 Bacteria 4893
146 Ga0068852_100024761 3300005616 Bacteria 4855
147 Ga0068852_100039707 3300005616 Bacteria 3964
148 Ga0068852_100058698 3300005616 Bacteria 3334
149 Ga0068852_100438240 3300005616 Bacteria 1291
150 Ga0068852_100550100 3300005616 Bacteria 1154
151 Ga0068859_100007663 3300005617 Bacteria 10972
152 Ga0068859_100017405 3300005617 Bacteria 7222
153 Ga0068859_100098336 3300005617 Bacteria 2980
154 Ga0068859_100101529 3300005617 Bacteria 2934
155 Ga0068859_100186772 3300005617 Bacteria 2156
156 Ga0068859_100233329 3300005617 Bacteria 1928
157 Ga0068864_100000078 3300005618 Bacteria 103622
158 Ga0068864_100025754 3300005618 Bacteria 4958
159 Ga0068864_100029690 3300005618 Bacteria 4633
160 Ga0068864_100063522 3300005618 Bacteria 3200
161 Ga0068864_100175246 3300005618 Unclassified 1957
162 Ga0068851_10049842 3300005834 Bacteria 2125
163 Ga0068851_10100716 3300005834 Bacteria 1533
164 Ga0068851_10222593 3300005834 Bacteria 1061
165 Ga0068863_100000882 3300005841 Bacteria 30167
166 Ga0068863_100006447 3300005841 Bacteria 11509
167 Ga0068863_100007990 3300005841 Bacteria 10340
168 Ga0068863_100012042 3300005841 Bacteria 8356
169 Ga0068863_100021273 3300005841 Bacteria 6191
170 Ga0068863_100340016 3300005841 Bacteria 1460
171 Ga0068858_100000874 3300005842 Bacteria 31179
172 Ga0068858_100024269 3300005842 Bacteria 5651
173 Ga0068858_100045644 3300005842 Bacteria 4061
174 Ga0068858_100076547 3300005842 Bacteria 3107
175 Ga0068858_100163805 3300005842 Bacteria 2094
176 Ga0068860_100024087 3300005843 Bacteria 5884
177 Ga0068860_100040147 3300005843 Bacteria 4474
178 Ga0068860_100045393 3300005843 Bacteria 4190
179 Ga0068860_100115400 3300005843 Bacteria 2568
180 Ga0068860_100188697 3300005843 Bacteria 1994
181 Ga0068860_100912823 3300005843 Bacteria 894
182 Ga0068862_100022720 3300005844 Bacteria 5248
183 Ga0068862_100064993 3300005844 Bacteria 3141
184 Ga0068862_100223251 3300005844 Bacteria 1706
185 Ga0070717_10049129 3300006028 Bacteria 3463
186 Ga0070712_100094472 3300006175 Bacteria 2197
187 Ga0075362_10015029 3300006177 Bacteria 3140
188 Ga0075366_10194703 3300006195 Bacteria 1232
189 Ga0097621_100022079 3300006237 Bacteria 4936
190 Ga0068871_100029650 3300006358 Bacteria 4299
191 Ga0075433_10008933 3300006852 Bacteria 8001
192 Ga0075434_100385818 3300006871 Bacteria 1422
193 Ga0068865_100053377 3300006881 Bacteria 2804
194 Ga0068865_100171967 3300006881 Bacteria 1662
195 Ga0097620_100007663 3300006931 Bacteria 10972
196 Ga0097620_100017404 3300006931 Bacteria 7222
197 Ga0097620_100098336 3300006931 Bacteria 2980
198 Ga0097620_100101529 3300006931 Bacteria 2934
199 Ga0097620_100186782 3300006931 Bacteria 2156
200 Ga0097620_100233339 3300006931 Bacteria 1928
201 Ga0075435_100177985 3300007076 Bacteria 1797
202 Ga0075435_100441963 3300007076 Unclassified 1121
203 Ga0105240_10025727 3300009093 Bacteria 7731
204 Ga0105240_10191183 3300009093 Bacteria 2407
205 Ga0105240_10266643 3300009093 Bacteria 1973
206 Ga0111539_10263877 3300009094 Bacteria 2005
207 Ga0105245_10006613 3300009098 Bacteria 10180
208 Ga0105245_10038031 3300009098 Bacteria 4280
209 Ga0105245_10060421 3300009098 Bacteria 3413
210 Ga0105247_10069037 3300009101 Bacteria 2204
211 Ga0105247_10117243 3300009101 Bacteria 1721
212 Ga0105243_10824345 3300009148 Unclassified 916
213 Ga0105243_11219036 3300009148 Bacteria 766
214 Ga0105241_10144185 3300009174 Bacteria 1942
215 Ga0105241_10147154 3300009174 Bacteria 1923
216 Ga0105248_10000413 3300009177 Bacteria 49136
217 Ga0105248_10010623 3300009177 Bacteria 10151
218 Ga0105248_10026996 3300009177 Bacteria 6387
219 Ga0105237_10025586 3300009545 Bacteria 6032
220 Ga0105237_10088467 3300009545 Bacteria 3087
221 Ga0105237_10313488 3300009545 Bacteria 1572
222 Ga0105238_10058011 3300009551 Bacteria 3881
223 Ga0105238_10130225 3300009551 Bacteria 2494
224 Ga0105238_10221022 3300009551 Bacteria 1870
225 Ga0105249_11018019 3300009553 Bacteria 897
226 Ga0105239_10331318 3300010375 Bacteria 1717
227 Ga0105239_10376215 3300010375 Bacteria 1605
228 Ga0105246_10026790 3300011119 Bacteria 3771
229 Ga0105246_10792506 3300011119 Bacteria 840
230 Ga0157373_10058148 3300013100 Bacteria 2742
231 Ga0157373_10073585 3300013100 Bacteria 2411
232 Ga0157371_10016861 3300013102 Bacteria 5438
233 Ga0157371_10021836 3300013102 Bacteria 4696
234 Ga0157371_10050735 3300013102 Bacteria 2949
235 Ga0157371_10210681 3300013102 Bacteria 1394
236 Ga0157370_10101856 3300013104 Bacteria 2689
237 Ga0157370_10321547 3300013104 Bacteria 1427
238 Ga0157370_10408711 3300013104 Bacteria 1249
239 Ga0157369_10247390 3300013105 Bacteria 1862
240 Ga0157369_10258346 3300013105 Bacteria 1817
241 Ga0157369_10619597 3300013105 Bacteria 1116
242 Ga0157374_10051240 3300013296 Bacteria 3840
243 Ga0157374_10227769 3300013296 Bacteria 1830
244 Ga0157378_10147256 3300013297 Bacteria 2191
245 Ga0157378_10444067 3300013297 Bacteria 1286
246 Ga0163162_10144051 3300013306 Bacteria 2497
247 Ga0163162_10189606 3300013306 Bacteria 2183
248 Ga0157372_10046002 3300013307 Bacteria 4843
249 Ga0157372_10114752 3300013307 Bacteria 3088
250 Ga0157372_10156824 3300013307 Bacteria 2630
251 Ga0157375_10038727 3300013308 Bacteria 4580
252 Ga0157375_10106733 3300013308 Bacteria 2892
253 Ga0157375_10207343 3300013308 Bacteria 2117
254 Ga0163163_10000355 3300014325 Bacteria 44183
255 Ga0163163_10052239 3300014325 Bacteria 4032
256 Ga0182008_10144219 3300014497 Bacteria 1192
257 Ga0157377_10012534 3300014745 Bacteria 4267
258 Ga0157377_10035272 3300014745 Bacteria 2743
259 Ga0157377_10038900 3300014745 Bacteria 2629
260 Ga0157379_10008315 3300014968 Bacteria 9019
261 Ga0157379_10014034 3300014968 Bacteria 7021
262 Ga0157379_10205583 3300014968 Bacteria 1781
263 Ga0157379_10259294 3300014968 Bacteria 1579
264 Ga0157376_10163183 3300014969 Bacteria 2022
265 Ga0197907_10348122 3300020069 Bacteria 3358
266 Ga0206356_11765321 3300020070 Bacteria 3131
267 Ga0206352_10695348 3300020078 Bacteria 2604
268 Ga0206354_11542634 3300020081 Bacteria 1996
269 Ga0224712_10013386 3300022467 Bacteria 2610
270 Ga0207656_10022031 3300025321 Bacteria 2552
271 Ga0207656_10094225 3300025321 Bacteria 1364
272 Ga0207656_10097911 3300025321 Bacteria 1341
273 Ga0207656_10098502 3300025321 Bacteria 1337
274 Ga0207710_10043951 3300025900 Bacteria 1989
275 Ga0207688_10059191 3300025901 Bacteria 2157
276 Ga0207680_10003609 3300025903 Bacteria 7269
277 Ga0207680_10005881 3300025903 Bacteria 5891
278 Ga0207647_10001281 3300025904 Bacteria 19328
279 Ga0207647_10001345 3300025904 Bacteria 18875
280 Ga0207647_10025933 3300025904 Bacteria 3841
281 Ga0207647_10045888 3300025904 Bacteria 2725
282 Ga0207647_10069825 3300025904 Bacteria 2123
283 Ga0207647_10104427 3300025904 Bacteria 1679
284 Ga0207699_10081535 3300025906 Bacteria 2007
285 Ga0207645_10060102 3300025907 Bacteria 2427
286 Ga0207705_10006192 3300025909 Bacteria 8898
287 Ga0207705_10039327 3300025909 Bacteria 3389
288 Ga0207705_10044715 3300025909 Bacteria 3182
289 Ga0207705_10068679 3300025909 Bacteria 2566
290 Ga0207705_10070806 3300025909 Bacteria 2527
291 Ga0207705_10079286 3300025909 Bacteria 2391
292 Ga0207705_10232895 3300025909 Bacteria 1401
293 Ga0207654_10114875 3300025911 Bacteria 1681
294 Ga0207695_10020420 3300025913 Bacteria 7588
295 Ga0207695_10191825 3300025913 Bacteria 1961
296 Ga0207671_10083862 3300025914 Bacteria 2393
297 Ga0207693_10128733 3300025915 Bacteria 1990
298 Ga0207662_10046394 3300025918 Bacteria 2570
299 Ga0207662_10115081 3300025918 Bacteria 1681
300 Ga0207657_10002226 3300025919 Bacteria 21039
301 Ga0207657_10004148 3300025919 Bacteria 15361
302 Ga0207657_10006333 3300025919 Bacteria 12295
303 Ga0207657_10026801 3300025919 Bacteria 5287
304 Ga0207657_10048808 3300025919 Bacteria 3694
305 Ga0207657_10142592 3300025919 Bacteria 1957
306 Ga0207657_10484017 3300025919 Bacteria 970
307 Ga0207649_10035179 3300025920 Bacteria 3008
308 Ga0207649_10072763 3300025920 Bacteria 2200
309 Ga0207649_10110468 3300025920 Bacteria 1835
310 Ga0207649_10127496 3300025920 Bacteria 1724
311 Ga0207649_10163689 3300025920 Bacteria 1543
312 Ga0207681_10041224 3300025923 Bacteria 3077
313 Ga0207681_10082008 3300025923 Bacteria 2278
314 Ga0207694_10194067 3300025924 Bacteria 1650
315 Ga0207650_10021499 3300025925 Bacteria 4559
316 Ga0207650_10041030 3300025925 Bacteria 3389
317 Ga0207650_10219605 3300025925 Bacteria 1529
318 Ga0207650_10463381 3300025925 Bacteria 1056
319 Ga0207659_10237572 3300025926 Bacteria 1473
320 Ga0207687_10022941 3300025927 Bacteria 4155
321 Ga0207687_10061409 3300025927 Bacteria 2654
322 Ga0207687_10157000 3300025927 Bacteria 1742
323 Ga0207700_10019853 3300025928 Bacteria 4548
324 Ga0207700_10021521 3300025928 Bacteria 4405
325 Ga0207664_10094947 3300025929 Bacteria 2452
326 Ga0207664_10223562 3300025929 Bacteria 1634
327 Ga0207664_10263844 3300025929 Bacteria 1507
328 Ga0207664_10315366 3300025929 Bacteria 1379
329 Ga0207644_10002434 3300025931 Bacteria 11996
330 Ga0207644_10015074 3300025931 Bacteria 5185
331 Ga0207644_10216759 3300025931 Bacteria 1515
332 Ga0207690_10001514 3300025932 Bacteria 14537
333 Ga0207690_10001815 3300025932 Bacteria 13100
334 Ga0207690_10004995 3300025932 Bacteria 7834
335 Ga0207690_10007352 3300025932 Bacteria 6537
336 Ga0207690_10100767 3300025932 Bacteria 2062
337 Ga0207690_10157373 3300025932 Bacteria 1690
338 Ga0207690_10239139 3300025932 Bacteria 1398
339 Ga0207690_10420978 3300025932 Bacteria 1068
340 Ga0207706_10005493 3300025933 Bacteria 11819
341 Ga0207706_10008878 3300025933 Bacteria 9253
342 Ga0207706_10009166 3300025933 Bacteria 9100
343 Ga0207706_10029701 3300025933 Bacteria 4879
344 Ga0207706_10175944 3300025933 Bacteria 1880
345 Ga0207706_10274764 3300025933 Bacteria 1470
346 Ga0207709_10061071 3300025935 Bacteria 2353
347 Ga0207670_10154132 3300025936 Bacteria 1708
348 Ga0207704_10022109 3300025938 Bacteria 3401
349 Ga0207665_10064085 3300025939 Bacteria 2497
350 Ga0207691_10019957 3300025940 Bacteria 6340
351 Ga0207691_10031623 3300025940 Bacteria 4938
352 Ga0207691_10035290 3300025940 Bacteria 4643
353 Ga0207711_10000218 3300025941 Bacteria 61467
354 Ga0207711_10038776 3300025941 Bacteria 4051
355 Ga0207711_10139359 3300025941 Bacteria 2181
356 Ga0207689_10004458 3300025942 Bacteria 12697
357 Ga0207689_10043365 3300025942 Bacteria 3719
358 Ga0207689_10081410 3300025942 Bacteria 2661
359 Ga0207661_10005261 3300025944 Bacteria 9104
360 Ga0207661_10034322 3300025944 Bacteria 3944
361 Ga0207661_10278480 3300025944 Bacteria 1494
362 Ga0207679_10016086 3300025945 Bacteria 4961
363 Ga0207679_10020084 3300025945 Bacteria 4503
364 Ga0207679_10113798 3300025945 Bacteria 2141
365 Ga0207679_10114820 3300025945 Bacteria 2133
366 Ga0207679_10121163 3300025945 Bacteria 2083
367 Ga0207679_10148427 3300025945 Unclassified 1905
368 Ga0207667_10062034 3300025949 Bacteria 3910
369 Ga0207667_10110739 3300025949 Bacteria 2832
370 Ga0207667_10123647 3300025949 Bacteria 2666
371 Ga0207667_10154203 3300025949 Bacteria 2364
372 Ga0207667_10169394 3300025949 Bacteria 2245
373 Ga0207667_10236828 3300025949 Bacteria 1868
374 Ga0207667_11016428 3300025949 Unclassified 816
375 Ga0207651_10006923 3300025960 Bacteria 5994
376 Ga0207651_10010070 3300025960 Bacteria 5218
377 Ga0207651_10034399 3300025960 Bacteria 3281
378 Ga0207651_10203799 3300025960 Bacteria 1587
379 Ga0207651_11087280 3300025960 Unclassified 716
380 Ga0207712_10001363 3300025961 Bacteria 16740
381 Ga0207712_10075106 3300025961 Bacteria 2442
382 Ga0207712_10082997 3300025961 Bacteria 2338
383 Ga0207640_10014556 3300025981 Bacteria 4533
384 Ga0207640_10032695 3300025981 Bacteria 3227
385 Ga0207640_10203049 3300025981 Bacteria 1504
386 Ga0207658_10007069 3300025986 Bacteria 7644
387 Ga0207658_10033231 3300025986 Bacteria 3678
388 Ga0207658_10221936 3300025986 Bacteria 1590
389 Ga0207658_10281680 3300025986 Bacteria 1425
390 Ga0207677_10015748 3300026023 Bacteria 4459
391 Ga0207677_10019761 3300026023 Bacteria 4075
392 Ga0207677_10048633 3300026023 Bacteria 2856
393 Ga0207703_10006561 3300026035 Bacteria 9282
394 Ga0207703_10028418 3300026035 Bacteria 4408
395 Ga0207703_10028966 3300026035 Bacteria 4369
396 Ga0207703_10042441 3300026035 Bacteria 3649
397 Ga0207639_10039207 3300026041 Bacteria 3528
398 Ga0207639_10048533 3300026041 Bacteria 3214
399 Ga0207639_10077587 3300026041 Bacteria 2619
400 Ga0207639_10175840 3300026041 Bacteria 1817
401 Ga0207639_10305380 3300026041 Bacteria 1408
402 Ga0207678_10025460 3300026067 Bacteria 5164
403 Ga0207678_10047953 3300026067 Bacteria 3693
404 Ga0207678_10053707 3300026067 Bacteria 3472
405 Ga0207678_10299349 3300026067 Bacteria 1382
406 Ga0207702_10049535 3300026078 Bacteria 3545
407 Ga0207702_10278932 3300026078 Bacteria 1579
408 Ga0207641_10000573 3300026088 Bacteria 40695
409 Ga0207641_10009481 3300026088 Bacteria 8023
410 Ga0207641_10028905 3300026088 Bacteria 4582
411 Ga0207641_10033451 3300026088 Bacteria 4270
412 Ga0207641_10075309 3300026088 Bacteria 2914
413 Ga0207641_10089990 3300026088 Bacteria 2683
414 Ga0207641_10135099 3300026088 Bacteria 2219
415 Ga0207648_10005572 3300026089 Bacteria 12668
416 Ga0207648_10032713 3300026089 Bacteria 4589
417 Ga0207648_10208825 3300026089 Bacteria 1733
418 Ga0207648_10794584 3300026089 Bacteria 881
419 Ga0207676_10000783 3300026095 Bacteria 24809
420 Ga0207676_10053238 3300026095 Bacteria 3167
421 Ga0207676_10093916 3300026095 Bacteria 2470
422 Ga0207676_10123915 3300026095 Bacteria 2184
423 Ga0207676_10142352 3300026095 Bacteria 2054
424 Ga0207674_10000725 3300026116 Bacteria 43126
425 Ga0207674_10002909 3300026116 Bacteria 21260
426 Ga0207674_10005438 3300026116 Bacteria 15125
427 Ga0207674_10009776 3300026116 Bacteria 10924
428 Ga0207674_10010178 3300026116 Bacteria 10684
429 Ga0207674_10013154 3300026116 Bacteria 9210
430 Ga0207674_10601426 3300026116 Bacteria 1062
431 Ga0207675_100627167 3300026118 Bacteria 1080
432 Ga0207683_10004440 3300026121 Bacteria 12117
433 Ga0207683_10027882 3300026121 Bacteria 4881
434 Ga0207698_10010089 3300026142 Bacteria 6050
435 Ga0207698_10021583 3300026142 Bacteria 4457
436 Ga0207698_10098047 3300026142 Bacteria 2421
437 Ga0207698_10109292 3300026142 Bacteria 2313
438 Ga0268266_10012094 3300028379 Bacteria 7469
439 Ga0268266_10261897 3300028379 Unclassified 1603
440 Ga0268266_10373434 3300028379 Bacteria 1343
441 Ga0268265_10058641 3300028380 Bacteria 2940
442 Ga0268265_10092702 3300028380 Bacteria 2418
443 Ga0268265_10103717 3300028380 Bacteria 2303
444 Ga0268264_10065366 3300028381 Bacteria 3064
445 Ga0268264_10090510 3300028381 Bacteria 2637
446 Ga0268264_10299979 3300028381 Bacteria 1512
447 Ga0268264_10396143 3300028381 Bacteria 1326
448 Ga0268264_10624429 3300028381 Bacteria 1064
449 Ga0307509_10621874 3300031507 Unclassified 751
450 Ga0307408_100038939 3300031548 Bacteria 3356
451 Ga0307412_10246961 3300031911 Bacteria 1384
452 Ga0307415_100007479 3300032126 Bacteria 5980
453 Ga0307415_100163022 3300032126 Bacteria 1730
454 Ga0307415_100811501 3300032126 Unclassified 855
455 Ga0373943_0506817 3300035170 Bacteria 706
456 Ga0373931_0126451 3300035691 Bacteria 1467
457 Ga0373935_0011985 3300035692 Bacteria 5210
458 Ga0395899_0047865 3300037312 Bacteria 3182
459 Ga0395899_0064644 3300037312 Bacteria 2690
460 Ga0395899_0138330 3300037312 Bacteria 1734
461 Ga0395899_0179226 3300037312 Bacteria 1488
462 Ga0395899_0198340 3300037312 Bacteria 1401
463 Ga0395900_0001148 3300037418 Bacteria 33301
464 Ga0395900_0037965 3300037418 Bacteria 4966
465 Ga0395900_0047925 3300037418 Bacteria 4401
466 Ga0395900_0056957 3300037418 Bacteria 4023
467 Ga0395900_0077551 3300037418 Bacteria 3413
468 Ga0395900_0081955 3300037418 Bacteria 3314
469 Ga0395900_0089111 3300037418 Bacteria 3172
470 Ga0395900_0119341 3300037418 Bacteria 2707
471 Ga0395900_0154895 3300037418 Bacteria 2340
472 Ga0395900_0173978 3300037418 Bacteria 2190
473 Ga0395900_0207046 3300037418 Bacteria 1982
474 Ga0395900_0314546 3300037418 Bacteria 1548
475 Ga0395900_0460997 3300037418 Bacteria 1226
476 Ga0395900_0662801 3300037418 Unclassified 979
477 Ga0395900_0777590 3300037418 Bacteria 886
478 Ga0395900_0842873 3300037418 Bacteria 842
479 Ga0395898_0019121 3300037466 Bacteria 6974
480 Ga0395898_0054130 3300037466 Bacteria 3917
481 Ga0395898_0071693 3300037466 Bacteria 3347
482 Ga0395898_0111166 3300037466 Bacteria 2626
483 Ga0395898_0135549 3300037466 Bacteria 2357
484 Ga0395898_0187147 3300037466 Bacteria 1978
485 Ga0395898_0698746 3300037466 Unclassified 956
486 Ga0395905_0000649 3300037471 Bacteria 46291
487 Ga0395905_0004074 3300037471 Bacteria 15319
488 Ga0395905_0006002 3300037471 Bacteria 12300
489 Ga0395905_0015441 3300037471 Bacteria 7260
490 Ga0395905_0018079 3300037471 Bacteria 6691
491 Ga0395905_0024167 3300037471 Bacteria 5735
492 Ga0395905_0030561 3300037471 Bacteria 5073
493 Ga0395905_0036895 3300037471 Bacteria 4591
494 Ga0395905_0057463 3300037471 Bacteria 3639
495 Ga0395905_0063882 3300037471 Bacteria 3445
496 Ga0395905_0128573 3300037471 Bacteria 2382
497 Ga0395905_0153385 3300037471 Bacteria 2167
498 Ga0395905_0189924 3300037471 Bacteria 1927
499 Ga0395905_0236682 3300037471 Bacteria 1707
500 Ga0395905_0410573 3300037471 Bacteria 1249
501 Ga0395905_0600870 3300037471 Bacteria 1002
502 Ga0395901_0003117 3300038443 Bacteria 16656
503 Ga0395901_0042902 3300038443 Bacteria 4691
504 Ga0395901_0059256 3300038443 Bacteria 3983
505 Ga0395901_0081711 3300038443 Bacteria 3375
506 Ga0395901_0113734 3300038443 Bacteria 2842
507 Ga0395901_0141602 3300038443 Bacteria 2527
508 Ga0395901_0177699 3300038443 Bacteria 2232
509 Ga0395901_0186888 3300038443 Bacteria 2173
510 Ga0395901_0268670 3300038443 Bacteria 1774
511 Ga0395901_0730844 3300038443 Bacteria 984
512 Ga0395901_0822070 3300038443 Bacteria 916
513 Ga0439448_0004558 3300042005 Bacteria 3913
514 Ga0439458_0000646 3300042157 Bacteria 8999
515 Ga0466965_0087756 3300044683 Bacteria 1579
516 Ga0466961_0022283 3300044693 Bacteria 4075
517 Ga0466963_0013724 3300044694 Bacteria 4983
518 Ga0466963_0015246 3300044694 Bacteria 4754
519 Ga0466963_0074499 3300044694 Bacteria 2289
520 Ga0466971_0003152 3300044719 Bacteria 7031
521 Ga0466957_0014833 3300044842 Bacteria 4542
522 Ga0466957_0225408 3300044842 Bacteria 1239
523 Ga0466957_0322221 3300044842 Bacteria 1043
524 Ga0466959_0303860 3300045049 Bacteria 1092
525 Ga0466958_0069643 3300045836 Bacteria 2151
526 Ga0466958_0108953 3300045836 Bacteria 1728
527 Ga0466958_0271467 3300045836 Bacteria 1086
528 Ga0466967_0026614 3300045976 Bacteria 4793
529 Ga0466967_0140712 3300045976 Bacteria 2247
530 Ga0495606_0594294 3300046507 Bacteria 544
531 Ga0496100_0040957 3300048903 Bacteria 2950
532 Ga0496100_0052457 3300048903 Bacteria 2652
533 Ga0496101_0015211 3300048904 Bacteria 5179
534 Ga0496102_0011737 3300048905 Bacteria 7561
535 Ga0496102_0110936 3300048905 Bacteria 2557
536 Ga0496102_0846532 3300048905 Bacteria 837
537 Ga0496103_0339668 3300048906 Bacteria 966
538 Ga0496104_0047452 3300048907 Bacteria 4048
539 Ga0496104_0344838 3300048907 Bacteria 1402
540 Ga0496105_0109227 3300048908 Bacteria 2283
541 Ga0496105_0418991 3300048908 Bacteria 1060
542 Ga0496106_0051547 3300048909 Bacteria 3103
543 Ga0496106_0119557 3300048909 Bacteria 2058
544 Ga0496107_0022021 3300048910 Bacteria 4501
545 Ga0496107_0022973 3300048910 Bacteria 4409
546 Ga0496108_0000676 3300048911 Bacteria 26369
547 Ga0496108_0135752 3300048911 Bacteria 2116
548 Ga0496108_0176304 3300048911 Bacteria 1850
549 Ga0496109_0360450 3300048912 Bacteria 1373
550 Ga0496110_0054338 3300048913 Bacteria 3522
551 Ga0496110_0109407 3300048913 Bacteria 2482
552 Ga0496110_0773137 3300048913 Unclassified 864
553 Ga0496111_0005356 3300048914 Bacteria 8203
554 Ga0496111_0123720 3300048914 Bacteria 1911
555 Ga0496112_0188088 3300048915 Bacteria 2028
556 Ga0496113_0439089 3300048916 Bacteria 1048
557 Ga0496114_0195807 3300048917 Bacteria 1769
558 Ga0501067_0010483 3300049583 Bacteria 5131
559 Ga0501069_0061553 3300049585 Bacteria 2096
560 nmdc:mga03683_277784_c1 3300050489 Bacteria 782
561 nmdc:mga06r32_433354_c1 3300050510 Bacteria 1295
562 nmdc:mga0n895_230298_c1 3300050512 Bacteria 1881
563 nmdc:mga0n895_898454_c1 3300050512 Unclassified 871
564 nmdc:mga0rr50_439069_c1 3300050513 Unclassified 1105
565 nmdc:mga0a205_2631_c1 3300050515 Bacteria 15859
566 Ga0587073_0009956 3300059492 Bacteria 1584
567 Ga0587080_010796 3300059503 Bacteria 1353
568 Ga0587085_008424 3300059506 Bacteria 1315
569 Ga0587086_006256 3300059507 Bacteria 1322
570 Ga0587091_014619 3300059511 Bacteria 1282
571 Ga0587098_002886 3300059604 Bacteria 1499
572 Ga0587106_022284 3300059605 Unclassified 951
573 Ga0587106_031928 3300059605 Bacteria 850
574 Ga0587069_004336 3300059642 Bacteria 1593
575 Ga0587076_007383 3300059645 Bacteria 1500
576 Ga0587107_004085 3300059652 Bacteria 1460
577 Ga0587111_0002375 3300060346 Bacteria 2496
578 Ga0466962_0032656 3300061719 Bacteria 2492
579 Ga0466962_0107376 3300061719 Bacteria 1343
580 Ga0530510_0300881 3300061734 Bacteria 1200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0506817 Ga0373943_0506817_19_585 122
2 3300014745 Ga0157377_10038900 Ga0157377_100389004 125
3 3300046507 Ga0495606_0594294 Ga0495606_0594294_65_526 128
4 3300028379 Ga0268266_10261897 Ga0268266_102618973 130
5 3300005434 Ga0070709_10017933 Ga0070709_100179334 133
6 3300005436 Ga0070713_100021398 Ga0070713_1000213986 133
7 3300006028 Ga0070717_10049129 Ga0070717_100491293 133
8 3300006175 Ga0070712_100094472 Ga0070712_1000944723 133
9 3300025906 Ga0207699_10081535 Ga0207699_100815352 133
10 3300025915 Ga0207693_10128733 Ga0207693_101287333 133
11 3300025928 Ga0207700_10019853 Ga0207700_100198533 133
12 3300025929 Ga0207664_10315366 Ga0207664_103153662 133
13 3300025939 Ga0207665_10064085 Ga0207665_100640853 133
14 3300050510 nmdc:mga06r32_433354_c1 nmdc:mga06r32_433354_c1_689_1282 133
15 3300014745 Ga0157377_10035272 Ga0157377_100352725 134
16 3300005327 Ga0070658_10061150 Ga0070658_100611504 135
17 3300005328 Ga0070676_10029301 Ga0070676_100293013 135
18 3300005330 Ga0070690_100019531 Ga0070690_1000195316 135
19 3300005331 Ga0070670_100537853 Ga0070670_1005378532 135
20 3300005334 Ga0068869_100472432 Ga0068869_1004724321 135
21 3300005335 Ga0070666_10169730 Ga0070666_101697302 135
22 3300005338 Ga0068868_100178751 Ga0068868_1001787512 135
23 3300005339 Ga0070660_100081113 Ga0070660_1000811131 135
24 3300005343 Ga0070687_100115384 Ga0070687_1001153842 135
25 3300005354 Ga0070675_100241355 Ga0070675_1002413552 135
26 3300005355 Ga0070671_100234203 Ga0070671_1002342031 135
27 3300005364 Ga0070673_100097422 Ga0070673_1000974222 135
28 3300005366 Ga0070659_100240350 Ga0070659_1002403502 135
29 3300005367 Ga0070667_100084272 Ga0070667_1000842722 135
30 3300005456 Ga0070678_100010233 Ga0070678_1000102332 135
31 3300005457 Ga0070662_100031711 Ga0070662_1000317114 135
32 3300005459 Ga0068867_100035898 Ga0068867_1000358985 135
33 3300005539 Ga0068853_100333542 Ga0068853_1003335421 135
34 3300005543 Ga0070672_100015371 Ga0070672_1000153716 135
35 3300005544 Ga0070686_100008248 Ga0070686_1000082486 135
36 3300005614 Ga0068856_100334655 Ga0068856_1003346552 135
37 3300005616 Ga0068852_100024761 Ga0068852_1000247612 135
38 3300005617 Ga0068859_100098336 Ga0068859_1000983365 135
39 3300005618 Ga0068864_100025754 Ga0068864_1000257547 135
40 3300005834 Ga0068851_10049842 Ga0068851_100498424 135
41 3300005841 Ga0068863_100012042 Ga0068863_1000120428 135
42 3300005842 Ga0068858_100076547 Ga0068858_1000765473 135
43 3300005843 Ga0068860_100188697 Ga0068860_1001886974 135
44 3300006237 Ga0097621_100022079 Ga0097621_1000220796 135
45 3300006358 Ga0068871_100029650 Ga0068871_1000296506 135
46 3300006881 Ga0068865_100053377 Ga0068865_1000533773 135
47 3300006931 Ga0097620_100098336 Ga0097620_1000983363 135
48 3300009093 Ga0105240_10191183 Ga0105240_101911833 135
49 3300009098 Ga0105245_10038031 Ga0105245_100380316 135
50 3300009551 Ga0105238_10130225 Ga0105238_101302255 135
51 3300010375 Ga0105239_10331318 Ga0105239_103313182 135
52 3300011119 Ga0105246_10792506 Ga0105246_107925061 135
53 3300013102 Ga0157371_10050735 Ga0157371_100507352 135
54 3300013296 Ga0157374_10051240 Ga0157374_100512403 135
55 3300013297 Ga0157378_10147256 Ga0157378_101472563 135
56 3300013306 Ga0163162_10189606 Ga0163162_101896063 135
57 3300013308 Ga0157375_10106733 Ga0157375_101067334 135
58 3300014325 Ga0163163_10052239 Ga0163163_100522396 135
59 3300014968 Ga0157379_10205583 Ga0157379_102055832 135
60 3300014969 Ga0157376_10163183 Ga0157376_101631832 135
61 3300025321 Ga0207656_10022031 Ga0207656_100220312 135
62 3300025903 Ga0207680_10005881 Ga0207680_100058817 135
63 3300025904 Ga0207647_10069825 Ga0207647_100698252 135
64 3300025907 Ga0207645_10060102 Ga0207645_100601022 135
65 3300025909 Ga0207705_10044715 Ga0207705_100447155 135
66 3300025918 Ga0207662_10115081 Ga0207662_101150812 135
67 3300025919 Ga0207657_10142592 Ga0207657_101425924 135
68 3300025924 Ga0207694_10194067 Ga0207694_101940672 135
69 3300025925 Ga0207650_10463381 Ga0207650_104633812 135
70 3300025926 Ga0207659_10237572 Ga0207659_102375723 135
71 3300025927 Ga0207687_10157000 Ga0207687_101570002 135
72 3300025931 Ga0207644_10015074 Ga0207644_100150746 135
73 3300025933 Ga0207706_10005493 Ga0207706_1000549314 135
74 3300025938 Ga0207704_10022109 Ga0207704_100221093 135
75 3300025940 Ga0207691_10019957 Ga0207691_100199577 135
76 3300025941 Ga0207711_10139359 Ga0207711_101393593 135
77 3300025960 Ga0207651_10034399 Ga0207651_100343992 135
78 3300025986 Ga0207658_10221936 Ga0207658_102219362 135
79 3300026023 Ga0207677_10019761 Ga0207677_100197613 135
80 3300026035 Ga0207703_10028966 Ga0207703_100289666 135
81 3300026041 Ga0207639_10305380 Ga0207639_103053803 135
82 3300026078 Ga0207702_10278932 Ga0207702_102789322 135
83 3300026088 Ga0207641_10028905 Ga0207641_100289056 135
84 3300026089 Ga0207648_10005572 Ga0207648_100055722 135
85 3300026095 Ga0207676_10142352 Ga0207676_101423522 135
86 3300026121 Ga0207683_10004440 Ga0207683_1000444014 135
87 3300026142 Ga0207698_10021583 Ga0207698_100215836 135
88 3300028381 Ga0268264_10299979 Ga0268264_102999793 135
89 3300037471 Ga0395905_0410573 Ga0395905_0410573_604_1206 135
90 3300048903 Ga0496100_0040957 Ga0496100_0040957_2222_2878 135
91 3300048904 Ga0496101_0015211 Ga0496101_0015211_1236_1892 135
92 3300048905 Ga0496102_0110936 Ga0496102_0110936_1500_2156 135
93 3300048907 Ga0496104_0047452 Ga0496104_0047452_1396_2052 135
94 3300048908 Ga0496105_0418991 Ga0496105_0418991_313_969 135
95 3300048909 Ga0496106_0119557 Ga0496106_0119557_1151_1807 135
96 3300048910 Ga0496107_0022973 Ga0496107_0022973_1972_2628 135
97 3300048911 Ga0496108_0135752 Ga0496108_0135752_728_1384 135
98 3300048912 Ga0496109_0360450 Ga0496109_0360450_190_846 135
99 3300048913 Ga0496110_0054338 Ga0496110_0054338_1367_2023 135
100 3300048914 Ga0496111_0005356 Ga0496111_0005356_4438_5094 135
101 3300048916 Ga0496113_0439089 Ga0496113_0439089_50_706 135
102 3300048917 Ga0496114_0195807 Ga0496114_0195807_673_1329 135
103 3300005327 Ga0070658_10091050 Ga0070658_100910503 136
104 3300005338 Ga0068868_100011876 Ga0068868_1000118768 136
105 3300009098 Ga0105245_10006613 Ga0105245_100066137 136
106 3300025909 Ga0207705_10039327 Ga0207705_100393271 136
107 3300025927 Ga0207687_10022941 Ga0207687_100229412 136
108 3300026023 Ga0207677_10015748 Ga0207677_100157486 136
109 3300005347 Ga0070668_100252997 Ga0070668_1002529972 137
110 3300048911 Ga0496108_0000676 Ga0496108_0000676_20368_21021 137
111 3300013297 Ga0157378_10444067 Ga0157378_104440672 139
112 3300035692 Ga0373935_0011985 Ga0373935_0011985_1781_2440 140
113 3300037418 Ga0395900_0777590 Ga0395900_0777590_110_775 143
114 3300005340 Ga0070689_100183886 Ga0070689_1001838862 146
115 3300005617 Ga0068859_100017405 Ga0068859_1000174058 146
116 3300005841 Ga0068863_100340016 Ga0068863_1003400162 146
117 3300006931 Ga0097620_100017404 Ga0097620_1000174048 146
118 3300009101 Ga0105247_10117243 Ga0105247_101172433 146
119 3300009177 Ga0105248_10026996 Ga0105248_100269968 146
120 3300025900 Ga0207710_10043951 Ga0207710_100439512 146
121 3300025936 Ga0207670_10154132 Ga0207670_101541322 146
122 3300025941 Ga0207711_10038776 Ga0207711_100387764 146
123 3300026088 Ga0207641_10089990 Ga0207641_100899903 146
124 3300031507 Ga0307509_10621874 Ga0307509_106218741 146
125 3300035691 Ga0373931_0126451 Ga0373931_0126451_205_864 146
126 3300045976 Ga0466967_0026614 Ga0466967_0026614_2376_3035 146
127 3300031911 Ga0307412_10246961 Ga0307412_102469612 147
128 3300032126 Ga0307415_100007479 Ga0307415_1000074797 147
129 3300048913 Ga0496110_0109407 Ga0496110_0109407_584_1246 147
130 3300001979 JGI24740J21852_10009756 JGI24740J21852_100097563 148
131 3300001989 JGI24739J22299_10006141 JGI24739J22299_100061414 148
132 3300002075 JGI24738J21930_10008263 JGI24738J21930_100082632 148
133 3300005327 Ga0070658_10112212 Ga0070658_101122123 148
134 3300005329 Ga0070683_100027852 Ga0070683_1000278522 148
135 3300005331 Ga0070670_100054562 Ga0070670_1000545622 148
136 3300005335 Ga0070666_10001192 Ga0070666_1000119212 148
137 3300005338 Ga0068868_100130556 Ga0068868_1001305562 148
138 3300005339 Ga0070660_100024573 Ga0070660_1000245732 148
139 3300005355 Ga0070671_100072623 Ga0070671_1000726232 148
140 3300005367 Ga0070667_100006939 Ga0070667_1000069395 148
141 3300005455 Ga0070663_100224759 Ga0070663_1002247591 148
142 3300005457 Ga0070662_100007775 Ga0070662_1000077755 148
143 3300005535 Ga0070684_100108365 Ga0070684_1001083654 148
144 3300005548 Ga0070665_100012573 Ga0070665_1000125736 148
145 3300005564 Ga0070664_100018627 Ga0070664_1000186275 148
146 3300005577 Ga0068857_100005346 Ga0068857_1000053466 148
147 3300005578 Ga0068854_100054969 Ga0068854_1000549695 148
148 3300005616 Ga0068852_100039707 Ga0068852_1000397073 148
149 3300005834 Ga0068851_10100716 Ga0068851_101007162 148
150 3300013102 Ga0157371_10021836 Ga0157371_100218366 148
151 3300025321 Ga0207656_10098502 Ga0207656_100985022 148
152 3300025903 Ga0207680_10003609 Ga0207680_100036099 148
153 3300025904 Ga0207647_10045888 Ga0207647_100458882 148
154 3300025909 Ga0207705_10232895 Ga0207705_102328952 148
155 3300025919 Ga0207657_10004148 Ga0207657_1000414811 148
156 3300025920 Ga0207649_10072763 Ga0207649_100727632 148
157 3300025925 Ga0207650_10021499 Ga0207650_100214994 148
158 3300025931 Ga0207644_10216759 Ga0207644_102167592 148
159 3300025932 Ga0207690_10004995 Ga0207690_100049954 148
160 3300025933 Ga0207706_10008878 Ga0207706_1000887810 148
161 3300025944 Ga0207661_10278480 Ga0207661_102784801 148
162 3300025945 Ga0207679_10016086 Ga0207679_100160863 148
163 3300025949 Ga0207667_10154203 Ga0207667_101542031 148
164 3300025960 Ga0207651_10010070 Ga0207651_100100702 148
165 3300025981 Ga0207640_10203049 Ga0207640_102030492 148
166 3300025986 Ga0207658_10007069 Ga0207658_100070695 148
167 3300026067 Ga0207678_10025460 Ga0207678_100254606 148
168 3300026116 Ga0207674_10009776 Ga0207674_1000977611 148
169 3300028379 Ga0268266_10012094 Ga0268266_100120947 148
170 3300031548 Ga0307408_100038939 Ga0307408_1000389395 148
171 3300032126 Ga0307415_100163022 Ga0307415_1001630222 148
172 3300037312 Ga0395899_0138330 Ga0395899_0138330_467_1165 148
173 3300037418 Ga0395900_0047925 Ga0395900_0047925_3402_4100 148
174 3300037471 Ga0395905_0018079 Ga0395905_0018079_3220_3918 148
175 3300038443 Ga0395901_0730844 Ga0395901_0730844_266_964 148
176 3300001990 JGI24737J22298_10000437 JGI24737J22298_1000043713 149
177 3300005331 Ga0070670_100302444 Ga0070670_1003024441 149
178 3300005344 Ga0070661_100642614 Ga0070661_1006426141 149
179 3300005366 Ga0070659_100012501 Ga0070659_1000125014 149
180 3300005367 Ga0070667_100200348 Ga0070667_1002003484 149
181 3300005435 Ga0070714_100094321 Ga0070714_1000943214 149
182 3300005577 Ga0068857_100000424 Ga0068857_10000042424 149
183 3300005617 Ga0068859_100233329 Ga0068859_1002333293 149
184 3300005841 Ga0068863_100021273 Ga0068863_1000212737 149
185 3300005843 Ga0068860_100045393 Ga0068860_1000453935 149
186 3300006931 Ga0097620_100233339 Ga0097620_1002333393 149
187 3300009177 Ga0105248_10010623 Ga0105248_100106236 149
188 3300013308 Ga0157375_10038727 Ga0157375_100387273 149
189 3300025925 Ga0207650_10219605 Ga0207650_102196051 149
190 3300025929 Ga0207664_10094947 Ga0207664_100949473 149
191 3300025932 Ga0207690_10001815 Ga0207690_100018158 149
192 3300025960 Ga0207651_10006923 Ga0207651_100069234 149
193 3300025961 Ga0207712_10082997 Ga0207712_100829972 149
194 3300025986 Ga0207658_10033231 Ga0207658_100332313 149
195 3300026088 Ga0207641_10009481 Ga0207641_100094816 149
196 3300026088 Ga0207641_10033451 Ga0207641_100334514 149
197 3300026116 Ga0207674_10000725 Ga0207674_1000072534 149
198 3300026118 Ga0207675_100627167 Ga0207675_1006271671 149
199 3300032126 Ga0307415_100811501 Ga0307415_1008115012 149
200 3300037418 Ga0395900_0056957 Ga0395900_0056957_2951_3613 149
201 3300037418 Ga0395900_0077551 Ga0395900_0077551_694_1353 149
202 3300037418 Ga0395900_0207046 Ga0395900_0207046_1123_1782 149
203 3300037418 Ga0395900_0460997 Ga0395900_0460997_157_816 149
204 3300037466 Ga0395898_0111166 Ga0395898_0111166_1057_1716 149
205 3300037471 Ga0395905_0004074 Ga0395905_0004074_10654_11313 149
206 3300037471 Ga0395905_0128573 Ga0395905_0128573_608_1267 149
207 3300037471 Ga0395905_0236682 Ga0395905_0236682_91_750 149
208 3300038443 Ga0395901_0042902 Ga0395901_0042902_3282_3941 149
209 3300038443 Ga0395901_0059256 Ga0395901_0059256_2737_3396 149
210 3300038443 Ga0395901_0822070 Ga0395901_0822070_111_770 149
211 3300042005 Ga0439448_0004558 Ga0439448_0004558_157_816 149
212 3300042157 Ga0439458_0000646 Ga0439458_0000646_490_1149 149
213 3300059506 Ga0587085_008424 Ga0587085_008424_104_763 149
214 3300059507 Ga0587086_006256 Ga0587086_006256_105_764 149
215 3300059645 Ga0587076_007383 Ga0587076_007383_630_1289 149
216 3300003320 rootH2_10227537 rootH2_102275372 150
217 3300005327 Ga0070658_10126150 Ga0070658_101261502 150
218 3300005455 Ga0070663_100059383 Ga0070663_1000593834 150
219 3300025942 Ga0207689_10043365 Ga0207689_100433652 150
220 3300025945 Ga0207679_10148427 Ga0207679_101484273 150
221 3300028379 Ga0268266_10373434 Ga0268266_103734342 150
222 3300037418 Ga0395900_0089111 Ga0395900_0089111_2042_2704 150
223 3300037471 Ga0395905_0030561 Ga0395905_0030561_2865_3527 150
224 3300059492 Ga0587073_0009956 Ga0587073_0009956_115_777 150
225 3300059604 Ga0587098_002886 Ga0587098_002886_118_780 150
226 3300059605 Ga0587106_022284 Ga0587106_022284_118_780 150
227 3300059642 Ga0587069_004336 Ga0587069_004336_105_767 150
228 3300005327 Ga0070658_10075606 Ga0070658_100756063 151
229 3300005339 Ga0070660_100712048 Ga0070660_1007120481 151
230 3300005355 Ga0070671_100742101 Ga0070671_1007421011 151
231 3300005366 Ga0070659_100291607 Ga0070659_1002916071 151
232 3300005459 Ga0068867_100004370 Ga0068867_1000043703 151
233 3300005459 Ga0068867_100213572 Ga0068867_1002135722 151
234 3300005578 Ga0068854_100060225 Ga0068854_1000602252 151
235 3300005614 Ga0068856_100019388 Ga0068856_1000193888 151
236 3300005614 Ga0068856_100169021 Ga0068856_1001690213 151
237 3300006177 Ga0075362_10015029 Ga0075362_100150294 151
238 3300006195 Ga0075366_10194703 Ga0075366_101947031 151
239 3300009094 Ga0111539_10263877 Ga0111539_102638772 151
240 3300013104 Ga0157370_10408711 Ga0157370_104087112 151
241 3300013105 Ga0157369_10247390 Ga0157369_102473902 151
242 3300013105 Ga0157369_10258346 Ga0157369_102583462 151
243 3300025919 Ga0207657_10484017 Ga0207657_104840172 151
244 3300025932 Ga0207690_10239139 Ga0207690_102391391 151
245 3300025933 Ga0207706_10175944 Ga0207706_101759442 151
246 3300025949 Ga0207667_11016428 Ga0207667_110164282 151
247 3300025960 Ga0207651_11087280 Ga0207651_110872801 151
248 3300026067 Ga0207678_10047953 Ga0207678_100479532 151
249 3300026089 Ga0207648_10032713 Ga0207648_100327135 151
250 3300026089 Ga0207648_10208825 Ga0207648_102088252 151
251 3300037312 Ga0395899_0179226 Ga0395899_0179226_64_729 151
252 3300037418 Ga0395900_0001148 Ga0395900_0001148_8697_9356 151
253 3300037418 Ga0395900_0173978 Ga0395900_0173978_1136_1801 151
254 3300037418 Ga0395900_0662801 Ga0395900_0662801_286_948 151
255 3300037466 Ga0395898_0071693 Ga0395898_0071693_533_1192 151
256 3300037466 Ga0395898_0698746 Ga0395898_0698746_64_729 151
257 3300037471 Ga0395905_0000649 Ga0395905_0000649_35011_35670 151
258 3300037471 Ga0395905_0036895 Ga0395905_0036895_1708_2373 151
259 3300037471 Ga0395905_0063882 Ga0395905_0063882_168_833 151
260 3300037471 Ga0395905_0600870 Ga0395905_0600870_79_735 151
261 3300038443 Ga0395901_0003117 Ga0395901_0003117_6014_6673 151
262 3300038443 Ga0395901_0113734 Ga0395901_0113734_1310_1975 151
263 3300049583 Ga0501067_0010483 Ga0501067_0010483_1893_2549 151
264 3300049585 Ga0501069_0061553 Ga0501069_0061553_461_1117 151
265 3300050489 nmdc:mga03683_277784_c1 nmdc:mga03683_277784_c1_27_692 151
266 3300059503 Ga0587080_010796 Ga0587080_010796_225_887 151
267 3300059511 Ga0587091_014619 Ga0587091_014619_256_918 151
268 3300059652 Ga0587107_004085 Ga0587107_004085_251_913 151
269 3300061734 Ga0530510_0300881 Ga0530510_0300881_495_1151 151
270 3300002067 JGI24735J21928_10008978 JGI24735J21928_100089782 152
271 3300005327 Ga0070658_10011920 Ga0070658_100119204 152
272 3300005327 Ga0070658_10096390 Ga0070658_100963903 152
273 3300005327 Ga0070658_10124162 Ga0070658_101241622 152
274 3300005329 Ga0070683_100023262 Ga0070683_1000232622 152
275 3300005329 Ga0070683_100335146 Ga0070683_1003351462 152
276 3300005331 Ga0070670_100027221 Ga0070670_1000272216 152
277 3300005336 Ga0070680_100318756 Ga0070680_1003187562 152
278 3300005337 Ga0070682_100024223 Ga0070682_1000242233 152
279 3300005339 Ga0070660_100030494 Ga0070660_1000304944 152
280 3300005339 Ga0070660_100252854 Ga0070660_1002528542 152
281 3300005339 Ga0070660_100352931 Ga0070660_1003529312 152
282 3300005341 Ga0070691_10002882 Ga0070691_100028827 152
283 3300005344 Ga0070661_100052253 Ga0070661_1000522532 152
284 3300005344 Ga0070661_100120693 Ga0070661_1001206932 152
285 3300005355 Ga0070671_100000789 Ga0070671_10000078914 152
286 3300005364 Ga0070673_100751908 Ga0070673_1007519081 152
287 3300005366 Ga0070659_100023839 Ga0070659_1000238393 152
288 3300005366 Ga0070659_100294702 Ga0070659_1002947022 152
289 3300005366 Ga0070659_100596943 Ga0070659_1005969431 152
290 3300005438 Ga0070701_10367559 Ga0070701_103675591 152
291 3300005455 Ga0070663_100457977 Ga0070663_1004579771 152
292 3300005456 Ga0070678_100001974 Ga0070678_1000019742 152
293 3300005457 Ga0070662_100029531 Ga0070662_1000295312 152
294 3300005457 Ga0070662_100069047 Ga0070662_1000690473 152
295 3300005458 Ga0070681_10098411 Ga0070681_100984114 152
296 3300005530 Ga0070679_100261481 Ga0070679_1002614813 152
297 3300005530 Ga0070679_100271259 Ga0070679_1002712592 152
298 3300005535 Ga0070684_100002471 Ga0070684_10000247112 152
299 3300005539 Ga0068853_100009684 Ga0068853_1000096844 152
300 3300005539 Ga0068853_100132930 Ga0068853_1001329302 152
301 3300005547 Ga0070693_100018119 Ga0070693_1000181195 152
302 3300005563 Ga0068855_100302970 Ga0068855_1003029702 152
303 3300005564 Ga0070664_100002272 Ga0070664_10000227213 152
304 3300005564 Ga0070664_100009887 Ga0070664_1000098879 152
305 3300005564 Ga0070664_100012887 Ga0070664_1000128874 152
306 3300005577 Ga0068857_100006304 Ga0068857_1000063047 152
307 3300005577 Ga0068857_100010041 Ga0068857_1000100412 152
308 3300005577 Ga0068857_100011662 Ga0068857_10001166212 152
309 3300005578 Ga0068854_100030742 Ga0068854_1000307424 152
310 3300005578 Ga0068854_100049593 Ga0068854_1000495932 152
311 3300005614 Ga0068856_100097485 Ga0068856_1000974852 152
312 3300005614 Ga0068856_100620091 Ga0068856_1006200912 152
313 3300005616 Ga0068852_100058698 Ga0068852_1000586984 152
314 3300005616 Ga0068852_100438240 Ga0068852_1004382402 152
315 3300005618 Ga0068864_100029690 Ga0068864_1000296902 152
316 3300005618 Ga0068864_100175246 Ga0068864_1001752461 152
317 3300005834 Ga0068851_10222593 Ga0068851_102225932 152
318 3300005841 Ga0068863_100007990 Ga0068863_1000079903 152
319 3300005842 Ga0068858_100024269 Ga0068858_1000242698 152
320 3300005843 Ga0068860_100115400 Ga0068860_1001154003 152
321 3300005844 Ga0068862_100022720 Ga0068862_1000227203 152
322 3300009093 Ga0105240_10025727 Ga0105240_100257275 152
323 3300009174 Ga0105241_10144185 Ga0105241_101441852 152
324 3300009545 Ga0105237_10025586 Ga0105237_100255865 152
325 3300009551 Ga0105238_10058011 Ga0105238_100580113 152
326 3300013100 Ga0157373_10058148 Ga0157373_100581482 152
327 3300013100 Ga0157373_10073585 Ga0157373_100735852 152
328 3300013102 Ga0157371_10210681 Ga0157371_102106812 152
329 3300013104 Ga0157370_10101856 Ga0157370_101018562 152
330 3300013307 Ga0157372_10114752 Ga0157372_101147522 152
331 3300020069 Ga0197907_10348122 Ga0197907_103481225 152
332 3300020070 Ga0206356_11765321 Ga0206356_117653211 152
333 3300020078 Ga0206352_10695348 Ga0206352_106953484 152
334 3300022467 Ga0224712_10013386 Ga0224712_100133861 152
335 3300025321 Ga0207656_10094225 Ga0207656_100942252 152
336 3300025321 Ga0207656_10097911 Ga0207656_100979112 152
337 3300025904 Ga0207647_10001345 Ga0207647_100013459 152
338 3300025904 Ga0207647_10025933 Ga0207647_100259332 152
339 3300025909 Ga0207705_10006192 Ga0207705_100061925 152
340 3300025909 Ga0207705_10079286 Ga0207705_100792862 152
341 3300025911 Ga0207654_10114875 Ga0207654_101148752 152
342 3300025913 Ga0207695_10020420 Ga0207695_100204205 152
343 3300025918 Ga0207662_10046394 Ga0207662_100463943 152
344 3300025919 Ga0207657_10002226 Ga0207657_1000222611 152
345 3300025919 Ga0207657_10026801 Ga0207657_100268016 152
346 3300025920 Ga0207649_10035179 Ga0207649_100351794 152
347 3300025920 Ga0207649_10127496 Ga0207649_101274962 152
348 3300025920 Ga0207649_10163689 Ga0207649_101636891 152
349 3300025925 Ga0207650_10041030 Ga0207650_100410305 152
350 3300025931 Ga0207644_10002434 Ga0207644_100024344 152
351 3300025932 Ga0207690_10007352 Ga0207690_100073522 152
352 3300025932 Ga0207690_10157373 Ga0207690_101573732 152
353 3300025932 Ga0207690_10420978 Ga0207690_104209783 152
354 3300025933 Ga0207706_10029701 Ga0207706_100297012 152
355 3300025933 Ga0207706_10274764 Ga0207706_102747642 152
356 3300025935 Ga0207709_10061071 Ga0207709_100610711 152
357 3300025940 Ga0207691_10035290 Ga0207691_100352906 152
358 3300025944 Ga0207661_10005261 Ga0207661_100052611 152
359 3300025944 Ga0207661_10034322 Ga0207661_100343225 152
360 3300025945 Ga0207679_10113798 Ga0207679_101137982 152
361 3300025945 Ga0207679_10114820 Ga0207679_101148203 152
362 3300025945 Ga0207679_10121163 Ga0207679_101211632 152
363 3300025949 Ga0207667_10062034 Ga0207667_100620346 152
364 3300025949 Ga0207667_10236828 Ga0207667_102368282 152
365 3300025981 Ga0207640_10014556 Ga0207640_100145563 152
366 3300025981 Ga0207640_10032695 Ga0207640_100326954 152
367 3300026035 Ga0207703_10028418 Ga0207703_100284185 152
368 3300026041 Ga0207639_10048533 Ga0207639_100485334 152
369 3300026041 Ga0207639_10175840 Ga0207639_101758402 152
370 3300026067 Ga0207678_10053707 Ga0207678_100537072 152
371 3300026078 Ga0207702_10049535 Ga0207702_100495353 152
372 3300026088 Ga0207641_10135099 Ga0207641_101350992 152
373 3300026095 Ga0207676_10093916 Ga0207676_100939163 152
374 3300026095 Ga0207676_10123915 Ga0207676_101239153 152
375 3300026116 Ga0207674_10005438 Ga0207674_100054387 152
376 3300026116 Ga0207674_10010178 Ga0207674_100101786 152
377 3300026116 Ga0207674_10013154 Ga0207674_100131542 152
378 3300026121 Ga0207683_10027882 Ga0207683_100278821 152
379 3300026142 Ga0207698_10010089 Ga0207698_100100894 152
380 3300026142 Ga0207698_10109292 Ga0207698_101092922 152
381 3300028380 Ga0268265_10092702 Ga0268265_100927022 152
382 3300028381 Ga0268264_10065366 Ga0268264_100653662 152
383 3300037312 Ga0395899_0047865 Ga0395899_0047865_1067_1729 152
384 3300037312 Ga0395899_0198340 Ga0395899_0198340_20_682 152
385 3300037418 Ga0395900_0119341 Ga0395900_0119341_432_1094 152
386 3300037418 Ga0395900_0842873 Ga0395900_0842873_142_804 152
387 3300037466 Ga0395898_0019121 Ga0395898_0019121_2548_3210 152
388 3300037471 Ga0395905_0024167 Ga0395905_0024167_1067_1729 152
389 3300037471 Ga0395905_0153385 Ga0395905_0153385_990_1646 152
390 3300037471 Ga0395905_0189924 Ga0395905_0189924_110_772 152
391 3300038443 Ga0395901_0141602 Ga0395901_0141602_1454_2116 152
392 3300038443 Ga0395901_0177699 Ga0395901_0177699_1500_2165 152
393 3300038443 Ga0395901_0186888 Ga0395901_0186888_432_1094 152
394 3300038443 Ga0395901_0268670 Ga0395901_0268670_442_1098 152
395 3300044693 Ga0466961_0022283 Ga0466961_0022283_2546_3211 152
396 3300044694 Ga0466963_0013724 Ga0466963_0013724_912_1580 152
397 3300044694 Ga0466963_0015246 Ga0466963_0015246_1864_2529 152
398 3300044694 Ga0466963_0074499 Ga0466963_0074499_726_1391 152
399 3300044719 Ga0466971_0003152 Ga0466971_0003152_528_1193 152
400 3300044842 Ga0466957_0014833 Ga0466957_0014833_286_951 152
401 3300044842 Ga0466957_0225408 Ga0466957_0225408_249_914 152
402 3300044842 Ga0466957_0322221 Ga0466957_0322221_248_913 152
403 3300045049 Ga0466959_0303860 Ga0466959_0303860_130_795 152
404 3300045836 Ga0466958_0069643 Ga0466958_0069643_1095_1760 152
405 3300045836 Ga0466958_0108953 Ga0466958_0108953_682_1347 152
406 3300045836 Ga0466958_0271467 Ga0466958_0271467_203_868 152
407 3300045976 Ga0466967_0140712 Ga0466967_0140712_1062_1727 152
408 3300048905 Ga0496102_0846532 Ga0496102_0846532_69_731 152
409 3300048915 Ga0496112_0188088 Ga0496112_0188088_35_697 152
410 3300059605 Ga0587106_031928 Ga0587106_031928_121_783 152
411 3300061719 Ga0466962_0107376 Ga0466962_0107376_130_795 152
412 3300001979 JGI24740J21852_10007690 JGI24740J21852_100076905 153
413 3300005327 Ga0070658_10037201 Ga0070658_100372014 153
414 3300005327 Ga0070658_10333564 Ga0070658_103335641 153
415 3300005339 Ga0070660_100022816 Ga0070660_1000228168 153
416 3300005339 Ga0070660_100507087 Ga0070660_1005070871 153
417 3300005345 Ga0070692_10009633 Ga0070692_100096337 153
418 3300005345 Ga0070692_10120183 Ga0070692_101201832 153
419 3300005366 Ga0070659_100015805 Ga0070659_1000158051 153
420 3300005435 Ga0070714_100163827 Ga0070714_1001638273 153
421 3300005435 Ga0070714_100235368 Ga0070714_1002353682 153
422 3300005444 Ga0070694_100012672 Ga0070694_1000126722 153
423 3300005457 Ga0070662_100022795 Ga0070662_1000227956 153
424 3300005543 Ga0070672_100015815 Ga0070672_1000158156 153
425 3300005563 Ga0068855_100049492 Ga0068855_1000494922 153
426 3300005563 Ga0068855_100181088 Ga0068855_1001810882 153
427 3300005577 Ga0068857_100395433 Ga0068857_1003954331 153
428 3300005614 Ga0068856_100221027 Ga0068856_1002210273 153
429 3300005616 Ga0068852_100024324 Ga0068852_1000243242 153
430 3300005616 Ga0068852_100550100 Ga0068852_1005501001 153
431 3300005843 Ga0068860_100912823 Ga0068860_1009128231 153
432 3300009093 Ga0105240_10266643 Ga0105240_102666433 153
433 3300009148 Ga0105243_11219036 Ga0105243_112190361 153
434 3300009551 Ga0105238_10221022 Ga0105238_102210223 153
435 3300009553 Ga0105249_11018019 Ga0105249_110180191 153
436 3300010375 Ga0105239_10376215 Ga0105239_103762151 153
437 3300013102 Ga0157371_10016861 Ga0157371_100168616 153
438 3300013104 Ga0157370_10321547 Ga0157370_103215472 153
439 3300013105 Ga0157369_10619597 Ga0157369_106195971 153
440 3300013307 Ga0157372_10046002 Ga0157372_100460022 153
441 3300014968 Ga0157379_10259294 Ga0157379_102592942 153
442 3300020081 Ga0206354_11542634 Ga0206354_115426343 153
443 3300025901 Ga0207688_10059191 Ga0207688_100591912 153
444 3300025904 Ga0207647_10001281 Ga0207647_1000128111 153
445 3300025904 Ga0207647_10104427 Ga0207647_101044272 153
446 3300025909 Ga0207705_10068679 Ga0207705_100686792 153
447 3300025909 Ga0207705_10070806 Ga0207705_100708061 153
448 3300025913 Ga0207695_10191825 Ga0207695_101918252 153
449 3300025919 Ga0207657_10006333 Ga0207657_1000633314 153
450 3300025919 Ga0207657_10048808 Ga0207657_100488084 153
451 3300025929 Ga0207664_10223562 Ga0207664_102235622 153
452 3300025932 Ga0207690_10001514 Ga0207690_1000151412 153
453 3300025932 Ga0207690_10100767 Ga0207690_101007672 153
454 3300025940 Ga0207691_10031623 Ga0207691_100316237 153
455 3300025949 Ga0207667_10123647 Ga0207667_101236473 153
456 3300025949 Ga0207667_10169394 Ga0207667_101693942 153
457 3300025961 Ga0207712_10001363 Ga0207712_1000136311 153
458 3300026041 Ga0207639_10039207 Ga0207639_100392072 153
459 3300026041 Ga0207639_10077587 Ga0207639_100775873 153
460 3300026116 Ga0207674_10601426 Ga0207674_106014261 153
461 3300026142 Ga0207698_10098047 Ga0207698_100980472 153
462 3300028381 Ga0268264_10396143 Ga0268264_103961431 153
463 3300037312 Ga0395899_0064644 Ga0395899_0064644_1459_2118 153
464 3300037418 Ga0395900_0037965 Ga0395900_0037965_4005_4664 153
465 3300037418 Ga0395900_0154895 Ga0395900_0154895_812_1480 153
466 3300037418 Ga0395900_0314546 Ga0395900_0314546_241_903 153
467 3300037466 Ga0395898_0135549 Ga0395898_0135549_1110_1769 153
468 3300037466 Ga0395898_0187147 Ga0395898_0187147_963_1631 153
469 3300037471 Ga0395905_0006002 Ga0395905_0006002_672_1331 153
470 3300038443 Ga0395901_0081711 Ga0395901_0081711_2331_2999 153
471 3300044683 Ga0466965_0087756 Ga0466965_0087756_193_861 153
472 3300048913 Ga0496110_0773137 Ga0496110_0773137_127_783 153
473 3300061719 Ga0466962_0032656 Ga0466962_0032656_389_1057 153
474 3300001979 JGI24740J21852_10001749 JGI24740J21852_1000174910 154
475 3300005334 Ga0068869_100030209 Ga0068869_1000302093 154
476 3300005334 Ga0068869_100073637 Ga0068869_1000736373 154
477 3300005338 Ga0068868_100014488 Ga0068868_1000144882 154
478 3300005347 Ga0070668_100027417 Ga0070668_1000274177 154
479 3300005347 Ga0070668_100031969 Ga0070668_1000319694 154
480 3300005353 Ga0070669_100089087 Ga0070669_1000890873 154
481 3300005353 Ga0070669_100235621 Ga0070669_1002356211 154
482 3300005355 Ga0070671_100012914 Ga0070671_1000129146 154
483 3300005355 Ga0070671_100032700 Ga0070671_1000327006 154
484 3300005367 Ga0070667_100000836 Ga0070667_10000083621 154
485 3300005367 Ga0070667_100072284 Ga0070667_1000722841 154
486 3300005435 Ga0070714_100438025 Ga0070714_1004380252 154
487 3300005455 Ga0070663_100389677 Ga0070663_1003896772 154
488 3300005545 Ga0070695_100237508 Ga0070695_1002375082 154
489 3300005563 Ga0068855_100089424 Ga0068855_1000894242 154
490 3300005564 Ga0070664_100002857 Ga0070664_1000028578 154
491 3300005577 Ga0068857_100005446 Ga0068857_1000054469 154
492 3300005577 Ga0068857_100857302 Ga0068857_1008573021 154
493 3300005614 Ga0068856_100028999 Ga0068856_1000289994 154
494 3300005617 Ga0068859_100007663 Ga0068859_1000076638 154
495 3300005617 Ga0068859_100101529 Ga0068859_1001015292 154
496 3300005617 Ga0068859_100186772 Ga0068859_1001867722 154
497 3300005618 Ga0068864_100000078 Ga0068864_10000007815 154
498 3300005618 Ga0068864_100063522 Ga0068864_1000635224 154
499 3300005841 Ga0068863_100000882 Ga0068863_10000088227 154
500 3300005841 Ga0068863_100006447 Ga0068863_10000644710 154
501 3300005842 Ga0068858_100000874 Ga0068858_10000087429 154
502 3300005842 Ga0068858_100045644 Ga0068858_1000456445 154
503 3300005842 Ga0068858_100163805 Ga0068858_1001638053 154
504 3300005843 Ga0068860_100024087 Ga0068860_1000240878 154
505 3300005843 Ga0068860_100040147 Ga0068860_1000401473 154
506 3300005844 Ga0068862_100064993 Ga0068862_1000649931 154
507 3300005844 Ga0068862_100223251 Ga0068862_1002232513 154
508 3300006852 Ga0075433_10008933 Ga0075433_1000893311 154
509 3300006871 Ga0075434_100385818 Ga0075434_1003858182 154
510 3300006881 Ga0068865_100171967 Ga0068865_1001719673 154
511 3300006931 Ga0097620_100007663 Ga0097620_1000076638 154
512 3300006931 Ga0097620_100101529 Ga0097620_1001015292 154
513 3300006931 Ga0097620_100186782 Ga0097620_1001867823 154
514 3300007076 Ga0075435_100177985 Ga0075435_1001779852 154
515 3300007076 Ga0075435_100441963 Ga0075435_1004419631 154
516 3300009098 Ga0105245_10060421 Ga0105245_100604213 154
517 3300009101 Ga0105247_10069037 Ga0105247_100690372 154
518 3300009148 Ga0105243_10824345 Ga0105243_108243451 154
519 3300009174 Ga0105241_10147154 Ga0105241_101471542 154
520 3300009177 Ga0105248_10000413 Ga0105248_1000041326 154
521 3300009545 Ga0105237_10088467 Ga0105237_100884674 154
522 3300009545 Ga0105237_10313488 Ga0105237_103134882 154
523 3300011119 Ga0105246_10026790 Ga0105246_100267905 154
524 3300013296 Ga0157374_10227769 Ga0157374_102277692 154
525 3300013306 Ga0163162_10144051 Ga0163162_101440512 154
526 3300013307 Ga0157372_10156824 Ga0157372_101568244 154
527 3300013308 Ga0157375_10207343 Ga0157375_102073432 154
528 3300014325 Ga0163163_10000355 Ga0163163_1000035533 154
529 3300014497 Ga0182008_10144219 Ga0182008_101442192 154
530 3300014745 Ga0157377_10012534 Ga0157377_100125342 154
531 3300014968 Ga0157379_10008315 Ga0157379_100083153 154
532 3300014968 Ga0157379_10014034 Ga0157379_100140346 154
533 3300025914 Ga0207671_10083862 Ga0207671_100838622 154
534 3300025920 Ga0207649_10110468 Ga0207649_101104682 154
535 3300025923 Ga0207681_10041224 Ga0207681_100412243 154
536 3300025923 Ga0207681_10082008 Ga0207681_100820081 154
537 3300025927 Ga0207687_10061409 Ga0207687_100614094 154
538 3300025928 Ga0207700_10021521 Ga0207700_100215216 154
539 3300025929 Ga0207664_10263844 Ga0207664_102638442 154
540 3300025933 Ga0207706_10009166 Ga0207706_100091661 154
541 3300025941 Ga0207711_10000218 Ga0207711_1000021829 154
542 3300025942 Ga0207689_10004458 Ga0207689_100044588 154
543 3300025942 Ga0207689_10081410 Ga0207689_100814102 154
544 3300025945 Ga0207679_10020084 Ga0207679_100200843 154
545 3300025949 Ga0207667_10110739 Ga0207667_101107392 154
546 3300025960 Ga0207651_10203799 Ga0207651_102037992 154
547 3300025961 Ga0207712_10075106 Ga0207712_100751062 154
548 3300025986 Ga0207658_10281680 Ga0207658_102816801 154
549 3300026023 Ga0207677_10048633 Ga0207677_100486332 154
550 3300026035 Ga0207703_10006561 Ga0207703_100065617 154
551 3300026035 Ga0207703_10042441 Ga0207703_100424411 154
552 3300026067 Ga0207678_10299349 Ga0207678_102993492 154
553 3300026088 Ga0207641_10000573 Ga0207641_1000057329 154
554 3300026088 Ga0207641_10075309 Ga0207641_100753094 154
555 3300026089 Ga0207648_10794584 Ga0207648_107945841 154
556 3300026095 Ga0207676_10000783 Ga0207676_100007836 154
557 3300026095 Ga0207676_10053238 Ga0207676_100532384 154
558 3300026116 Ga0207674_10002909 Ga0207674_100029096 154
559 3300028380 Ga0268265_10058641 Ga0268265_100586411 154
560 3300028380 Ga0268265_10103717 Ga0268265_101037173 154
561 3300028381 Ga0268264_10090510 Ga0268264_100905102 154
562 3300028381 Ga0268264_10624429 Ga0268264_106244291 154
563 3300037418 Ga0395900_0081955 Ga0395900_0081955_1357_2025 154
564 3300037466 Ga0395898_0054130 Ga0395898_0054130_422_1090 154
565 3300037471 Ga0395905_0015441 Ga0395905_0015441_5685_6353 154
566 3300037471 Ga0395905_0057463 Ga0395905_0057463_1400_2062 154
567 3300048903 Ga0496100_0052457 Ga0496100_0052457_1895_2557 154
568 3300048905 Ga0496102_0011737 Ga0496102_0011737_2805_3467 154
569 3300048906 Ga0496103_0339668 Ga0496103_0339668_210_869 154
570 3300048907 Ga0496104_0344838 Ga0496104_0344838_308_970 154
571 3300048908 Ga0496105_0109227 Ga0496105_0109227_554_1216 154
572 3300048909 Ga0496106_0051547 Ga0496106_0051547_1205_1867 154
573 3300048910 Ga0496107_0022021 Ga0496107_0022021_511_1173 154
574 3300048911 Ga0496108_0176304 Ga0496108_0176304_1168_1830 154
575 3300048914 Ga0496111_0123720 Ga0496111_0123720_517_1179 154
576 3300050512 nmdc:mga0n895_230298_c1 nmdc:mga0n895_230298_c1_265_921 154
577 3300050512 nmdc:mga0n895_898454_c1 nmdc:mga0n895_898454_c1_79_732 154
578 3300050513 nmdc:mga0rr50_439069_c1 nmdc:mga0rr50_439069_c1_11_673 154
579 3300050515 nmdc:mga0a205_2631_c1 nmdc:mga0a205_2631_c1_9977_10633 154
580 3300060346 Ga0587111_0002375 Ga0587111_0002375_99_761 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03544

TonB_C

Gram-negative bacterial TonB protein C-terminal

76

157

0.94

PF13103

TonB_2

TonB C terminal

78

148

0.82

Feature Viewer

pLDDT pTM Quality
69.51 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map